© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | Ophun1|77 |
| Gene name | |
| Location | Contig_10:46840..49483 |
| Strand | + |
| Gene length (bp) | 2643 |
| Transcript length (bp) | 1908 |
| Coding sequence length (bp) | 1908 |
| Protein length (aa) | 636 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF00153 | Mito_carr | Mitochondrial carrier protein | 8.2E-25 | 6 | 94 |
| PF00153 | Mito_carr | Mitochondrial carrier protein | 1.0E-17 | 112 | 197 |
| PF00153 | Mito_carr | Mitochondrial carrier protein | 4.5E-14 | 203 | 278 |
| PF01171 | ATP_bind_3 | PP-loop family | 1.1E-18 | 302 | 481 |
| PF16503 | zn-ribbon_14 | Zinc-ribbon | 6.7E-16 | 603 | 633 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|A2Q879|CTU1_ASPNC | Cytoplasmic tRNA 2-thiolation protein 1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=ncs6 PE=3 SV=1 | 272 | 533 | 5.0E-150 |
| sp|Q6C8R5|CTU1_YARLI | Cytoplasmic tRNA 2-thiolation protein 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=NCS6 PE=3 SV=1 | 270 | 633 | 7.0E-138 |
| sp|A3GGB3|CTU1_PICST | Cytoplasmic tRNA 2-thiolation protein 1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=NCS6 PE=3 SV=2 | 270 | 633 | 7.0E-135 |
| sp|Q5AML2|CTU1_CANAL | Cytoplasmic tRNA 2-thiolation protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NCS6 PE=3 SV=1 | 270 | 635 | 9.0E-134 |
| sp|Q6CWX6|CTU1_KLULA | Cytoplasmic tRNA 2-thiolation protein 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=NCS6 PE=3 SV=1 | 270 | 635 | 1.0E-133 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|A2Q879|CTU1_ASPNC | Cytoplasmic tRNA 2-thiolation protein 1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=ncs6 PE=3 SV=1 | 272 | 533 | 5.0E-150 |
| sp|Q6C8R5|CTU1_YARLI | Cytoplasmic tRNA 2-thiolation protein 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=NCS6 PE=3 SV=1 | 270 | 633 | 7.0E-138 |
| sp|A3GGB3|CTU1_PICST | Cytoplasmic tRNA 2-thiolation protein 1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=NCS6 PE=3 SV=2 | 270 | 633 | 7.0E-135 |
| sp|Q5AML2|CTU1_CANAL | Cytoplasmic tRNA 2-thiolation protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NCS6 PE=3 SV=1 | 270 | 635 | 9.0E-134 |
| sp|Q6CWX6|CTU1_KLULA | Cytoplasmic tRNA 2-thiolation protein 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=NCS6 PE=3 SV=1 | 270 | 635 | 1.0E-133 |
| sp|B5RV24|CTU1_DEBHA | Cytoplasmic tRNA 2-thiolation protein 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=NCS6 PE=3 SV=1 | 270 | 633 | 9.0E-133 |
| sp|A5DPQ4|CTU1_PICGU | Cytoplasmic tRNA 2-thiolation protein 1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=NCS6 PE=3 SV=2 | 270 | 633 | 1.0E-132 |
| sp|Q5FW05|CTU1_XENTR | Cytoplasmic tRNA 2-thiolation protein 1 OS=Xenopus tropicalis GN=ctu1 PE=2 SV=1 | 273 | 519 | 2.0E-125 |
| sp|A7TER7|CTU1_VANPO | Cytoplasmic tRNA 2-thiolation protein 1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=NCS6 PE=3 SV=1 | 270 | 516 | 2.0E-125 |
| sp|B0DK66|CTU1_LACBS | Cytoplasmic tRNA 2-thiolation protein 1 OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=NCS6 PE=3 SV=1 | 272 | 516 | 8.0E-125 |
| sp|Q6FMB5|CTU1_CANGA | Cytoplasmic tRNA 2-thiolation protein 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=NCS6 PE=3 SV=1 | 270 | 518 | 7.0E-124 |
| sp|Q755T1|CTU1_ASHGO | Cytoplasmic tRNA 2-thiolation protein 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=NCS6 PE=3 SV=1 | 270 | 518 | 2.0E-123 |
| sp|Q05AW7|CTU1_XENLA | Cytoplasmic tRNA 2-thiolation protein 1 OS=Xenopus laevis GN=ctu1 PE=2 SV=1 | 273 | 519 | 1.0E-122 |
| sp|O94282|CTU1_SCHPO | Cytoplasmic tRNA 2-thiolation protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ncs6 PE=1 SV=1 | 272 | 518 | 1.0E-122 |
| sp|B4LM02|CTU1_DROVI | Cytoplasmic tRNA 2-thiolation protein 1 OS=Drosophila virilis GN=GJ21203 PE=3 SV=1 | 273 | 518 | 3.0E-122 |
| sp|B4HSL7|CTU1_DROSE | Cytoplasmic tRNA 2-thiolation protein 1 OS=Drosophila sechellia GN=GM20632 PE=3 SV=1 | 273 | 518 | 6.0E-122 |
| sp|B3MI77|CTU1_DROAN | Cytoplasmic tRNA 2-thiolation protein 1 OS=Drosophila ananassae GN=GF12710 PE=3 SV=1 | 273 | 518 | 6.0E-122 |
| sp|Q7JWW5|CTU1_DROME | Cytoplasmic tRNA 2-thiolation protein 1 OS=Drosophila melanogaster GN=CG8078 PE=1 SV=1 | 273 | 518 | 7.0E-122 |
| sp|B4J5B3|CTU1_DROGR | Cytoplasmic tRNA 2-thiolation protein 1 OS=Drosophila grimshawi GN=GH20281 PE=3 SV=1 | 273 | 518 | 8.0E-122 |
| sp|B3N7L9|CTU1_DROER | Cytoplasmic tRNA 2-thiolation protein 1 OS=Drosophila erecta GN=GG10584 PE=3 SV=1 | 273 | 518 | 1.0E-121 |
| sp|B4P3W7|CTU1_DROYA | Cytoplasmic tRNA 2-thiolation protein 1 OS=Drosophila yakuba GN=GE22576 PE=3 SV=1 | 273 | 518 | 1.0E-121 |
| sp|B4KLL0|CTU1_DROMO | Cytoplasmic tRNA 2-thiolation protein 1 OS=Drosophila mojavensis GN=GI19452 PE=3 SV=1 | 273 | 518 | 2.0E-121 |
| sp|O64862|CTU1_ARATH | Cytoplasmic tRNA 2-thiolation protein 1 OS=Arabidopsis thaliana GN=NCS6 PE=2 SV=2 | 270 | 533 | 3.0E-121 |
| sp|Q6Z6G6|CTU1_ORYSJ | Cytoplasmic tRNA 2-thiolation protein 1 OS=Oryza sativa subsp. japonica GN=NCS6 PE=2 SV=1 | 259 | 533 | 2.0E-120 |
| sp|Q28ZC1|CTU1_DROPS | Cytoplasmic tRNA 2-thiolation protein 1 OS=Drosophila pseudoobscura pseudoobscura GN=GA20807 PE=3 SV=2 | 273 | 518 | 9.0E-120 |
| sp|A6ZTX8|CTU1_YEAS7 | Cytoplasmic tRNA 2-thiolation protein 1 OS=Saccharomyces cerevisiae (strain YJM789) GN=NCS6 PE=3 SV=1 | 270 | 519 | 2.0E-119 |
| sp|B3LHQ7|CTU1_YEAS1 | Cytoplasmic tRNA 2-thiolation protein 1 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=NCS6 PE=3 SV=1 | 270 | 519 | 2.0E-119 |
| sp|B4NN33|CTU1_DROWI | Cytoplasmic tRNA 2-thiolation protein 1 OS=Drosophila willistoni GN=GK22963 PE=3 SV=1 | 273 | 518 | 2.0E-119 |
| sp|P53088|CTU1_YEAST | Cytoplasmic tRNA 2-thiolation protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NCS6 PE=1 SV=3 | 270 | 519 | 2.0E-119 |
| sp|B4GHY8|CTU1_DROPE | Cytoplasmic tRNA 2-thiolation protein 1 OS=Drosophila persimilis GN=GL16852 PE=3 SV=1 | 273 | 518 | 2.0E-119 |
| sp|Q803X1|CTU1_DANRE | Cytoplasmic tRNA 2-thiolation protein 1 OS=Danio rerio GN=ctu1 PE=2 SV=1 | 273 | 519 | 2.0E-119 |
| sp|Q4P6R3|CTU1_USTMA | Cytoplasmic tRNA 2-thiolation protein 1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=NCS6 PE=3 SV=2 | 251 | 518 | 6.0E-119 |
| sp|P0CS70|CTU1_CRYNJ | Cytoplasmic tRNA 2-thiolation protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=NCS6 PE=3 SV=1 | 272 | 518 | 5.0E-118 |
| sp|P0CS71|CTU1_CRYNB | Cytoplasmic tRNA 2-thiolation protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=NCS6 PE=3 SV=1 | 272 | 518 | 5.0E-118 |
| sp|Q94480|CTU1_DICDI | Cytoplasmic tRNA 2-thiolation protein 1 OS=Dictyostelium discoideum GN=ctu1 PE=2 SV=2 | 273 | 518 | 7.0E-118 |
| sp|A8PVM6|CTU1_MALGO | Cytoplasmic tRNA 2-thiolation protein 1 OS=Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) GN=NCS6 PE=3 SV=1 | 273 | 518 | 3.0E-116 |
| sp|A8JF71|CTU1_CHLRE | Cytoplasmic tRNA 2-thiolation protein 1 OS=Chlamydomonas reinhardtii GN=NCS6 PE=3 SV=1 | 272 | 518 | 5.0E-116 |
| sp|Q99297|ODC2_YEAST | Mitochondrial 2-oxodicarboxylate carrier 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ODC2 PE=1 SV=1 | 2 | 275 | 2.0E-113 |
| sp|Q16QI1|CTU1_AEDAE | Cytoplasmic tRNA 2-thiolation protein 1 OS=Aedes aegypti GN=AAEL011283 PE=3 SV=1 | 267 | 519 | 2.0E-113 |
| sp|Q7Q9I4|CTU1_ANOGA | Cytoplasmic tRNA 2-thiolation protein 1 OS=Anopheles gambiae GN=AGAP005220 PE=3 SV=3 | 273 | 518 | 3.0E-112 |
| sp|A8WR63|CTU1_CAEBR | Cytoplasmic tRNA 2-thiolation protein 1 OS=Caenorhabditis briggsae GN=tut-1 PE=3 SV=1 | 272 | 519 | 7.0E-109 |
| sp|O76365|CTU1_CAEEL | Cytoplasmic tRNA 2-thiolation protein 1 OS=Caenorhabditis elegans GN=tut-1 PE=1 SV=1 | 272 | 519 | 1.0E-105 |
| sp|A5E3Q3|CTU1_LODEL | Cytoplasmic tRNA 2-thiolation protein 1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=NCS6 PE=3 SV=1 | 270 | 520 | 2.0E-104 |
| sp|Q9P3T7|ODC_SCHPO | Probable mitochondrial 2-oxodicarboxylate carrier OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC328.09 PE=3 SV=1 | 7 | 275 | 4.0E-103 |
| sp|Q03028|ODC1_YEAST | Mitochondrial 2-oxodicarboxylate carrier 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ODC1 PE=1 SV=1 | 4 | 275 | 5.0E-99 |
| sp|Q99J10|CTU1_MOUSE | Cytoplasmic tRNA 2-thiolation protein 1 OS=Mus musculus GN=Ctu1 PE=2 SV=1 | 273 | 516 | 1.0E-86 |
| sp|Q7Z7A3|CTU1_HUMAN | Cytoplasmic tRNA 2-thiolation protein 1 OS=Homo sapiens GN=CTU1 PE=1 SV=1 | 273 | 519 | 2.0E-86 |
| sp|Q0VC66|CTU1_BOVIN | Cytoplasmic tRNA 2-thiolation protein 1 OS=Bos taurus GN=CTU1 PE=2 SV=1 | 273 | 519 | 3.0E-86 |
| sp|B1WBV0|CTU1_RAT | Cytoplasmic tRNA 2-thiolation protein 1 OS=Rattus norvegicus GN=Ctu1 PE=2 SV=1 | 273 | 516 | 3.0E-84 |
| sp|Q55GE2|ODC_DICDI | Probable mitochondrial 2-oxodicarboxylate carrier OS=Dictyostelium discoideum GN=mcfT PE=3 SV=1 | 5 | 275 | 2.0E-82 |
| sp|Q99JD3|ODC_RAT | Mitochondrial 2-oxodicarboxylate carrier OS=Rattus norvegicus GN=Slc25a21 PE=2 SV=1 | 12 | 275 | 4.0E-50 |
| sp|Q9BQT8|ODC_HUMAN | Mitochondrial 2-oxodicarboxylate carrier OS=Homo sapiens GN=SLC25A21 PE=1 SV=1 | 12 | 275 | 2.0E-49 |
| sp|Q5RFB7|ODC_PONAB | Mitochondrial 2-oxodicarboxylate carrier OS=Pongo abelii GN=SLC25A21 PE=2 SV=1 | 12 | 275 | 5.0E-49 |
| sp|Q8BZ09|ODC_MOUSE | Mitochondrial 2-oxodicarboxylate carrier OS=Mus musculus GN=Slc25a21 PE=1 SV=1 | 12 | 275 | 3.0E-47 |
| sp|A0JN87|ODC_BOVIN | Mitochondrial 2-oxodicarboxylate carrier OS=Bos taurus GN=SLC25A21 PE=2 SV=1 | 12 | 275 | 2.0E-45 |
| sp|Q86AV5|MCFX_DICDI | Mitochondrial substrate carrier family protein X OS=Dictyostelium discoideum GN=mcfX PE=3 SV=1 | 2 | 274 | 6.0E-36 |
| sp|Q58558|Y1157_METJA | CTU1/ATPBD3 family protein MJ1157 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1157 PE=3 SV=1 | 273 | 520 | 7.0E-35 |
| sp|P79110|TXTP_BOVIN | Tricarboxylate transport protein, mitochondrial OS=Bos taurus GN=SLC25A1 PE=2 SV=1 | 15 | 291 | 7.0E-33 |
| sp|A4QNX2|S247B_DANRE | Solute carrier family 25 member 47-B OS=Danio rerio GN=slc25a47b PE=2 SV=1 | 13 | 269 | 7.0E-31 |
| sp|Q75AH6|AGC1_ASHGO | Mitochondrial aspartate-glutamate transporter AGC1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=AGC1 PE=3 SV=2 | 10 | 275 | 1.0E-30 |
| sp|P53007|TXTP_HUMAN | Tricarboxylate transport protein, mitochondrial OS=Homo sapiens GN=SLC25A1 PE=1 SV=2 | 15 | 291 | 2.0E-29 |
| sp|Q9M038|SFC1_ARATH | Mitochondrial succinate-fumarate transporter 1 OS=Arabidopsis thaliana GN=SFC1 PE=2 SV=1 | 4 | 275 | 2.0E-29 |
| sp|Q9H1K4|GHC2_HUMAN | Mitochondrial glutamate carrier 2 OS=Homo sapiens GN=SLC25A18 PE=1 SV=1 | 4 | 280 | 3.0E-29 |
| sp|Q54RB9|CMC_DICDI | Calcium-binding mitochondrial carrier protein OS=Dictyostelium discoideum GN=mcfO PE=3 SV=1 | 4 | 275 | 4.0E-29 |
| sp|O75746|CMC1_HUMAN | Calcium-binding mitochondrial carrier protein Aralar1 OS=Homo sapiens GN=SLC25A12 PE=1 SV=2 | 11 | 275 | 6.0E-29 |
| sp|Q5RBC8|CMC1_PONAB | Calcium-binding mitochondrial carrier protein Aralar1 OS=Pongo abelii GN=SLC25A12 PE=2 SV=1 | 11 | 275 | 7.0E-29 |
| sp|P97521|MCAT_RAT | Mitochondrial carnitine/acylcarnitine carrier protein OS=Rattus norvegicus GN=Slc25a20 PE=1 SV=1 | 1 | 269 | 9.0E-29 |
| sp|Q9QXX4|CMC2_MOUSE | Calcium-binding mitochondrial carrier protein Aralar2 OS=Mus musculus GN=Slc25a13 PE=1 SV=1 | 11 | 275 | 1.0E-28 |
| sp|Q12482|AGC1_YEAST | Mitochondrial aspartate-glutamate transporter AGC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AGC1 PE=3 SV=1 | 10 | 275 | 2.0E-28 |
| sp|O43772|MCAT_HUMAN | Mitochondrial carnitine/acylcarnitine carrier protein OS=Homo sapiens GN=SLC25A20 PE=1 SV=1 | 3 | 269 | 2.0E-28 |
| sp|Q505J6|GHC2_RAT | Mitochondrial glutamate carrier 2 OS=Rattus norvegicus GN=Slc25a18 PE=2 SV=2 | 4 | 280 | 2.0E-28 |
| sp|Q9VQG4|COLT_DROME | Congested-like trachea protein OS=Drosophila melanogaster GN=colt PE=2 SV=1 | 1 | 295 | 2.0E-28 |
| sp|Q8BH59|CMC1_MOUSE | Calcium-binding mitochondrial carrier protein Aralar1 OS=Mus musculus GN=Slc25a12 PE=1 SV=1 | 11 | 275 | 2.0E-28 |
| sp|Q9DB41|GHC2_MOUSE | Mitochondrial glutamate carrier 2 OS=Mus musculus GN=Slc25a18 PE=1 SV=4 | 16 | 280 | 3.0E-28 |
| sp|Q9UJS0|CMC2_HUMAN | Calcium-binding mitochondrial carrier protein Aralar2 OS=Homo sapiens GN=SLC25A13 PE=1 SV=2 | 11 | 275 | 4.0E-28 |
| sp|Q54FE6|MCFS_DICDI | Mitochondrial substrate carrier family protein S OS=Dictyostelium discoideum GN=mcfS PE=3 SV=1 | 15 | 291 | 5.0E-28 |
| sp|Q8HXY2|MCAT_MACFA | Mitochondrial carnitine/acylcarnitine carrier protein OS=Macaca fascicularis GN=SLC25A20 PE=2 SV=1 | 3 | 269 | 7.0E-28 |
| sp|Q9Z2Z6|MCAT_MOUSE | Mitochondrial carnitine/acylcarnitine carrier protein OS=Mus musculus GN=Slc25a20 PE=1 SV=1 | 3 | 269 | 7.0E-28 |
| sp|Q8JZU2|TXTP_MOUSE | Tricarboxylate transport protein, mitochondrial OS=Mus musculus GN=Slc25a1 PE=1 SV=1 | 15 | 291 | 1.0E-27 |
| sp|P32089|TXTP_RAT | Tricarboxylate transport protein, mitochondrial OS=Rattus norvegicus GN=Slc25a1 PE=1 SV=1 | 15 | 291 | 1.0E-27 |
| sp|Q9VA73|CMC_DROME | Calcium-binding mitochondrial carrier protein Aralar1 OS=Drosophila melanogaster GN=aralar1 PE=2 SV=1 | 11 | 275 | 1.0E-27 |
| sp|Q8HXW2|CMC2_MACFA | Calcium-binding mitochondrial carrier protein Aralar2 OS=Macaca fascicularis GN=SLC25A13 PE=2 SV=1 | 11 | 268 | 5.0E-27 |
| sp|Q27257|DIF1_CAEEL | Protein dif-1 OS=Caenorhabditis elegans GN=dif-1 PE=2 SV=1 | 10 | 275 | 7.0E-27 |
| sp|Q58873|Y1478_METJA | CTU1/ATPBD3 family protein MJ1478 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1478 PE=3 SV=1 | 273 | 505 | 1.0E-26 |
| sp|P33303|SFC1_YEAST | Succinate/fumarate mitochondrial transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SFC1 PE=1 SV=2 | 1 | 275 | 3.0E-26 |
| sp|Q08CI8|S238A_DANRE | Solute carrier family 25 member 38-A OS=Danio rerio GN=slc25a38a PE=2 SV=2 | 8 | 292 | 3.0E-26 |
| sp|Q5SVS4|KMCP1_HUMAN | Kidney mitochondrial carrier protein 1 OS=Homo sapiens GN=SLC25A30 PE=1 SV=1 | 1 | 275 | 5.0E-26 |
| sp|Q54BM3|MCFG_DICDI | Mitochondrial substrate carrier family protein G OS=Dictyostelium discoideum GN=mcfG PE=2 SV=1 | 15 | 279 | 8.0E-26 |
| sp|P34519|TXTP_CAEEL | Putative tricarboxylate transport protein, mitochondrial OS=Caenorhabditis elegans GN=K11H3.3 PE=3 SV=1 | 28 | 291 | 2.0E-25 |
| sp|Q8CFJ7|S2545_MOUSE | Solute carrier family 25 member 45 OS=Mus musculus GN=Slc25a45 PE=1 SV=1 | 10 | 268 | 3.0E-25 |
| sp|B0G143|UCPB_DICDI | Mitochondrial substrate carrier family protein ucpB OS=Dictyostelium discoideum GN=ucpB PE=3 SV=1 | 12 | 275 | 5.0E-25 |
| sp|Q8HXE3|KMCP1_MACFA | Kidney mitochondrial carrier protein 1 OS=Macaca fascicularis GN=SLC25A30 PE=2 SV=1 | 1 | 275 | 6.0E-25 |
| sp|Q9CR62|M2OM_MOUSE | Mitochondrial 2-oxoglutarate/malate carrier protein OS=Mus musculus GN=Slc25a11 PE=1 SV=3 | 8 | 275 | 6.0E-25 |
| sp|Q10248|YD1K_SCHPO | Uncharacterized mitochondrial carrier C4G9.20c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4G9.20c PE=3 SV=2 | 13 | 290 | 9.0E-25 |
| sp|Q08DK7|MCATL_BOVIN | Mitochondrial basic amino acids transporter OS=Bos taurus GN=SLC25A29 PE=2 SV=1 | 13 | 275 | 1.0E-24 |
| sp|Q6DJ08|S2538_XENTR | Solute carrier family 25 member 38 OS=Xenopus tropicalis GN=slc25a38 PE=2 SV=1 | 8 | 291 | 3.0E-24 |
| sp|O77792|UCP3_BOVIN | Mitochondrial uncoupling protein 3 OS=Bos taurus GN=UCP3 PE=2 SV=1 | 2 | 275 | 4.0E-24 |
| sp|Q02978|M2OM_HUMAN | Mitochondrial 2-oxoglutarate/malate carrier protein OS=Homo sapiens GN=SLC25A11 PE=1 SV=3 | 8 | 275 | 5.0E-24 |
| sp|Q9ER18|UCP1_PHOSU | Mitochondrial brown fat uncoupling protein 1 OS=Phodopus sungorus GN=UCP1 PE=2 SV=1 | 2 | 275 | 1.0E-23 |
| sp|Q6DE75|S2538_XENLA | Solute carrier family 25 member 38 OS=Xenopus laevis GN=slc25a38 PE=2 SV=1 | 8 | 291 | 1.0E-23 |
| sp|Q9CR58|KMCP1_MOUSE | Kidney mitochondrial carrier protein 1 OS=Mus musculus GN=Slc25a30 PE=1 SV=1 | 1 | 275 | 1.0E-23 |
| sp|Q8BL03|MCATL_MOUSE | Mitochondrial basic amino acids transporter OS=Mus musculus GN=Slc25a29 PE=1 SV=1 | 13 | 234 | 2.0E-23 |
| sp|Q5XGI1|KMCP1_XENTR | Kidney mitochondrial carrier protein 1 OS=Xenopus tropicalis GN=slc25a30 PE=2 SV=1 | 8 | 275 | 2.0E-23 |
| sp|Q21153|CMC1_CAEEL | Probable calcium-binding mitochondrial carrier K02F3.2 OS=Caenorhabditis elegans GN=K02F3.2 PE=3 SV=3 | 11 | 275 | 2.0E-23 |
| sp|O95258|UCP5_HUMAN | Brain mitochondrial carrier protein 1 OS=Homo sapiens GN=SLC25A14 PE=2 SV=1 | 8 | 275 | 2.0E-23 |
| sp|Q3V132|ADT4_MOUSE | ADP/ATP translocase 4 OS=Mus musculus GN=Slc25a31 PE=1 SV=1 | 6 | 275 | 3.0E-23 |
| sp|P22292|M2OM_BOVIN | Mitochondrial 2-oxoglutarate/malate carrier protein OS=Bos taurus GN=SLC25A11 PE=1 SV=3 | 8 | 275 | 3.0E-23 |
| sp|Q5HZE0|MCATL_RAT | Mitochondrial basic amino acids transporter OS=Rattus norvegicus GN=Slc25a29 PE=2 SV=1 | 13 | 234 | 4.0E-23 |
| sp|Q9Z2B2|UCP5_MOUSE | Brain mitochondrial carrier protein 1 OS=Mus musculus GN=Slc25a14 PE=1 SV=2 | 8 | 275 | 4.0E-23 |
| sp|P04633|UCP1_RAT | Mitochondrial brown fat uncoupling protein 1 OS=Rattus norvegicus GN=Ucp1 PE=1 SV=2 | 2 | 275 | 5.0E-23 |
| sp|Q6GQ22|KMCP1_XENLA | Kidney mitochondrial carrier protein 1 OS=Xenopus laevis GN=slc25a30 PE=2 SV=1 | 8 | 275 | 5.0E-23 |
| sp|Q93XM7|MCAT_ARATH | Mitochondrial carnitine/acylcarnitine carrier-like protein OS=Arabidopsis thaliana GN=BOU PE=2 SV=1 | 13 | 280 | 6.0E-23 |
| sp|Q5PQM9|KMCP1_RAT | Kidney mitochondrial carrier protein 1 OS=Rattus norvegicus GN=Slc25a30 PE=2 SV=1 | 1 | 275 | 7.0E-23 |
| sp|Q26365|ADT_DROME | ADP,ATP carrier protein OS=Drosophila melanogaster GN=sesB PE=2 SV=4 | 9 | 290 | 8.0E-23 |
| sp|O97649|UCP3_PIG | Mitochondrial uncoupling protein 3 OS=Sus scrofa GN=UCP3 PE=2 SV=1 | 6 | 275 | 9.0E-23 |
| sp|P38152|TXTP_YEAST | Tricarboxylate transport protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CTP1 PE=2 SV=3 | 10 | 275 | 1.0E-22 |
| sp|P25874|UCP1_HUMAN | Mitochondrial brown fat uncoupling protein 1 OS=Homo sapiens GN=UCP1 PE=2 SV=3 | 2 | 275 | 1.0E-22 |
| sp|Q8N8R3|MCATL_HUMAN | Mitochondrial basic amino acids transporter OS=Homo sapiens GN=SLC25A29 PE=1 SV=2 | 13 | 275 | 1.0E-22 |
| sp|Q9D6M3|GHC1_MOUSE | Mitochondrial glutamate carrier 1 OS=Mus musculus GN=Slc25a22 PE=1 SV=1 | 16 | 280 | 1.0E-22 |
| sp|Q5HZE0|MCATL_RAT | Mitochondrial basic amino acids transporter OS=Rattus norvegicus GN=Slc25a29 PE=2 SV=1 | 1 | 225 | 2.0E-22 |
| sp|P56499|UCP3_RAT | Mitochondrial uncoupling protein 3 OS=Rattus norvegicus GN=Ucp3 PE=2 SV=1 | 4 | 275 | 2.0E-22 |
| sp|P14271|UCP1_RABIT | Mitochondrial brown fat uncoupling protein 1 OS=Oryctolagus cuniculus GN=UCP1 PE=2 SV=1 | 13 | 275 | 2.0E-22 |
| sp|Q54W11|MCFL_DICDI | Mitochondrial substrate carrier family protein L OS=Dictyostelium discoideum GN=mcfL PE=3 SV=1 | 10 | 275 | 3.0E-22 |
| sp|Q54PY7|M2OM_DICDI | Probable mitochondrial 2-oxoglutarate/malate carrier protein OS=Dictyostelium discoideum GN=ucpC PE=3 SV=1 | 12 | 275 | 3.0E-22 |
| sp|Q27238|ADT1_ANOGA | ADP,ATP carrier protein 1 OS=Anopheles gambiae GN=AGAP006782 PE=2 SV=2 | 6 | 290 | 4.0E-22 |
| sp|Q7PQV7|ADT2_ANOGA | ADP,ATP carrier protein 2 OS=Anopheles gambiae GN=AGAP002358 PE=3 SV=2 | 6 | 290 | 4.0E-22 |
| sp|P97700|M2OM_RAT | Mitochondrial 2-oxoglutarate/malate carrier protein OS=Rattus norvegicus GN=Slc25a11 PE=1 SV=3 | 8 | 275 | 4.0E-22 |
| sp|Q8K404|UCP1_DICGR | Mitochondrial brown fat uncoupling protein 1 OS=Dicrostonyx groenlandicus GN=UCP1 PE=2 SV=1 | 2 | 275 | 5.0E-22 |
| sp|Q9H936|GHC1_HUMAN | Mitochondrial glutamate carrier 1 OS=Homo sapiens GN=SLC25A22 PE=1 SV=1 | 16 | 280 | 6.0E-22 |
| sp|O97562|UCP2_PIG | Mitochondrial uncoupling protein 2 OS=Sus scrofa GN=UCP2 PE=2 SV=1 | 2 | 275 | 6.0E-22 |
| sp|Q8BL03|MCATL_MOUSE | Mitochondrial basic amino acids transporter OS=Mus musculus GN=Slc25a29 PE=1 SV=1 | 1 | 200 | 1.0E-21 |
| sp|P04575|UCP1_MESAU | Mitochondrial brown fat uncoupling protein 1 OS=Mesocricetus auratus GN=UCP1 PE=1 SV=3 | 2 | 275 | 1.0E-21 |
| sp|P48962|ADT1_MOUSE | ADP/ATP translocase 1 OS=Mus musculus GN=Slc25a4 PE=1 SV=4 | 4 | 290 | 1.0E-21 |
| sp|Q08DK4|GHC1_BOVIN | Mitochondrial glutamate carrier 1 OS=Bos taurus GN=SLC25A22 PE=2 SV=1 | 16 | 280 | 2.0E-21 |
| sp|P56501|UCP3_MOUSE | Mitochondrial uncoupling protein 3 OS=Mus musculus GN=Ucp3 PE=1 SV=1 | 4 | 275 | 2.0E-21 |
| sp|O97470|ADT_DICDI | Mitochondrial substrate carrier family protein ancA OS=Dictyostelium discoideum GN=ancA PE=1 SV=1 | 16 | 275 | 3.0E-21 |
| sp|Q6QRN9|ADT3_PIG | ADP/ATP translocase 3 OS=Sus scrofa GN=SLC25A6 PE=2 SV=3 | 4 | 290 | 3.0E-21 |
| sp|Q9ZWG1|PUMP2_ARATH | Mitochondrial uncoupling protein 2 OS=Arabidopsis thaliana GN=PUMP2 PE=2 SV=1 | 1 | 275 | 3.0E-21 |
| sp|Q9SUV1|BRT1_ARATH | Adenine nucleotide transporter BT1, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=BT1 PE=1 SV=1 | 3 | 169 | 3.0E-21 |
| sp|P10861|UCP1_BOVIN | Mitochondrial brown fat uncoupling protein 1 (Fragment) OS=Bos taurus GN=UCP1 PE=2 SV=2 | 13 | 275 | 3.0E-21 |
| sp|Q2YDD9|ADT4_BOVIN | ADP/ATP translocase 4 OS=Bos taurus GN=SLC25A31 PE=2 SV=1 | 13 | 275 | 3.0E-21 |
| sp|Q9GMZ1|UCP1_CANLF | Mitochondrial brown fat uncoupling protein 1 OS=Canis lupus familiaris GN=UCP1 PE=2 SV=1 | 25 | 275 | 3.0E-21 |
| sp|P0CAT2|S238B_DANRE | Solute carrier family 25 member 38-B OS=Danio rerio GN=slc25a38b PE=3 SV=2 | 8 | 292 | 3.0E-21 |
| sp|Q5RD81|GHC1_PONAB | Mitochondrial glutamate carrier 1 OS=Pongo abelii GN=SLC25A22 PE=2 SV=1 | 16 | 280 | 3.0E-21 |
| sp|Q18P97|UCP1_SUNMU | Mitochondrial brown fat uncoupling protein 1 OS=Suncus murinus GN=UCP1 PE=2 SV=1 | 2 | 275 | 4.0E-21 |
| sp|Q9H0C2|ADT4_HUMAN | ADP/ATP translocase 4 OS=Homo sapiens GN=SLC25A31 PE=2 SV=1 | 14 | 275 | 4.0E-21 |
| sp|Q552L9|S2540_DICDI | Mitochondrial substrate carrier family protein H OS=Dictyostelium discoideum GN=mcfH PE=3 SV=1 | 14 | 283 | 5.0E-21 |
| sp|A0PC02|UCP1_OCHDA | Mitochondrial brown fat uncoupling protein 1 OS=Ochotona dauurica GN=UCP1 PE=2 SV=1 | 13 | 275 | 5.0E-21 |
| sp|Q08DK7|MCATL_BOVIN | Mitochondrial basic amino acids transporter OS=Bos taurus GN=SLC25A29 PE=2 SV=1 | 1 | 199 | 6.0E-21 |
| sp|Q86HN8|MCFY_DICDI | Mitochondrial substrate carrier family protein Y OS=Dictyostelium discoideum GN=mcfY PE=3 SV=1 | 19 | 269 | 6.0E-21 |
| sp|P12242|UCP1_MOUSE | Mitochondrial brown fat uncoupling protein 1 OS=Mus musculus GN=Ucp1 PE=1 SV=2 | 2 | 275 | 6.0E-21 |
| sp|Q8N413|S2545_HUMAN | Solute carrier family 25 member 45 OS=Homo sapiens GN=SLC25A45 PE=2 SV=2 | 10 | 234 | 6.0E-21 |
| sp|P12236|ADT3_HUMAN | ADP/ATP translocase 3 OS=Homo sapiens GN=SLC25A6 PE=1 SV=4 | 4 | 290 | 7.0E-21 |
| sp|Q96DW6|S2538_HUMAN | Solute carrier family 25 member 38 OS=Homo sapiens GN=SLC25A38 PE=1 SV=1 | 8 | 292 | 7.0E-21 |
| sp|Q6P316|S2540_XENTR | Solute carrier family 25 member 40 OS=Xenopus tropicalis GN=slc25a40 PE=2 SV=1 | 12 | 275 | 7.0E-21 |
| sp|Q4R8M0|ADT4_MACFA | ADP/ATP translocase 4 OS=Macaca fascicularis GN=SLC25A31 PE=2 SV=1 | 14 | 275 | 8.0E-21 |
| sp|Q05962|ADT1_RAT | ADP/ATP translocase 1 OS=Rattus norvegicus GN=Slc25a4 PE=1 SV=3 | 4 | 290 | 9.0E-21 |
| sp|B2MVX9|S2538_SHEEP | Solute carrier family 25 member 38 OS=Ovis aries GN=SLC25A38 PE=2 SV=1 | 8 | 292 | 1.0E-20 |
| sp|Q9P6L7|YKQ9_SCHPO | Uncharacterized mitochondrial carrier C688.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC688.09 PE=3 SV=1 | 2 | 275 | 1.0E-20 |
| sp|O46373|ADT1_RABIT | ADP/ATP translocase 1 OS=Oryctolagus cuniculus GN=SLC25A4 PE=2 SV=3 | 4 | 290 | 1.0E-20 |
| sp|P55851|UCP2_HUMAN | Mitochondrial uncoupling protein 2 OS=Homo sapiens GN=UCP2 PE=1 SV=1 | 6 | 275 | 1.0E-20 |
| sp|P38087|YMC2_YEAST | Carrier protein YMC2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMC2 PE=1 SV=1 | 15 | 277 | 2.0E-20 |
| sp|Q84UC7|BAC1_ARATH | Mitochondrial arginine transporter BAC1 OS=Arabidopsis thaliana GN=BAC1 PE=1 SV=1 | 9 | 275 | 2.0E-20 |
| sp|P31692|ADT_PARKE | ADP,ATP carrier protein OS=Parachlorella kessleri PE=3 SV=1 | 2 | 290 | 2.0E-20 |
| sp|Q6IS41|S2547_MOUSE | Solute carrier family 25 member 47 OS=Mus musculus GN=Slc25a47 PE=2 SV=2 | 13 | 275 | 2.0E-20 |
| sp|P32007|ADT3_BOVIN | ADP/ATP translocase 3 OS=Bos taurus GN=SLC25A6 PE=1 SV=3 | 4 | 290 | 2.0E-20 |
| sp|Q5R5A8|UCP2_PONAB | Mitochondrial uncoupling protein 2 OS=Pongo abelii GN=UCP2 PE=2 SV=1 | 6 | 275 | 2.0E-20 |
| sp|Q8N8R3|MCATL_HUMAN | Mitochondrial basic amino acids transporter OS=Homo sapiens GN=SLC25A29 PE=1 SV=2 | 1 | 200 | 3.0E-20 |
| sp|Q5EAC0|S2538_BOVIN | Solute carrier family 25 member 38 OS=Bos taurus GN=SLC25A38 PE=2 SV=2 | 8 | 292 | 3.0E-20 |
| sp|Q54MZ4|MCFB_DICDI | Mitochondrial substrate carrier family protein B OS=Dictyostelium discoideum GN=mcfB PE=3 SV=1 | 15 | 169 | 3.0E-20 |
| sp|Q55DY8|MFRN_DICDI | Mitoferrin OS=Dictyostelium discoideum GN=mcfF PE=3 SV=1 | 9 | 274 | 3.0E-20 |
| sp|Q54S10|MCFU_DICDI | Mitochondrial substrate carrier family protein U OS=Dictyostelium discoideum GN=mcfU PE=3 SV=1 | 12 | 269 | 4.0E-20 |
| sp|P12235|ADT1_HUMAN | ADP/ATP translocase 1 OS=Homo sapiens GN=SLC25A4 PE=1 SV=4 | 4 | 290 | 4.0E-20 |
| sp|Q9N2J1|UCP2_CANLF | Mitochondrial uncoupling protein 2 OS=Canis lupus familiaris GN=UCP2 PE=2 SV=1 | 6 | 275 | 5.0E-20 |
| sp|P02722|ADT1_BOVIN | ADP/ATP translocase 1 OS=Bos taurus GN=SLC25A4 PE=1 SV=3 | 4 | 290 | 5.0E-20 |
| sp|Q9SUV1|BRT1_ARATH | Adenine nucleotide transporter BT1, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=BT1 PE=1 SV=1 | 8 | 275 | 6.0E-20 |
| sp|P70406|UCP2_MOUSE | Mitochondrial uncoupling protein 2 OS=Mus musculus GN=Ucp2 PE=1 SV=1 | 6 | 275 | 6.0E-20 |
| sp|P56500|UCP2_RAT | Mitochondrial uncoupling protein 2 OS=Rattus norvegicus GN=Ucp2 PE=2 SV=1 | 6 | 275 | 6.0E-20 |
| sp|P55916|UCP3_HUMAN | Mitochondrial uncoupling protein 3 OS=Homo sapiens GN=UCP3 PE=1 SV=1 | 6 | 275 | 8.0E-20 |
| sp|Q9N2I9|UCP3_CANLF | Mitochondrial uncoupling protein 3 OS=Canis lupus familiaris GN=UCP3 PE=2 SV=1 | 2 | 275 | 1.0E-19 |
| sp|P18238|ADT3_YEAST | ADP,ATP carrier protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AAC3 PE=1 SV=1 | 2 | 275 | 1.0E-19 |
| sp|O81845|PUMP1_ARATH | Mitochondrial uncoupling protein 1 OS=Arabidopsis thaliana GN=PUMP1 PE=1 SV=1 | 13 | 275 | 1.0E-19 |
| sp|Q9W725|UCP2_CYPCA | Mitochondrial uncoupling protein 2 OS=Cyprinus carpio GN=ucp2 PE=2 SV=1 | 6 | 275 | 1.0E-19 |
| sp|Q9XI74|PUMP3_ARATH | Mitochondrial uncoupling protein 3 OS=Arabidopsis thaliana GN=PUMP3 PE=2 SV=1 | 26 | 275 | 2.0E-19 |
| sp|Q3SZI5|UCP2_BOVIN | Mitochondrial uncoupling protein 2 OS=Bos taurus GN=UCP2 PE=2 SV=1 | 6 | 275 | 2.0E-19 |
| sp|Q6J329|S2547_RAT | Solute carrier family 25 member 47 OS=Rattus norvegicus GN=Slc25a47 PE=2 SV=1 | 13 | 275 | 2.0E-19 |
| sp|Q8BW66|S2548_MOUSE | Solute carrier family 25 member 48 OS=Mus musculus GN=Slc25a48 PE=1 SV=2 | 13 | 234 | 3.0E-19 |
| sp|Q6DFK2|S2540_XENLA | Solute carrier family 25 member 40 OS=Xenopus laevis GN=slc25a40 PE=2 SV=1 | 12 | 275 | 3.0E-19 |
| sp|Q6ZT89|S2548_HUMAN | Solute carrier family 25 member 48 OS=Homo sapiens GN=SLC25A48 PE=1 SV=2 | 13 | 234 | 4.0E-19 |
| sp|Q8SQH5|ADT2_BOVIN | ADP/ATP translocase 2 OS=Bos taurus GN=SLC25A5 PE=2 SV=3 | 4 | 286 | 4.0E-19 |
| sp|Q6Q0C1|S2547_HUMAN | Solute carrier family 25 member 47 OS=Homo sapiens GN=SLC25A47 PE=2 SV=1 | 13 | 275 | 6.0E-19 |
| sp|P51881|ADT2_MOUSE | ADP/ATP translocase 2 OS=Mus musculus GN=Slc25a5 PE=1 SV=3 | 4 | 286 | 6.0E-19 |
| sp|O95847|UCP4_HUMAN | Mitochondrial uncoupling protein 4 OS=Homo sapiens GN=SLC25A27 PE=2 SV=1 | 3 | 275 | 7.0E-19 |
| sp|Q000K2|ADT2_TACAC | ADP/ATP translocase 2 OS=Tachyglossus aculeatus aculeatus GN=SLC25A5 PE=2 SV=1 | 4 | 286 | 8.0E-19 |
| sp|Q7XA87|FOLT1_ARATH | Folate transporter 1, chloroplastic OS=Arabidopsis thaliana GN=FOLT1 PE=2 SV=1 | 15 | 291 | 9.0E-19 |
| sp|Q5R5A1|ADT2_PONAB | ADP/ATP translocase 2 OS=Pongo abelii GN=SLC25A5 PE=2 SV=3 | 4 | 275 | 9.0E-19 |
| sp|Q09073|ADT2_RAT | ADP/ATP translocase 2 OS=Rattus norvegicus GN=Slc25a5 PE=1 SV=3 | 4 | 286 | 1.0E-18 |
| sp|Q54B67|MCFZ_DICDI | Mitochondrial substrate carrier family protein Z OS=Dictyostelium discoideum GN=mcfZ PE=2 SV=1 | 3 | 275 | 1.0E-18 |
| sp|Q94AG6|SAMC1_ARATH | S-adenosylmethionine carrier 1, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=SAMC1 PE=1 SV=1 | 7 | 204 | 1.0E-18 |
| sp|Q6DG32|S2536_DANRE | Solute carrier family 25 member 36-A OS=Danio rerio GN=slc25a36a PE=2 SV=1 | 1 | 276 | 1.0E-18 |
| sp|P05141|ADT2_HUMAN | ADP/ATP translocase 2 OS=Homo sapiens GN=SLC25A5 PE=1 SV=7 | 4 | 286 | 1.0E-18 |
| sp|P53320|MTM1_YEAST | Mitochondrial carrier protein MTM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MTM1 PE=1 SV=1 | 50 | 295 | 1.0E-18 |
| sp|Q54QN2|MCFM_DICDI | Mitochondrial substrate carrier family protein M OS=Dictyostelium discoideum GN=mcfM PE=3 SV=1 | 29 | 275 | 3.0E-18 |
| sp|O14281|YETC_SCHPO | Uncharacterized mitochondrial carrier C8C9.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC8C9.12c PE=3 SV=1 | 8 | 273 | 3.0E-18 |
| sp|Q91XD8|S2538_MOUSE | Solute carrier family 25 member 38 OS=Mus musculus GN=Slc25a38 PE=2 SV=1 | 8 | 292 | 3.0E-18 |
| sp|P04709|ADT1_MAIZE | ADP,ATP carrier protein 1, mitochondrial OS=Zea mays GN=ANT1 PE=2 SV=3 | 9 | 275 | 3.0E-18 |
| sp|P02723|ADT_NEUCR | ADP,ATP carrier protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=aac PE=3 SV=1 | 3 | 275 | 4.0E-18 |
| sp|Q922G0|S2536_MOUSE | Solute carrier family 25 member 36 OS=Mus musculus GN=Slc25a36 PE=2 SV=1 | 1 | 276 | 4.0E-18 |
| sp|Q9W720|UCP2_DANRE | Mitochondrial uncoupling protein 2 OS=Danio rerio GN=ucp2 PE=2 SV=1 | 6 | 275 | 5.0E-18 |
| sp|Q96CQ1|S2536_HUMAN | Solute carrier family 25 member 36 OS=Homo sapiens GN=SLC25A36 PE=1 SV=1 | 1 | 276 | 8.0E-18 |
| sp|Q5ZKP7|S2536_CHICK | Solute carrier family 25 member 36 OS=Gallus gallus GN=SLC25A36 PE=2 SV=1 | 1 | 276 | 9.0E-18 |
| sp|A4QNX2|S247B_DANRE | Solute carrier family 25 member 47-B OS=Danio rerio GN=slc25a47b PE=2 SV=1 | 2 | 195 | 1.0E-17 |
| sp|O13844|YFG5_SCHPO | Uncharacterized mitochondrial carrier C19G12.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC19G12.05 PE=3 SV=1 | 2 | 275 | 1.0E-17 |
| sp|Q6DHC3|S2540_DANRE | Solute carrier family 25 member 40 OS=Danio rerio GN=slc25a40 PE=2 SV=1 | 8 | 275 | 1.0E-17 |
| sp|Q1ECW7|S247A_DANRE | Solute carrier family 25 member 47-A OS=Danio rerio GN=slc25a47a PE=2 SV=1 | 13 | 234 | 1.0E-17 |
| sp|Q8TBP6|S2540_HUMAN | Solute carrier family 25 member 40 OS=Homo sapiens GN=SLC25A40 PE=1 SV=1 | 12 | 275 | 1.0E-17 |
| sp|P39953|YEA6_YEAST | Mitochondrial nicotinamide adenine dinucleotide transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YEA6 PE=1 SV=1 | 15 | 275 | 1.0E-17 |
| sp|Q29RM1|TPC_BOVIN | Mitochondrial thiamine pyrophosphate carrier OS=Bos taurus GN=SLC25A19 PE=2 SV=1 | 15 | 288 | 1.0E-17 |
| sp|P32331|YMC1_YEAST | Carrier protein YMC1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMC1 PE=3 SV=2 | 10 | 275 | 1.0E-17 |
| sp|Q9C5M0|DTC_ARATH | Mitochondrial dicarboxylate/tricarboxylate transporter DTC OS=Arabidopsis thaliana GN=DTC PE=1 SV=1 | 1 | 274 | 1.0E-17 |
| sp|P32332|OAC1_YEAST | Mitochondrial oxaloacetate transport protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OAC1 PE=1 SV=1 | 13 | 275 | 1.0E-17 |
| sp|Q9H0C2|ADT4_HUMAN | ADP/ATP translocase 4 OS=Homo sapiens GN=SLC25A31 PE=2 SV=1 | 9 | 175 | 2.0E-17 |
| sp|Q4R8M0|ADT4_MACFA | ADP/ATP translocase 4 OS=Macaca fascicularis GN=SLC25A31 PE=2 SV=1 | 9 | 175 | 2.0E-17 |
| sp|Q66L49|SCMC1_DANRE | Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Danio rerio GN=slc25a24 PE=2 SV=1 | 12 | 275 | 2.0E-17 |
| sp|Q54VX4|MCFJ_DICDI | Mitochondrial substrate carrier family protein J OS=Dictyostelium discoideum GN=mcfJ PE=2 SV=1 | 9 | 274 | 2.0E-17 |
| sp|Q94AG6|SAMC1_ARATH | S-adenosylmethionine carrier 1, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=SAMC1 PE=1 SV=1 | 3 | 273 | 3.0E-17 |
| sp|Q0VCH6|S2540_BOVIN | Solute carrier family 25 member 40 OS=Bos taurus GN=SLC25A40 PE=2 SV=1 | 12 | 275 | 3.0E-17 |
| sp|Q03829|YM39_YEAST | Uncharacterized mitochondrial carrier YMR166C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR166C PE=1 SV=1 | 2 | 274 | 4.0E-17 |
| sp|Q9SJY5|PUMP5_ARATH | Mitochondrial uncoupling protein 5 OS=Arabidopsis thaliana GN=PUMP5 PE=2 SV=1 | 13 | 277 | 5.0E-17 |
| sp|Q2YDD9|ADT4_BOVIN | ADP/ATP translocase 4 OS=Bos taurus GN=SLC25A31 PE=2 SV=1 | 9 | 175 | 6.0E-17 |
| sp|F4HT41|SAMC2_ARATH | Probable S-adenosylmethionine carrier 2, chloroplastic OS=Arabidopsis thaliana GN=SAMC2 PE=2 SV=1 | 7 | 194 | 6.0E-17 |
| sp|Q9SB52|PUMP4_ARATH | Mitochondrial uncoupling protein 4 OS=Arabidopsis thaliana GN=PUMP4 PE=2 SV=1 | 10 | 276 | 6.0E-17 |
| sp|Q76PC3|YQ73_SCHPO | Uncharacterized mitochondrial carrier C1442.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1442.03 PE=3 SV=1 | 15 | 273 | 6.0E-17 |
| sp|P12857|ADT2_MAIZE | ADP,ATP carrier protein 2, mitochondrial OS=Zea mays GN=ANT2 PE=2 SV=2 | 9 | 275 | 7.0E-17 |
| sp|Q8BGP6|S2540_MOUSE | Solute carrier family 25 member 40 OS=Mus musculus GN=Slc25a40 PE=1 SV=1 | 6 | 275 | 8.0E-17 |
| sp|Q6FTN2|DIC1_CANGA | Mitochondrial dicarboxylate transporter OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DIC1 PE=3 SV=1 | 11 | 275 | 8.0E-17 |
| sp|Q6NUK1|SCMC1_HUMAN | Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Homo sapiens GN=SLC25A24 PE=1 SV=2 | 12 | 275 | 8.0E-17 |
| sp|Q3MHI3|S2548_BOVIN | Solute carrier family 25 member 48 OS=Bos taurus GN=SLC25A48 PE=2 SV=1 | 13 | 234 | 8.0E-17 |
| sp|Q8BMD8|SCMC1_MOUSE | Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Mus musculus GN=Slc25a24 PE=1 SV=1 | 12 | 275 | 1.0E-16 |
| sp|Q52KK3|S2551_RAT | Solute carrier family 25 member 51 OS=Rattus norvegicus GN=Slc25a51 PE=2 SV=1 | 10 | 235 | 1.0E-16 |
| sp|P18239|ADT2_YEAST | ADP,ATP carrier protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PET9 PE=1 SV=2 | 9 | 275 | 1.0E-16 |
| sp|Q8CFJ7|S2545_MOUSE | Solute carrier family 25 member 45 OS=Mus musculus GN=Slc25a45 PE=1 SV=1 | 3 | 184 | 2.0E-16 |
| sp|Q498U3|S2540_RAT | Solute carrier family 25 member 40 OS=Rattus norvegicus GN=Slc25a40 PE=2 SV=2 | 12 | 275 | 2.0E-16 |
| sp|Q9P7X9|YH66_SCHPO | Uncharacterized mitochondrial carrier P23A10.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBP23A10.06 PE=3 SV=1 | 10 | 279 | 2.0E-16 |
| sp|A6RAY2|S2538_AJECN | Solute carrier family 25 member 38 homolog OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=HCAG_06120 PE=3 SV=1 | 11 | 291 | 2.0E-16 |
| sp|Q9D8K8|S2539_MOUSE | Solute carrier family 25 member 39 OS=Mus musculus GN=Slc25a39 PE=2 SV=1 | 50 | 275 | 2.0E-16 |
| sp|Q01356|ARG13_NEUCR | Amino-acid transporter arg-13 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=arg-13 PE=2 SV=1 | 16 | 237 | 2.0E-16 |
| sp|Q7SXW0|S2539_DANRE | Solute carrier family 25 member 39 OS=Danio rerio GN=slc25a39 PE=2 SV=1 | 50 | 275 | 2.0E-16 |
| sp|A5PJZ1|SCMC1_BOVIN | Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Bos taurus GN=SLC25A24 PE=2 SV=1 | 12 | 275 | 2.0E-16 |
| sp|Q8N413|S2545_HUMAN | Solute carrier family 25 member 45 OS=Homo sapiens GN=SLC25A45 PE=2 SV=2 | 3 | 169 | 3.0E-16 |
| sp|F4HT41|SAMC2_ARATH | Probable S-adenosylmethionine carrier 2, chloroplastic OS=Arabidopsis thaliana GN=SAMC2 PE=2 SV=1 | 1 | 273 | 3.0E-16 |
| sp|Q287T7|MFRN1_DANRE | Mitoferrin-1 OS=Danio rerio GN=slc25a37 PE=1 SV=1 | 12 | 273 | 3.0E-16 |
| sp|Q09461|YQ51_CAEEL | Uncharacterized mitochondrial carrier C16C10.1 OS=Caenorhabditis elegans GN=C16C10.1 PE=3 SV=2 | 12 | 275 | 3.0E-16 |
| sp|B0G159|MCFC_DICDI | Mitochondrial substrate carrier family protein C OS=Dictyostelium discoideum GN=mcfC PE=2 SV=1 | 15 | 275 | 3.0E-16 |
| sp|Q6CQR3|TPC1_KLULA | Mitochondrial thiamine pyrophosphate carrier 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TPC1 PE=3 SV=1 | 15 | 301 | 3.0E-16 |
| sp|Q7ZYD5|SCMC2_XENLA | Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Xenopus laevis GN=slc25a25 PE=2 SV=1 | 12 | 275 | 3.0E-16 |
| sp|O81845|PUMP1_ARATH | Mitochondrial uncoupling protein 1 OS=Arabidopsis thaliana GN=PUMP1 PE=1 SV=1 | 7 | 201 | 4.0E-16 |
| sp|Q5HZI9|S2551_MOUSE | Solute carrier family 25 member 51 OS=Mus musculus GN=Slc25a51 PE=1 SV=1 | 12 | 235 | 4.0E-16 |
| sp|P27080|ADT_CHLRE | ADP,ATP carrier protein OS=Chlamydomonas reinhardtii GN=ABT PE=2 SV=1 | 1 | 275 | 5.0E-16 |
| sp|Q9H1U9|S2551_HUMAN | Solute carrier family 25 member 51 OS=Homo sapiens GN=SLC25A51 PE=2 SV=1 | 12 | 235 | 5.0E-16 |
| sp|Q6GQS1|SCMC3_MOUSE | Calcium-binding mitochondrial carrier protein SCaMC-3 OS=Mus musculus GN=Slc25a23 PE=1 SV=1 | 1 | 275 | 5.0E-16 |
| sp|P10566|MRS3_YEAST | Mitochondrial RNA-splicing protein MRS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRS3 PE=1 SV=4 | 8 | 234 | 5.0E-16 |
| sp|Q9BZJ4|S2539_HUMAN | Solute carrier family 25 member 39 OS=Homo sapiens GN=SLC25A39 PE=2 SV=2 | 50 | 275 | 5.0E-16 |
| sp|Q5XH95|SCMC2_XENTR | Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Xenopus tropicalis GN=slc25a25 PE=2 SV=1 | 12 | 275 | 5.0E-16 |
| sp|P31691|ADT_ORYSJ | ADP,ATP carrier protein, mitochondrial OS=Oryza sativa subsp. japonica GN=Os02g0718900 PE=2 SV=1 | 9 | 275 | 8.0E-16 |
| sp|Q54MZ4|MCFB_DICDI | Mitochondrial substrate carrier family protein B OS=Dictyostelium discoideum GN=mcfB PE=3 SV=1 | 15 | 271 | 1.0E-15 |
| sp|A6SL61|TPC1_BOTFB | Mitochondrial thiamine pyrophosphate carrier 1 OS=Botryotinia fuckeliana (strain B05.10) GN=tpc1 PE=3 SV=1 | 15 | 269 | 2.0E-15 |
| sp|O22342|ADT1_GOSHI | ADP,ATP carrier protein 1, mitochondrial OS=Gossypium hirsutum GN=ANT1 PE=2 SV=1 | 9 | 275 | 2.0E-15 |
| sp|Q06143|DIC1_YEAST | Mitochondrial dicarboxylate transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DIC1 PE=1 SV=1 | 11 | 275 | 2.0E-15 |
| sp|Q7DNC3|MPCP1_ARATH | Mitochondrial phosphate carrier protein 1, mitochondrial OS=Arabidopsis thaliana GN=MPT1 PE=2 SV=1 | 1 | 235 | 2.0E-15 |
| sp|Q6PIV7|S2534_HUMAN | Solute carrier family 25 member 34 OS=Homo sapiens GN=SLC25A34 PE=2 SV=1 | 7 | 275 | 2.0E-15 |
| sp|Q05AQ3|S2542_XENTR | Mitochondrial coenzyme A transporter SLC25A42 OS=Xenopus tropicalis GN=slc25a42 PE=2 SV=1 | 15 | 269 | 2.0E-15 |
| sp|Q4V8K4|S2539_RAT | Solute carrier family 25 member 39 OS=Rattus norvegicus GN=Slc25a39 PE=2 SV=1 | 50 | 275 | 2.0E-15 |
| sp|O18757|SCMC1_RABIT | Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Oryctolagus cuniculus GN=SLC25A24 PE=1 SV=1 | 12 | 275 | 2.0E-15 |
| sp|Q9ZWG1|PUMP2_ARATH | Mitochondrial uncoupling protein 2 OS=Arabidopsis thaliana GN=PUMP2 PE=2 SV=1 | 7 | 194 | 3.0E-15 |
| sp|P23500|MRS4_YEAST | Mitochondrial RNA-splicing protein MRS4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRS4 PE=1 SV=1 | 8 | 234 | 3.0E-15 |
| sp|Q9RX35|TTCA_DEIRA | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=ttcA PE=3 SV=1 | 278 | 529 | 3.0E-15 |
| sp|Q41629|ADT1_WHEAT | ADP,ATP carrier protein 1, mitochondrial OS=Triticum aestivum GN=ANT-G1 PE=3 SV=1 | 9 | 275 | 3.0E-15 |
| sp|P40556|YIA6_YEAST | Mitochondrial nicotinamide adenine dinucleotide transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIA6 PE=1 SV=1 | 15 | 275 | 4.0E-15 |
| sp|Q9QZD8|DIC_MOUSE | Mitochondrial dicarboxylate carrier OS=Mus musculus GN=Slc25a10 PE=1 SV=2 | 16 | 271 | 4.0E-15 |
| sp|P40941|ADT2_ARATH | ADP,ATP carrier protein 2, mitochondrial OS=Arabidopsis thaliana GN=AAC2 PE=2 SV=2 | 9 | 275 | 4.0E-15 |
| sp|A3KPP4|S2535_DANRE | Solute carrier family 25 member 35 OS=Danio rerio GN=slc25a35 PE=2 SV=1 | 13 | 269 | 4.0E-15 |
| sp|Q5XHA0|SCMC1_XENTR | Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Xenopus tropicalis GN=slc25a24 PE=2 SV=1 | 12 | 275 | 4.0E-15 |
| sp|Q93XM7|MCAT_ARATH | Mitochondrial carnitine/acylcarnitine carrier-like protein OS=Arabidopsis thaliana GN=BOU PE=2 SV=1 | 6 | 184 | 5.0E-15 |
| sp|Q8N5S1|S2541_HUMAN | Solute carrier family 25 member 41 OS=Homo sapiens GN=SLC25A41 PE=2 SV=2 | 15 | 275 | 5.0E-15 |
| sp|P04710|ADT1_YEAST | ADP,ATP carrier protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AAC1 PE=1 SV=1 | 2 | 268 | 5.0E-15 |
| sp|Q7ZY36|SCM1A_XENLA | Calcium-binding mitochondrial carrier protein SCaMC-1-A OS=Xenopus laevis GN=slc25a24-a PE=2 SV=2 | 12 | 275 | 5.0E-15 |
| sp|O94502|YBT5_SCHPO | Uncharacterized mitochondrial carrier C12D12.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC12D12.05c PE=3 SV=2 | 10 | 177 | 6.0E-15 |
| sp|Q59Q36|TPC1_CANAL | Mitochondrial thiamine pyrophosphate carrier 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TPC1 PE=3 SV=1 | 13 | 269 | 7.0E-15 |
| sp|Q1IX43|TTCA_DEIGD | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Deinococcus geothermalis (strain DSM 11300) GN=ttcA PE=3 SV=1 | 299 | 523 | 8.0E-15 |
| sp|Q499U1|S2538_RAT | Solute carrier family 25 member 38 OS=Rattus norvegicus GN=Slc25a38 PE=2 SV=2 | 8 | 292 | 8.0E-15 |
| sp|Q76P23|PM34_DICDI | Mitochondrial substrate carrier family protein Q OS=Dictyostelium discoideum GN=mcfQ PE=2 SV=1 | 1 | 201 | 9.0E-15 |
| sp|Q55BF4|UCPA_DICDI | Mitochondrial substrate carrier family protein ucpA OS=Dictyostelium discoideum GN=ucpA PE=3 SV=1 | 13 | 275 | 1.0E-14 |
| sp|Q9BV35|SCMC3_HUMAN | Calcium-binding mitochondrial carrier protein SCaMC-3 OS=Homo sapiens GN=SLC25A23 PE=1 SV=2 | 12 | 275 | 1.0E-14 |
| sp|A7H8W2|TTCA_ANADF | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Anaeromyxobacter sp. (strain Fw109-5) GN=ttcA PE=3 SV=1 | 299 | 561 | 1.0E-14 |
| sp|Q54VS7|TPC_DICDI | Probable mitochondrial thiamine pyrophosphate carrier OS=Dictyostelium discoideum GN=mcfK PE=3 SV=1 | 3 | 281 | 1.0E-14 |
| sp|Q6KCM7|SCMC2_HUMAN | Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Homo sapiens GN=SLC25A25 PE=1 SV=1 | 12 | 275 | 1.0E-14 |
| sp|Q7T0U6|SCM1B_XENLA | Calcium-binding mitochondrial carrier protein SCaMC-1-B OS=Xenopus laevis GN=slc25a24-b PE=2 SV=1 | 12 | 275 | 1.0E-14 |
| sp|C6E087|TTCA_GEOSM | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Geobacter sp. (strain M21) GN=ttcA PE=3 SV=1 | 273 | 505 | 1.0E-14 |
| sp|B5ED57|TTCA_GEOBB | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=ttcA PE=3 SV=1 | 273 | 505 | 1.0E-14 |
| sp|P29518|BT1_MAIZE | Adenine nucleotide transporter BT1, chloroplastic/amyloplastic/mitochondrial OS=Zea mays GN=BT1 PE=1 SV=1 | 8 | 271 | 1.0E-14 |
| sp|P27081|ADT2_SOLTU | ADP,ATP carrier protein, mitochondrial (Fragment) OS=Solanum tuberosum GN=ANT1 PE=2 SV=1 | 3 | 275 | 1.0E-14 |
| sp|Q9NYZ2|MFRN1_HUMAN | Mitoferrin-1 OS=Homo sapiens GN=SLC25A37 PE=2 SV=2 | 12 | 273 | 1.0E-14 |
| sp|Q1ECW7|S247A_DANRE | Solute carrier family 25 member 47-A OS=Danio rerio GN=slc25a47a PE=2 SV=1 | 13 | 186 | 2.0E-14 |
| sp|Q5F956|TTCA_NEIG1 | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=ttcA PE=3 SV=1 | 286 | 510 | 2.0E-14 |
| sp|B5FE41|TTCA_VIBFM | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Vibrio fischeri (strain MJ11) GN=ttcA PE=3 SV=1 | 288 | 508 | 2.0E-14 |
| sp|Q5E590|TTCA_VIBF1 | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=ttcA PE=3 SV=1 | 288 | 508 | 2.0E-14 |
| sp|Q6DHS9|S2548_DANRE | Solute carrier family 25 member 48 OS=Danio rerio GN=slc25a48 PE=2 SV=1 | 13 | 268 | 2.0E-14 |
| sp|Q5U3V7|S2543_DANRE | Solute carrier family 25 member 43 OS=Danio rerio GN=slc25a43 PE=2 SV=1 | 14 | 188 | 2.0E-14 |
| sp|B4RMM2|TTCA_NEIG2 | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Neisseria gonorrhoeae (strain NCCP11945) GN=ttcA PE=3 SV=1 | 286 | 510 | 2.0E-14 |
| sp|B2T6U6|TTCA_BURPP | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=ttcA PE=3 SV=1 | 285 | 508 | 2.0E-14 |
| sp|P25083|ADT1_SOLTU | ADP,ATP carrier protein, mitochondrial OS=Solanum tuberosum GN=ANT PE=2 SV=1 | 3 | 275 | 2.0E-14 |
| sp|Q9QXX4|CMC2_MOUSE | Calcium-binding mitochondrial carrier protein Aralar2 OS=Mus musculus GN=Slc25a13 PE=1 SV=1 | 1 | 195 | 3.0E-14 |
| sp|Q9CA93|BAC2_ARATH | Mitochondrial arginine transporter BAC2 OS=Arabidopsis thaliana GN=BAC2 PE=1 SV=1 | 28 | 275 | 3.0E-14 |
| sp|A2CEQ0|SCM2B_DANRE | Calcium-binding mitochondrial carrier protein SCaMC-2-B OS=Danio rerio GN=slc25a25b PE=3 SV=2 | 12 | 275 | 3.0E-14 |
| sp|A1S6K0|TTCA_SHEAM | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=ttcA PE=3 SV=1 | 285 | 519 | 3.0E-14 |
| sp|Q1E7P0|TPC1_COCIM | Mitochondrial thiamine pyrophosphate carrier 1 OS=Coccidioides immitis (strain RS) GN=TPC1 PE=3 SV=1 | 14 | 269 | 3.0E-14 |
| sp|C3LMC8|TTCA_VIBCM | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Vibrio cholerae serotype O1 (strain M66-2) GN=ttcA PE=3 SV=1 | 288 | 566 | 3.0E-14 |
| sp|Q9KS29|TTCA_VIBCH | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=ttcA PE=3 SV=1 | 288 | 566 | 3.0E-14 |
| sp|Q13T64|TTCA_BURXL | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Burkholderia xenovorans (strain LB400) GN=ttcA PE=3 SV=1 | 285 | 508 | 3.0E-14 |
| sp|Q74GW7|TTCA_GEOSL | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=ttcA PE=3 SV=2 | 282 | 514 | 3.0E-14 |
| sp|A2ASZ8|SCMC2_MOUSE | Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Mus musculus GN=Slc25a25 PE=1 SV=1 | 12 | 275 | 3.0E-14 |
| sp|A5GBX4|TTCA_GEOUR | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Geobacter uraniireducens (strain Rf4) GN=ttcA PE=3 SV=1 | 273 | 505 | 4.0E-14 |
| sp|O04619|ADNT1_ARATH | Mitochondrial adenine nucleotide transporter ADNT1 OS=Arabidopsis thaliana GN=ADNT1 PE=2 SV=1 | 13 | 275 | 4.0E-14 |
| sp|Q8N413|S2545_HUMAN | Solute carrier family 25 member 45 OS=Homo sapiens GN=SLC25A45 PE=2 SV=2 | 129 | 276 | 5.0E-14 |
| sp|Q4WQC5|S2538_ASPFU | Solute carrier family 25 member 38 homolog OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_4G12340 PE=3 SV=1 | 11 | 291 | 5.0E-14 |
| sp|B0Y4J4|S2538_ASPFC | Solute carrier family 25 member 38 homolog OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=AFUB_069300 PE=3 SV=1 | 11 | 291 | 5.0E-14 |
| sp|Q8K3P6|SCMC2_RAT | Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Rattus norvegicus GN=Slc25a25 PE=1 SV=1 | 12 | 275 | 5.0E-14 |
| sp|P31167|ADT1_ARATH | ADP,ATP carrier protein 1, mitochondrial OS=Arabidopsis thaliana GN=AAC1 PE=1 SV=2 | 9 | 275 | 5.0E-14 |
| sp|A5F888|TTCA_VIBC3 | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=ttcA PE=3 SV=1 | 288 | 566 | 5.0E-14 |
| sp|Q0V7M4|SCMC2_BOVIN | Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Bos taurus GN=SLC25A25 PE=2 SV=1 | 12 | 275 | 6.0E-14 |
| sp|Q63Y74|TTCA_BURPS | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Burkholderia pseudomallei (strain K96243) GN=ttcA PE=3 SV=1 | 285 | 546 | 6.0E-14 |
| sp|A3N4V9|TTCA_BURP6 | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Burkholderia pseudomallei (strain 668) GN=ttcA PE=3 SV=1 | 285 | 546 | 6.0E-14 |
| sp|Q3JWX0|TTCA_BURP1 | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Burkholderia pseudomallei (strain 1710b) GN=ttcA PE=3 SV=1 | 285 | 546 | 6.0E-14 |
| sp|A3NQK2|TTCA_BURP0 | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Burkholderia pseudomallei (strain 1106a) GN=ttcA PE=3 SV=1 | 285 | 546 | 6.0E-14 |
| sp|A1V7Z5|TTCA_BURMS | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Burkholderia mallei (strain SAVP1) GN=ttcA PE=3 SV=1 | 285 | 546 | 6.0E-14 |
| sp|Q62EN9|TTCA_BURMA | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Burkholderia mallei (strain ATCC 23344) GN=ttcA PE=3 SV=1 | 285 | 546 | 6.0E-14 |
| sp|A2S7T4|TTCA_BURM9 | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Burkholderia mallei (strain NCTC 10229) GN=ttcA PE=3 SV=1 | 285 | 546 | 6.0E-14 |
| sp|A3MND8|TTCA_BURM7 | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Burkholderia mallei (strain NCTC 10247) GN=ttcA PE=3 SV=1 | 285 | 546 | 6.0E-14 |
| sp|A1CWA4|S2538_NEOFI | Solute carrier family 25 member 38 homolog OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NFIA_103940 PE=3 SV=1 | 11 | 291 | 6.0E-14 |
| sp|A9LZH0|TTCA_NEIM0 | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Neisseria meningitidis serogroup C (strain 053442) GN=ttcA PE=3 SV=2 | 286 | 510 | 6.0E-14 |
| sp|Q17QI7|S2539_BOVIN | Solute carrier family 25 member 39 OS=Bos taurus GN=SLC25A39 PE=2 SV=2 | 50 | 275 | 6.0E-14 |
| sp|P38127|RIM2_YEAST | Mitochondrial carrier protein RIM2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RIM2 PE=3 SV=1 | 8 | 275 | 6.0E-14 |
| sp|Q9BXI2|ORNT2_HUMAN | Mitochondrial ornithine transporter 2 OS=Homo sapiens GN=SLC25A2 PE=1 SV=3 | 29 | 198 | 6.0E-14 |
| sp|Q5PQ27|S2542_XENLA | Mitochondrial coenzyme A transporter SLC25A42 OS=Xenopus laevis GN=slc25a42 PE=2 SV=1 | 13 | 269 | 6.0E-14 |
| sp|Q6ZT89|S2548_HUMAN | Solute carrier family 25 member 48 OS=Homo sapiens GN=SLC25A48 PE=1 SV=2 | 15 | 184 | 7.0E-14 |
| sp|Q9Y619|ORNT1_HUMAN | Mitochondrial ornithine transporter 1 OS=Homo sapiens GN=SLC25A15 PE=1 SV=1 | 15 | 275 | 7.0E-14 |
| sp|Q6NYZ6|SCM2A_DANRE | Calcium-binding mitochondrial carrier protein SCaMC-2-A OS=Danio rerio GN=slc25a25a PE=2 SV=1 | 12 | 275 | 7.0E-14 |
| sp|P18238|ADT3_YEAST | ADP,ATP carrier protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AAC3 PE=1 SV=1 | 9 | 194 | 8.0E-14 |
| sp|B0G159|MCFC_DICDI | Mitochondrial substrate carrier family protein C OS=Dictyostelium discoideum GN=mcfC PE=2 SV=1 | 12 | 175 | 8.0E-14 |
| sp|Q9CA93|BAC2_ARATH | Mitochondrial arginine transporter BAC2 OS=Arabidopsis thaliana GN=BAC2 PE=1 SV=1 | 16 | 184 | 8.0E-14 |
| sp|A4RF23|TPC1_MAGO7 | Mitochondrial thiamine pyrophosphate carrier 1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=TPC1 PE=3 SV=2 | 15 | 277 | 8.0E-14 |
| sp|Q82UJ4|TTCA_NITEU | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=ttcA PE=3 SV=1 | 290 | 505 | 8.0E-14 |
| sp|Q55E85|MCFD_DICDI | Mitochondrial substrate carrier family protein D OS=Dictyostelium discoideum GN=mcfD PE=3 SV=1 | 13 | 275 | 9.0E-14 |
| sp|Q2YBQ4|TTCA_NITMU | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=ttcA PE=3 SV=1 | 290 | 510 | 9.0E-14 |
| sp|A5DX39|TPC1_LODEL | Mitochondrial thiamine pyrophosphate carrier 1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=TPC1 PE=3 SV=1 | 8 | 297 | 9.0E-14 |
| sp|Q27257|DIF1_CAEEL | Protein dif-1 OS=Caenorhabditis elegans GN=dif-1 PE=2 SV=1 | 2 | 186 | 1.0E-13 |
| sp|Q9WVD5|ORNT1_MOUSE | Mitochondrial ornithine transporter 1 OS=Mus musculus GN=Slc25a15 PE=1 SV=1 | 15 | 275 | 1.0E-13 |
| sp|O59674|YB8B_SCHPO | Uncharacterized mitochondrial carrier C29A3.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC29A3.11c PE=3 SV=1 | 13 | 283 | 1.0E-13 |
| sp|Q39QC5|TTCA_GEOMG | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=ttcA PE=3 SV=2 | 282 | 514 | 1.0E-13 |
| sp|A5WG99|TTCA_PSYWF | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Psychrobacter sp. (strain PRwf-1) GN=ttcA PE=3 SV=1 | 286 | 519 | 1.0E-13 |
| sp|A1IS67|TTCA_NEIMA | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=ttcA PE=3 SV=1 | 286 | 510 | 1.0E-13 |
| sp|Q54EV4|MCFA_DICDI | Mitochondrial substrate carrier family protein A OS=Dictyostelium discoideum GN=mcfA PE=3 SV=1 | 13 | 275 | 1.0E-13 |
| sp|Q55E45|MCFE_DICDI | Mitochondrial substrate carrier family protein E OS=Dictyostelium discoideum GN=mcfE PE=3 SV=1 | 16 | 268 | 1.0E-13 |
| sp|Q8CFJ7|S2545_MOUSE | Solute carrier family 25 member 45 OS=Mus musculus GN=Slc25a45 PE=1 SV=1 | 129 | 276 | 2.0E-13 |
| sp|Q5U3V7|S2543_DANRE | Solute carrier family 25 member 43 OS=Danio rerio GN=slc25a43 PE=2 SV=1 | 19 | 269 | 2.0E-13 |
| sp|Q47ZU5|TTCA_COLP3 | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=ttcA PE=3 SV=1 | 286 | 510 | 2.0E-13 |
| sp|Q6BPW0|TPC1_DEBHA | Mitochondrial thiamine pyrophosphate carrier 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=TPC1 PE=3 SV=3 | 15 | 277 | 2.0E-13 |
| sp|A3QEG3|TTCA_SHELP | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=ttcA PE=3 SV=1 | 285 | 526 | 2.0E-13 |
| sp|A9HY25|TTCA_BORPD | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=ttcA PE=3 SV=1 | 285 | 557 | 2.0E-13 |
| sp|Q0P483|S2542_DANRE | Mitochondrial coenzyme A transporter SLC25A42 OS=Danio rerio GN=slc25a42 PE=2 SV=1 | 15 | 269 | 2.0E-13 |
| sp|A1CIF6|S2538_ASPCL | Solute carrier family 25 member 38 homolog OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ACLA_051330 PE=3 SV=1 | 11 | 291 | 2.0E-13 |
| sp|Q41630|ADT2_WHEAT | ADP,ATP carrier protein 2, mitochondrial OS=Triticum aestivum GN=ANT-G2 PE=3 SV=1 | 9 | 275 | 2.0E-13 |
| sp|A1RJP0|TTCA_SHESW | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Shewanella sp. (strain W3-18-1) GN=ttcA PE=3 SV=1 | 285 | 519 | 2.0E-13 |
| sp|A4Y6T9|TTCA_SHEPC | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=ttcA PE=3 SV=1 | 285 | 519 | 2.0E-13 |
| sp|Q1CZQ8|TTCA_MYXXD | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Myxococcus xanthus (strain DK 1622) GN=ttcA PE=3 SV=1 | 290 | 510 | 2.0E-13 |
| sp|Q6C6I3|S2538_YARLI | Solute carrier family 25 member 38 homolog OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0E09284g PE=3 SV=1 | 15 | 275 | 2.0E-13 |
| sp|A7ER02|TPC1_SCLS1 | Mitochondrial thiamine pyrophosphate carrier 1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=tpc1 PE=3 SV=1 | 15 | 269 | 2.0E-13 |
| sp|Q5IS35|TPC_MACFA | Mitochondrial thiamine pyrophosphate carrier OS=Macaca fascicularis GN=SLC25A19 PE=2 SV=1 | 15 | 282 | 2.0E-13 |
| sp|Q54FE6|MCFS_DICDI | Mitochondrial substrate carrier family protein S OS=Dictyostelium discoideum GN=mcfS PE=3 SV=1 | 114 | 276 | 3.0E-13 |
| sp|Q9CR58|KMCP1_MOUSE | Kidney mitochondrial carrier protein 1 OS=Mus musculus GN=Slc25a30 PE=1 SV=1 | 16 | 193 | 3.0E-13 |
| sp|Q3MHI3|S2548_BOVIN | Solute carrier family 25 member 48 OS=Bos taurus GN=SLC25A48 PE=2 SV=1 | 15 | 184 | 3.0E-13 |
| sp|Q05AQ3|S2542_XENTR | Mitochondrial coenzyme A transporter SLC25A42 OS=Xenopus tropicalis GN=slc25a42 PE=2 SV=1 | 112 | 309 | 3.0E-13 |
| sp|Q9UBX3|DIC_HUMAN | Mitochondrial dicarboxylate carrier OS=Homo sapiens GN=SLC25A10 PE=1 SV=2 | 16 | 271 | 3.0E-13 |
| sp|Q66H23|MFRN1_RAT | Mitoferrin-1 OS=Rattus norvegicus GN=Slc25a37 PE=2 SV=1 | 12 | 273 | 3.0E-13 |
| sp|Q8WUT9|S2543_HUMAN | Solute carrier family 25 member 43 OS=Homo sapiens GN=SLC25A43 PE=2 SV=2 | 15 | 188 | 3.0E-13 |
| sp|A1B0E2|TTCA_PARDP | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Paracoccus denitrificans (strain Pd 1222) GN=ttcA PE=3 SV=1 | 285 | 510 | 3.0E-13 |
| sp|Q1DRJ3|S2538_COCIM | Solute carrier family 25 member 38 homolog OS=Coccidioides immitis (strain RS) GN=CIMG_07070 PE=3 SV=1 | 11 | 291 | 3.0E-13 |
| sp|Q0CT66|S2538_ASPTN | Solute carrier family 25 member 38 homolog OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ATEG_03118 PE=3 SV=1 | 11 | 291 | 3.0E-13 |
| sp|O49447|ADT3_ARATH | ADP,ATP carrier protein 3, mitochondrial OS=Arabidopsis thaliana GN=AAC3 PE=2 SV=1 | 2 | 275 | 3.0E-13 |
| sp|O43772|MCAT_HUMAN | Mitochondrial carnitine/acylcarnitine carrier protein OS=Homo sapiens GN=SLC25A20 PE=1 SV=1 | 13 | 184 | 4.0E-13 |
| sp|Q9UJS0|CMC2_HUMAN | Calcium-binding mitochondrial carrier protein Aralar2 OS=Homo sapiens GN=SLC25A13 PE=1 SV=2 | 1 | 195 | 4.0E-13 |
| sp|Q54PY7|M2OM_DICDI | Probable mitochondrial 2-oxoglutarate/malate carrier protein OS=Dictyostelium discoideum GN=ucpC PE=3 SV=1 | 104 | 307 | 4.0E-13 |
| sp|Q7XA87|FOLT1_ARATH | Folate transporter 1, chloroplastic OS=Arabidopsis thaliana GN=FOLT1 PE=2 SV=1 | 12 | 201 | 4.0E-13 |
| sp|A4SMC4|TTCA_AERS4 | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Aeromonas salmonicida (strain A449) GN=ttcA PE=3 SV=1 | 286 | 510 | 4.0E-13 |
| sp|B2UD46|TTCA_RALPJ | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Ralstonia pickettii (strain 12J) GN=ttcA PE=3 SV=1 | 282 | 543 | 4.0E-13 |
| sp|A9MQT5|TTCA_SALAR | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=ttcA PE=3 SV=1 | 286 | 514 | 4.0E-13 |
| sp|Q7N3Y7|TTCA_PHOLL | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=ttcA PE=3 SV=1 | 285 | 519 | 4.0E-13 |
| sp|Q920G8|MFRN1_MOUSE | Mitoferrin-1 OS=Mus musculus GN=Slc25a37 PE=1 SV=1 | 12 | 273 | 4.0E-13 |
| sp|Q0II44|S2541_BOVIN | Solute carrier family 25 member 41 OS=Bos taurus GN=SLC25A41 PE=2 SV=1 | 15 | 259 | 4.0E-13 |
| sp|P23641|MPCP_YEAST | Mitochondrial phosphate carrier protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MIR1 PE=1 SV=1 | 15 | 243 | 4.0E-13 |
| sp|Q54BF6|MCFN_DICDI | Mitochondrial substrate carrier family protein N OS=Dictyostelium discoideum GN=mcfN PE=1 SV=2 | 11 | 274 | 4.0E-13 |
| sp|Q320D9|TTCA_SHIBS | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Shigella boydii serotype 4 (strain Sb227) GN=ttcA PE=3 SV=1 | 286 | 557 | 4.0E-13 |
| sp|Q476S4|TTCA_CUPPJ | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=ttcA PE=3 SV=1 | 299 | 514 | 4.0E-13 |
| sp|Q96A46|MFRN2_HUMAN | Mitoferrin-2 OS=Homo sapiens GN=SLC25A28 PE=2 SV=1 | 12 | 273 | 4.0E-13 |
| sp|Q83KS7|TTCA_SHIFL | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Shigella flexneri GN=ttcA PE=3 SV=1 | 286 | 557 | 4.0E-13 |
| sp|Q0T3Z1|TTCA_SHIF8 | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Shigella flexneri serotype 5b (strain 8401) GN=ttcA PE=3 SV=1 | 286 | 557 | 4.0E-13 |
| sp|Q9ZWG1|PUMP2_ARATH | Mitochondrial uncoupling protein 2 OS=Arabidopsis thaliana GN=PUMP2 PE=2 SV=1 | 112 | 296 | 5.0E-13 |
| sp|P18239|ADT2_YEAST | ADP,ATP carrier protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PET9 PE=1 SV=2 | 9 | 194 | 5.0E-13 |
| sp|A1KU93|TTCA_NEIMF | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=ttcA PE=3 SV=1 | 286 | 510 | 5.0E-13 |
| sp|Q3Z194|TTCA_SHISS | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Shigella sonnei (strain Ss046) GN=ttcA PE=3 SV=1 | 286 | 557 | 5.0E-13 |
| sp|B6IA61|TTCA_ECOSE | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Escherichia coli (strain SE11) GN=ttcA PE=3 SV=1 | 286 | 557 | 5.0E-13 |
| sp|Q8X8Q5|TTCA_ECO57 | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Escherichia coli O157:H7 GN=ttcA PE=3 SV=1 | 286 | 557 | 5.0E-13 |
| sp|Q9FM86|ADT5_ARATH | Probable ADP,ATP carrier protein At5g56450 OS=Arabidopsis thaliana GN=At5g56450 PE=2 SV=1 | 12 | 175 | 5.0E-13 |
| sp|Q86I81|MCFI_DICDI | Mitochondrial substrate carrier family protein I OS=Dictyostelium discoideum GN=mcfI PE=2 SV=1 | 12 | 282 | 5.0E-13 |
| sp|Q5XIF9|S2534_RAT | Solute carrier family 25 member 34 OS=Rattus norvegicus GN=Slc25a34 PE=2 SV=2 | 16 | 275 | 5.0E-13 |
| sp|Q7MKU7|TTCA_VIBVY | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Vibrio vulnificus (strain YJ016) GN=ttcA PE=3 SV=1 | 288 | 582 | 5.0E-13 |
| sp|B7N4F3|TTCA_ECOLU | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=ttcA PE=3 SV=1 | 286 | 557 | 5.0E-13 |
| sp|P76055|TTCA_ECOLI | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Escherichia coli (strain K12) GN=ttcA PE=1 SV=1 | 286 | 557 | 5.0E-13 |
| sp|B1ISR7|TTCA_ECOLC | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=ttcA PE=3 SV=1 | 286 | 557 | 5.0E-13 |
| sp|A7ZZT7|TTCA_ECOHS | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Escherichia coli O9:H4 (strain HS) GN=ttcA PE=3 SV=1 | 286 | 557 | 5.0E-13 |
| sp|B1XCH3|TTCA_ECODH | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Escherichia coli (strain K12 / DH10B) GN=ttcA PE=3 SV=1 | 286 | 557 | 5.0E-13 |
| sp|C4ZV92|TTCA_ECOBW | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=ttcA PE=3 SV=1 | 286 | 557 | 5.0E-13 |
| sp|B7LYL5|TTCA_ECO8A | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Escherichia coli O8 (strain IAI1) GN=ttcA PE=3 SV=1 | 286 | 557 | 5.0E-13 |
| sp|B5Z0R4|TTCA_ECO5E | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=ttcA PE=3 SV=1 | 286 | 557 | 5.0E-13 |
| sp|A7ZLH4|TTCA_ECO24 | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=ttcA PE=3 SV=1 | 286 | 557 | 5.0E-13 |
| sp|Q9Z2Z6|MCAT_MOUSE | Mitochondrial carnitine/acylcarnitine carrier protein OS=Mus musculus GN=Slc25a20 PE=1 SV=1 | 2 | 184 | 6.0E-13 |
| sp|O77792|UCP3_BOVIN | Mitochondrial uncoupling protein 3 OS=Bos taurus GN=UCP3 PE=2 SV=1 | 15 | 194 | 6.0E-13 |
| sp|Q8Y306|TTCA_RALSO | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Ralstonia solanacearum (strain GMI1000) GN=ttcA PE=3 SV=1 | 299 | 543 | 6.0E-13 |
| sp|Q4UNZ5|TTCA_XANC8 | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Xanthomonas campestris pv. campestris (strain 8004) GN=ttcA PE=3 SV=1 | 282 | 544 | 6.0E-13 |
| sp|B7L5B2|TTCA_ECO55 | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Escherichia coli (strain 55989 / EAEC) GN=ttcA PE=3 SV=1 | 286 | 557 | 6.0E-13 |
| sp|Q12N51|TTCA_SHEDO | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=ttcA PE=3 SV=1 | 253 | 526 | 6.0E-13 |
| sp|Q39C93|TTCA_BURL3 | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=ttcA PE=3 SV=1 | 285 | 523 | 6.0E-13 |
| sp|Q6D5P6|TTCA_PECAS | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=ttcA PE=3 SV=1 | 286 | 508 | 6.0E-13 |
| sp|Q55E45|MCFE_DICDI | Mitochondrial substrate carrier family protein E OS=Dictyostelium discoideum GN=mcfE PE=3 SV=1 | 111 | 274 | 7.0E-13 |
| sp|Q32GI6|TTCA_SHIDS | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=ttcA PE=3 SV=1 | 286 | 557 | 7.0E-13 |
| sp|A4WAT7|TTCA_ENT38 | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Enterobacter sp. (strain 638) GN=ttcA PE=3 SV=1 | 286 | 508 | 7.0E-13 |
| sp|Q2T1V1|TTCA_BURTA | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=ttcA PE=3 SV=1 | 285 | 553 | 7.0E-13 |
| sp|P38988|GGC1_YEAST | Mitochondrial GTP/GDP carrier protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GGC1 PE=1 SV=1 | 17 | 274 | 7.0E-13 |
| sp|Q3SZI5|UCP2_BOVIN | Mitochondrial uncoupling protein 2 OS=Bos taurus GN=UCP2 PE=2 SV=1 | 15 | 201 | 8.0E-13 |
| sp|Q9FM86|ADT5_ARATH | Probable ADP,ATP carrier protein At5g56450 OS=Arabidopsis thaliana GN=At5g56450 PE=2 SV=1 | 9 | 286 | 8.0E-13 |
| sp|Q8D9J0|TTCA_VIBVU | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Vibrio vulnificus (strain CMCP6) GN=ttcA PE=3 SV=1 | 288 | 582 | 8.0E-13 |
| sp|Q603C7|TTCA_METCA | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=ttcA PE=3 SV=1 | 299 | 519 | 8.0E-13 |
| sp|Q9JZJ6|TTCA_NEIMB | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Neisseria meningitidis serogroup B (strain MC58) GN=ttcA PE=1 SV=1 | 294 | 510 | 8.0E-13 |
| sp|Q9N2J1|UCP2_CANLF | Mitochondrial uncoupling protein 2 OS=Canis lupus familiaris GN=UCP2 PE=2 SV=1 | 15 | 194 | 9.0E-13 |
| sp|Q7WEL6|TTCA_BORBR | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=ttcA PE=3 SV=1 | 285 | 550 | 9.0E-13 |
| sp|Q6PH61|S2534_DANRE | Solute carrier family 25 member 34 OS=Danio rerio GN=slc25a34 PE=2 SV=1 | 13 | 275 | 9.0E-13 |
| sp|Q9M038|SFC1_ARATH | Mitochondrial succinate-fumarate transporter 1 OS=Arabidopsis thaliana GN=SFC1 PE=2 SV=1 | 12 | 195 | 1.0E-12 |
| sp|Q8HXW2|CMC2_MACFA | Calcium-binding mitochondrial carrier protein Aralar2 OS=Macaca fascicularis GN=SLC25A13 PE=2 SV=1 | 1 | 195 | 1.0E-12 |
| sp|P56501|UCP3_MOUSE | Mitochondrial uncoupling protein 3 OS=Mus musculus GN=Ucp3 PE=1 SV=1 | 15 | 194 | 1.0E-12 |
| sp|O81845|PUMP1_ARATH | Mitochondrial uncoupling protein 1 OS=Arabidopsis thaliana GN=PUMP1 PE=1 SV=1 | 106 | 299 | 1.0E-12 |
| sp|Q9W725|UCP2_CYPCA | Mitochondrial uncoupling protein 2 OS=Cyprinus carpio GN=ucp2 PE=2 SV=1 | 12 | 205 | 1.0E-12 |
| sp|Q9HC21|TPC_HUMAN | Mitochondrial thiamine pyrophosphate carrier OS=Homo sapiens GN=SLC25A19 PE=1 SV=1 | 15 | 282 | 1.0E-12 |
| sp|A2R5A0|TPC1_ASPNC | Mitochondrial thiamine pyrophosphate carrier 1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=tpc1 PE=3 SV=1 | 15 | 269 | 1.0E-12 |
| sp|C0Q3V6|TTCA_SALPC | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Salmonella paratyphi C (strain RKS4594) GN=ttcA PE=3 SV=1 | 286 | 508 | 1.0E-12 |
| sp|Q57P06|TTCA_SALCH | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Salmonella choleraesuis (strain SC-B67) GN=ttcA PE=3 SV=1 | 286 | 508 | 1.0E-12 |
| sp|B7NHP6|TTCA_ECO7I | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=ttcA PE=3 SV=1 | 286 | 557 | 1.0E-12 |
| sp|Q8P3H2|TTCA_XANCP | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=ttcA PE=3 SV=1 | 282 | 544 | 1.0E-12 |
| sp|B0RYY8|TTCA_XANCB | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Xanthomonas campestris pv. campestris (strain B100) GN=ttcA PE=3 SV=2 | 282 | 544 | 1.0E-12 |
| sp|Q7W398|TTCA_BORPA | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=ttcA PE=3 SV=1 | 285 | 550 | 1.0E-12 |
| sp|Q5SWT3|S2535_MOUSE | Solute carrier family 25 member 35 OS=Mus musculus GN=Slc25a35 PE=1 SV=2 | 13 | 268 | 1.0E-12 |
| sp|Q12251|YP011_YEAST | Uncharacterized mitochondrial carrier YPR011C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPR011C PE=1 SV=1 | 13 | 269 | 1.0E-12 |
| sp|A0KB51|TTCA_BURCH | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Burkholderia cenocepacia (strain HI2424) GN=ttcA PE=3 SV=1 | 285 | 523 | 1.0E-12 |
| sp|Q1BSY9|TTCA_BURCA | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Burkholderia cenocepacia (strain AU 1054) GN=ttcA PE=3 SV=1 | 285 | 523 | 1.0E-12 |
| sp|Q8BVN7|S2541_MOUSE | Solute carrier family 25 member 41 OS=Mus musculus GN=Slc25a41 PE=2 SV=1 | 15 | 275 | 1.0E-12 |
| sp|B1JZU7|TTCA_BURCC | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Burkholderia cenocepacia (strain MC0-3) GN=ttcA PE=3 SV=1 | 285 | 523 | 1.0E-12 |
| sp|A4JIF6|TTCA_BURVG | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=ttcA PE=3 SV=1 | 285 | 508 | 1.0E-12 |
| sp|B4TIS7|TTCA_SALHS | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Salmonella heidelberg (strain SL476) GN=ttcA PE=3 SV=1 | 286 | 508 | 1.0E-12 |
| sp|Q8Z783|TTCA_SALTI | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Salmonella typhi GN=ttcA PE=3 SV=1 | 286 | 508 | 1.0E-12 |
| sp|B4T6P5|TTCA_SALNS | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Salmonella newport (strain SL254) GN=ttcA PE=3 SV=1 | 286 | 508 | 1.0E-12 |
| sp|B5RA25|TTCA_SALG2 | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=ttcA PE=3 SV=1 | 286 | 508 | 1.0E-12 |
| sp|B5R4D8|TTCA_SALEP | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Salmonella enteritidis PT4 (strain P125109) GN=ttcA PE=3 SV=1 | 286 | 508 | 1.0E-12 |
| sp|B5FUP1|TTCA_SALDC | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Salmonella dublin (strain CT_02021853) GN=ttcA PE=3 SV=1 | 286 | 508 | 1.0E-12 |
| sp|Q9FMU6|MPCP3_ARATH | Mitochondrial phosphate carrier protein 3, mitochondrial OS=Arabidopsis thaliana GN=MPT3 PE=2 SV=1 | 25 | 235 | 1.0E-12 |
| sp|A6T3N1|TTCA_JANMA | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Janthinobacterium sp. (strain Marseille) GN=ttcA PE=3 SV=1 | 285 | 514 | 1.0E-12 |
| sp|Q5NVC1|TPC_PONAB | Mitochondrial thiamine pyrophosphate carrier OS=Pongo abelii GN=SLC25A19 PE=2 SV=1 | 15 | 282 | 1.0E-12 |
| sp|P49382|ADT_KLULA | ADP,ATP carrier protein OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=AAC PE=3 SV=1 | 2 | 275 | 1.0E-12 |
| sp|Q7VU56|TTCA_BORPE | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=ttcA PE=3 SV=1 | 285 | 550 | 1.0E-12 |
| sp|B9KNZ4|TTCA_RHOSK | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=ttcA PE=3 SV=1 | 284 | 510 | 1.0E-12 |
| sp|A3PNA9|TTCA_RHOS1 | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=ttcA PE=3 SV=1 | 284 | 510 | 1.0E-12 |
| sp|Q5SVS4|KMCP1_HUMAN | Kidney mitochondrial carrier protein 1 OS=Homo sapiens GN=SLC25A30 PE=1 SV=1 | 3 | 193 | 2.0E-12 |
| sp|P56500|UCP2_RAT | Mitochondrial uncoupling protein 2 OS=Rattus norvegicus GN=Ucp2 PE=2 SV=1 | 15 | 201 | 2.0E-12 |
| sp|Q9N2I9|UCP3_CANLF | Mitochondrial uncoupling protein 3 OS=Canis lupus familiaris GN=UCP3 PE=2 SV=1 | 15 | 194 | 2.0E-12 |
| sp|Q9WVD5|ORNT1_MOUSE | Mitochondrial ornithine transporter 1 OS=Mus musculus GN=Slc25a15 PE=1 SV=1 | 25 | 194 | 2.0E-12 |
| sp|Q8LB08|ADT4_ARATH | ADP,ATP carrier protein ER-ANT1 OS=Arabidopsis thaliana GN=ER-ANT1 PE=2 SV=2 | 50 | 268 | 2.0E-12 |
| sp|Q3A6S7|TTCA_PELCD | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=ttcA PE=3 SV=1 | 294 | 510 | 2.0E-12 |
| sp|Q3IYY8|TTCA_RHOS4 | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=ttcA PE=3 SV=1 | 284 | 510 | 2.0E-12 |
| sp|A9AKB0|TTCA_BURM1 | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=ttcA PE=3 SV=1 | 285 | 508 | 2.0E-12 |
| sp|Q8ZP88|TTCA_SALTY | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ttcA PE=1 SV=1 | 286 | 508 | 2.0E-12 |
| sp|B5F5C0|TTCA_SALA4 | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Salmonella agona (strain SL483) GN=ttcA PE=3 SV=1 | 286 | 508 | 2.0E-12 |
| sp|Q1RC21|TTCA_ECOUT | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Escherichia coli (strain UTI89 / UPEC) GN=ttcA PE=3 SV=1 | 286 | 557 | 2.0E-12 |
| sp|Q8FHP6|TTCA_ECOL6 | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ttcA PE=3 SV=1 | 286 | 557 | 2.0E-12 |
| sp|Q0TI22|TTCA_ECOL5 | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=ttcA PE=3 SV=1 | 286 | 557 | 2.0E-12 |
| sp|B7MUI7|TTCA_ECO81 | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Escherichia coli O81 (strain ED1a) GN=ttcA PE=3 SV=1 | 286 | 557 | 2.0E-12 |
| sp|B7MM21|TTCA_ECO45 | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=ttcA PE=3 SV=1 | 286 | 557 | 2.0E-12 |
| sp|B0TY35|TTCA1_FRAP2 | tRNA 2-thiocytidine biosynthesis protein TtcA 1 OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=ttcA1 PE=3 SV=1 | 279 | 514 | 2.0E-12 |
| sp|A9MXN4|TTCA_SALPB | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=ttcA PE=3 SV=1 | 286 | 508 | 2.0E-12 |
| sp|A1AAV5|TTCA_ECOK1 | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Escherichia coli O1:K1 / APEC GN=ttcA PE=3 SV=1 | 286 | 557 | 2.0E-12 |
| sp|B6ELU0|TTCA_ALISL | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Aliivibrio salmonicida (strain LFI1238) GN=ttcA PE=3 SV=1 | 290 | 470 | 2.0E-12 |
| sp|B4TWA6|TTCA_SALSV | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Salmonella schwarzengrund (strain CVM19633) GN=ttcA PE=3 SV=1 | 286 | 508 | 2.0E-12 |
| sp|B5BJ71|TTCA_SALPK | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Salmonella paratyphi A (strain AKU_12601) GN=ttcA PE=3 SV=1 | 286 | 508 | 2.0E-12 |
| sp|Q5PHS1|TTCA_SALPA | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=ttcA PE=3 SV=1 | 286 | 508 | 2.0E-12 |
| sp|B1LG84|TTCA_ECOSM | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=ttcA PE=3 SV=1 | 286 | 557 | 2.0E-12 |
| sp|C6DJ78|TTCA_PECCP | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=ttcA PE=3 SV=1 | 286 | 508 | 2.0E-12 |
| sp|B7LRU9|TTCA_ESCF3 | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=ttcA PE=3 SV=1 | 286 | 548 | 2.0E-12 |
| sp|A2A3V2|S2543_MOUSE | Solute carrier family 25 member 43 OS=Mus musculus GN=Slc25a43 PE=2 SV=1 | 16 | 190 | 2.0E-12 |
| sp|B2U0Z1|TTCA_SHIB3 | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=ttcA PE=3 SV=1 | 286 | 557 | 2.0E-12 |
| sp|Q3SY17|S2552_HUMAN | Solute carrier family 25 member 52 OS=Homo sapiens GN=SLC25A52 PE=2 SV=2 | 12 | 235 | 2.0E-12 |
| sp|B2JIL8|TTCA_BURP8 | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=ttcA PE=3 SV=1 | 285 | 508 | 2.0E-12 |
| sp|Q0CEN9|TPC1_ASPTN | Mitochondrial thiamine pyrophosphate carrier 1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=tpc1 PE=3 SV=1 | 15 | 269 | 2.0E-12 |
| sp|C5CNK9|TTCA_VARPS | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Variovorax paradoxus (strain S110) GN=ttcA PE=3 SV=1 | 285 | 510 | 2.0E-12 |
| sp|Q9M2Z8|MPCP2_ARATH | Mitochondrial phosphate carrier protein 2, mitochondrial OS=Arabidopsis thaliana GN=MPT2 PE=2 SV=1 | 13 | 236 | 2.0E-12 |
| sp|Q8EEM4|TTCA_SHEON | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Shewanella oneidensis (strain MR-1) GN=ttcA PE=3 SV=1 | 285 | 519 | 2.0E-12 |
| sp|Q2KU24|TTCA_BORA1 | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Bordetella avium (strain 197N) GN=ttcA PE=3 SV=1 | 285 | 557 | 2.0E-12 |
| sp|A4G9W3|TTCA_HERAR | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Herminiimonas arsenicoxydans GN=ttcA PE=3 SV=1 | 285 | 514 | 2.0E-12 |
| sp|P97521|MCAT_RAT | Mitochondrial carnitine/acylcarnitine carrier protein OS=Rattus norvegicus GN=Slc25a20 PE=1 SV=1 | 2 | 184 | 3.0E-12 |
| sp|Q8BL03|MCATL_MOUSE | Mitochondrial basic amino acids transporter OS=Mus musculus GN=Slc25a29 PE=1 SV=1 | 111 | 276 | 3.0E-12 |
| sp|Q5HZE0|MCATL_RAT | Mitochondrial basic amino acids transporter OS=Rattus norvegicus GN=Slc25a29 PE=2 SV=1 | 111 | 276 | 3.0E-12 |
| sp|P04710|ADT1_YEAST | ADP,ATP carrier protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AAC1 PE=1 SV=1 | 13 | 194 | 3.0E-12 |
| sp|O04619|ADNT1_ARATH | Mitochondrial adenine nucleotide transporter ADNT1 OS=Arabidopsis thaliana GN=ADNT1 PE=2 SV=1 | 2 | 169 | 3.0E-12 |
| sp|Q9Y619|ORNT1_HUMAN | Mitochondrial ornithine transporter 1 OS=Homo sapiens GN=SLC25A15 PE=1 SV=1 | 25 | 194 | 3.0E-12 |
| sp|C4L8F7|TTCA_TOLAT | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=ttcA PE=3 SV=1 | 285 | 510 | 3.0E-12 |
| sp|B1JJU2|TTCA_YERPY | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=ttcA PE=3 SV=1 | 286 | 508 | 3.0E-12 |
| sp|A4TIV5|TTCA_YERPP | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Yersinia pestis (strain Pestoides F) GN=ttcA PE=3 SV=1 | 286 | 508 | 3.0E-12 |
| sp|Q1CIQ7|TTCA_YERPN | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=ttcA PE=3 SV=1 | 286 | 508 | 3.0E-12 |
| sp|A9R8Q5|TTCA_YERPG | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Yersinia pestis bv. Antiqua (strain Angola) GN=ttcA PE=3 SV=1 | 286 | 508 | 3.0E-12 |
| sp|Q7CIP8|TTCA_YERPE | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Yersinia pestis GN=ttcA PE=3 SV=1 | 286 | 508 | 3.0E-12 |
| sp|Q1C7C2|TTCA_YERPA | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=ttcA PE=3 SV=1 | 286 | 508 | 3.0E-12 |
| sp|A7FHP9|TTCA_YERP3 | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=ttcA PE=3 SV=1 | 286 | 508 | 3.0E-12 |
| sp|B2AGH6|TTCA_CUPTR | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=ttcA PE=3 SV=1 | 299 | 511 | 3.0E-12 |
| sp|Q9VAY3|MFRN_DROME | Mitoferrin OS=Drosophila melanogaster GN=mfrn PE=2 SV=1 | 12 | 231 | 3.0E-12 |
| sp|A0KKM7|TTCA_AERHH | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=ttcA PE=3 SV=1 | 286 | 510 | 3.0E-12 |
| sp|Q7T292|MFRN2_DANRE | Mitoferrin-2 OS=Danio rerio GN=slc25a28 PE=2 SV=1 | 15 | 231 | 3.0E-12 |
| sp|Q54DU1|MCFP_DICDI | Mitochondrial substrate carrier family protein P OS=Dictyostelium discoideum GN=mcfP PE=3 SV=1 | 13 | 269 | 3.0E-12 |
| sp|Q11IV8|TTCA_CHESB | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Chelativorans sp. (strain BNC1) GN=ttcA PE=3 SV=1 | 298 | 510 | 3.0E-12 |
| sp|Q8HXY2|MCAT_MACFA | Mitochondrial carnitine/acylcarnitine carrier protein OS=Macaca fascicularis GN=SLC25A20 PE=2 SV=1 | 13 | 184 | 4.0E-12 |
| sp|O97562|UCP2_PIG | Mitochondrial uncoupling protein 2 OS=Sus scrofa GN=UCP2 PE=2 SV=1 | 15 | 201 | 4.0E-12 |
| sp|P38127|RIM2_YEAST | Mitochondrial carrier protein RIM2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RIM2 PE=3 SV=1 | 29 | 194 | 4.0E-12 |
| sp|Q0HVA7|TTCA_SHESR | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Shewanella sp. (strain MR-7) GN=ttcA PE=3 SV=2 | 285 | 519 | 4.0E-12 |
| sp|Q0HIM8|TTCA_SHESM | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Shewanella sp. (strain MR-4) GN=ttcA PE=3 SV=2 | 285 | 519 | 4.0E-12 |
| sp|A0KX28|TTCA_SHESA | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Shewanella sp. (strain ANA-3) GN=ttcA PE=3 SV=2 | 285 | 519 | 4.0E-12 |
| sp|O60029|PET8_ASHGO | Putative mitochondrial carrier protein PET8 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PET8 PE=3 SV=1 | 9 | 272 | 4.0E-12 |
| sp|A7MLI7|TTCA_CROS8 | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=ttcA PE=3 SV=1 | 286 | 557 | 4.0E-12 |
| sp|Q7NQK6|TTCA_CHRVO | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=ttcA PE=3 SV=1 | 280 | 514 | 4.0E-12 |
| sp|Q082E9|TTCA_SHEFN | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Shewanella frigidimarina (strain NCIMB 400) GN=ttcA PE=3 SV=1 | 282 | 526 | 4.0E-12 |
| sp|Q5ZXN3|TTCA_LEGPH | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=ttcA PE=3 SV=1 | 286 | 510 | 5.0E-12 |
| sp|Q8R0Z5|MFRN2_MOUSE | Mitoferrin-2 OS=Mus musculus GN=Slc25a28 PE=2 SV=1 | 12 | 273 | 5.0E-12 |
| sp|Q9FHX2|MFL1_ARATH | Protein MITOFERRINLIKE 1, chloroplastic OS=Arabidopsis thaliana GN=MFL1 PE=2 SV=1 | 25 | 284 | 5.0E-12 |
| sp|Q6P036|S2533_DANRE | Solute carrier family 25 member 33 OS=Danio rerio GN=slc25a33 PE=2 SV=1 | 1 | 287 | 5.0E-12 |
| sp|P0C582|M2OM_NEUCR | Putative mitochondrial 2-oxoglutarate/malate carrier protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mic-33 PE=3 SV=1 | 7 | 269 | 5.0E-12 |
| sp|Q83CP2|TTCA_COXBU | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=ttcA PE=3 SV=1 | 299 | 514 | 5.0E-12 |
| sp|Q7S2H8|TPC1_NEUCR | Mitochondrial thiamine pyrophosphate carrier 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tpc-1 PE=3 SV=1 | 14 | 269 | 5.0E-12 |
| sp|Q9H936|GHC1_HUMAN | Mitochondrial glutamate carrier 1 OS=Homo sapiens GN=SLC25A22 PE=1 SV=1 | 102 | 276 | 6.0E-12 |
| sp|P55851|UCP2_HUMAN | Mitochondrial uncoupling protein 2 OS=Homo sapiens GN=UCP2 PE=1 SV=1 | 15 | 194 | 6.0E-12 |
| sp|Q5R5A8|UCP2_PONAB | Mitochondrial uncoupling protein 2 OS=Pongo abelii GN=UCP2 PE=2 SV=1 | 15 | 194 | 6.0E-12 |
| sp|Q0AI06|TTCA_NITEC | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Nitrosomonas eutropha (strain C91) GN=ttcA PE=3 SV=1 | 290 | 505 | 6.0E-12 |
| sp|A3D4P4|TTCA_SHEB5 | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=ttcA1 PE=3 SV=1 | 285 | 519 | 6.0E-12 |
| sp|Q8BMG8|MFTC_MOUSE | Mitochondrial folate transporter/carrier OS=Mus musculus GN=Slc25a32 PE=1 SV=1 | 3 | 175 | 6.0E-12 |
| sp|Q0BB90|TTCA_BURCM | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=ttcA PE=3 SV=1 | 285 | 508 | 6.0E-12 |
| sp|Q65TL6|TTCA_MANSM | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Mannheimia succiniciproducens (strain MBEL55E) GN=ttcA PE=3 SV=1 | 286 | 508 | 6.0E-12 |
| sp|Q2UCW8|TPC1_ASPOR | Mitochondrial thiamine pyrophosphate carrier 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=tpc1 PE=3 SV=1 | 15 | 288 | 6.0E-12 |
| sp|A1TUY3|TTCA_ACIAC | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Acidovorax citrulli (strain AAC00-1) GN=ttcA PE=3 SV=1 | 285 | 510 | 6.0E-12 |
| sp|A7N0R3|TTCA_VIBCB | tRNA 2-thiocytidine biosynthesis protein TtcA OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=ttcA PE=3 SV=1 | 286 | 510 | 6.0E-12 |
| sp|A1DI57|TPC1_NEOFI | Mitochondrial thiamine pyrophosphate carrier 1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=tpc1 PE=3 SV=1 | 15 | 269 | 6.0E-12 |
| sp|Q5XGI1|KMCP1_XENTR | Kidney mitochondrial carrier protein 1 OS=Xenopus tropicalis GN=slc25a30 PE=2 SV=1 | 9 | 193 | 7.0E-12 |
| sp|Q5PQM9|KMCP1_RAT | Kidney mitochondrial carrier protein 1 OS=Rattus norvegicus GN=Slc25a30 PE=2 SV=1 | 16 | 193 | 7.0E-12 |
| sp|Q8HXE3|KMCP1_MACFA | Kidney mitochondrial carrier protein 1 OS=Macaca fascicularis GN=SLC25A30 PE=2 SV=1 | 16 | 193 | 8.0E-12 |
| sp|Q5RD81|GHC1_PONAB | Mitochondrial glutamate carrier 1 OS=Pongo abelii GN=SLC25A22 PE=2 SV=1 | 102 | 276 | 8.0E-12 |
| sp|P70406|UCP2_MOUSE | Mitochondrial uncoupling protein 2 OS=Mus musculus GN=Ucp2 PE=1 SV=1 | 15 | 201 | 8.0E-12 |
| sp|P55916|UCP3_HUMAN | Mitochondrial uncoupling protein 3 OS=Homo sapiens GN=UCP3 PE=1 SV=1 | 15 | 194 | 8.0E-12 |
| sp|Q9W720|UCP2_DANRE | Mitochondrial uncoupling protein 2 OS=Danio rerio GN=ucp2 PE=2 SV=1 | 15 | 200 | 8.0E-12 |
| sp|P79110|TXTP_BOVIN | Tricarboxylate transport protein, mitochondrial OS=Bos taurus GN=SLC25A1 PE=2 SV=1 | 16 | 195 | 9.0E-12 |
| sp|P39953|YEA6_YEAST | Mitochondrial nicotinamide adenine dinucleotide transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YEA6 PE=1 SV=1 | 8 | 175 | 9.0E-12 |
| sp|Q6GQ22|KMCP1_XENLA | Kidney mitochondrial carrier protein 1 OS=Xenopus laevis GN=slc25a30 PE=2 SV=1 | 16 | 193 | 1.0E-11 |
| sp|Q1ECW7|S247A_DANRE | Solute carrier family 25 member 47-A OS=Danio rerio GN=slc25a47a PE=2 SV=1 | 113 | 292 | 1.0E-11 |
| sp|Q0P483|S2542_DANRE | Mitochondrial coenzyme A transporter SLC25A42 OS=Danio rerio GN=slc25a42 PE=2 SV=1 | 3 | 174 | 1.0E-11 |
| sp|O97649|UCP3_PIG | Mitochondrial uncoupling protein 3 OS=Sus scrofa GN=UCP3 PE=2 SV=1 | 15 | 194 | 2.0E-11 |
| sp|P56499|UCP3_RAT | Mitochondrial uncoupling protein 3 OS=Rattus norvegicus GN=Ucp3 PE=2 SV=1 | 15 | 194 | 2.0E-11 |
| sp|P32332|OAC1_YEAST | Mitochondrial oxaloacetate transport protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OAC1 PE=1 SV=1 | 15 | 199 | 2.0E-11 |
| sp|Q9SB52|PUMP4_ARATH | Mitochondrial uncoupling protein 4 OS=Arabidopsis thaliana GN=PUMP4 PE=2 SV=1 | 12 | 195 | 2.0E-11 |
| sp|Q05AQ3|S2542_XENTR | Mitochondrial coenzyme A transporter SLC25A42 OS=Xenopus tropicalis GN=slc25a42 PE=2 SV=1 | 6 | 174 | 2.0E-11 |
| sp|Q5PQ27|S2542_XENLA | Mitochondrial coenzyme A transporter SLC25A42 OS=Xenopus laevis GN=slc25a42 PE=2 SV=1 | 6 | 174 | 2.0E-11 |
| sp|Q08DK7|MCATL_BOVIN | Mitochondrial basic amino acids transporter OS=Bos taurus GN=SLC25A29 PE=2 SV=1 | 111 | 276 | 3.0E-11 |
| sp|Q9VA73|CMC_DROME | Calcium-binding mitochondrial carrier protein Aralar1 OS=Drosophila melanogaster GN=aralar1 PE=2 SV=1 | 7 | 227 | 4.0E-11 |
| sp|P33303|SFC1_YEAST | Succinate/fumarate mitochondrial transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SFC1 PE=1 SV=2 | 13 | 195 | 4.0E-11 |
| sp|Q54BM3|MCFG_DICDI | Mitochondrial substrate carrier family protein G OS=Dictyostelium discoideum GN=mcfG PE=2 SV=1 | 113 | 309 | 4.0E-11 |
| sp|Q54QN2|MCFM_DICDI | Mitochondrial substrate carrier family protein M OS=Dictyostelium discoideum GN=mcfM PE=3 SV=1 | 12 | 169 | 5.0E-11 |
| sp|O14281|YETC_SCHPO | Uncharacterized mitochondrial carrier C8C9.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC8C9.12c PE=3 SV=1 | 113 | 322 | 5.0E-11 |
| sp|O94502|YBT5_SCHPO | Uncharacterized mitochondrial carrier C12D12.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC12D12.05c PE=3 SV=2 | 3 | 92 | 5.0E-11 |
| sp|Q9BXI2|ORNT2_HUMAN | Mitochondrial ornithine transporter 2 OS=Homo sapiens GN=SLC25A2 PE=1 SV=3 | 15 | 275 | 5.0E-11 |
| sp|O75746|CMC1_HUMAN | Calcium-binding mitochondrial carrier protein Aralar1 OS=Homo sapiens GN=SLC25A12 PE=1 SV=2 | 6 | 195 | 6.0E-11 |
| sp|Q5RBC8|CMC1_PONAB | Calcium-binding mitochondrial carrier protein Aralar1 OS=Pongo abelii GN=SLC25A12 PE=2 SV=1 | 6 | 195 | 6.0E-11 |
| sp|Q8BH59|CMC1_MOUSE | Calcium-binding mitochondrial carrier protein Aralar1 OS=Mus musculus GN=Slc25a12 PE=1 SV=1 | 7 | 195 | 6.0E-11 |
| sp|Q08DK4|GHC1_BOVIN | Mitochondrial glutamate carrier 1 OS=Bos taurus GN=SLC25A22 PE=2 SV=1 | 102 | 276 | 6.0E-11 |
| sp|Q9BV35|SCMC3_HUMAN | Calcium-binding mitochondrial carrier protein SCaMC-3 OS=Homo sapiens GN=SLC25A23 PE=1 SV=2 | 1 | 169 | 6.0E-11 |
| sp|Q12482|AGC1_YEAST | Mitochondrial aspartate-glutamate transporter AGC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AGC1 PE=3 SV=1 | 98 | 281 | 7.0E-11 |
| sp|P34519|TXTP_CAEEL | Putative tricarboxylate transport protein, mitochondrial OS=Caenorhabditis elegans GN=K11H3.3 PE=3 SV=1 | 10 | 168 | 7.0E-11 |
| sp|O97470|ADT_DICDI | Mitochondrial substrate carrier family protein ancA OS=Dictyostelium discoideum GN=ancA PE=1 SV=1 | 2 | 175 | 7.0E-11 |
| sp|Q8N8R3|MCATL_HUMAN | Mitochondrial basic amino acids transporter OS=Homo sapiens GN=SLC25A29 PE=1 SV=2 | 111 | 276 | 9.0E-11 |
| sp|Q9D6M3|GHC1_MOUSE | Mitochondrial glutamate carrier 1 OS=Mus musculus GN=Slc25a22 PE=1 SV=1 | 102 | 276 | 9.0E-11 |
| sp|Q21153|CMC1_CAEEL | Probable calcium-binding mitochondrial carrier K02F3.2 OS=Caenorhabditis elegans GN=K02F3.2 PE=3 SV=3 | 1 | 175 | 1.0E-10 |
| sp|Q01356|ARG13_NEUCR | Amino-acid transporter arg-13 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=arg-13 PE=2 SV=1 | 113 | 277 | 1.0E-10 |
| sp|Q6NYZ6|SCM2A_DANRE | Calcium-binding mitochondrial carrier protein SCaMC-2-A OS=Danio rerio GN=slc25a25a PE=2 SV=1 | 2 | 169 | 1.0E-10 |
| sp|Q5IS35|TPC_MACFA | Mitochondrial thiamine pyrophosphate carrier OS=Macaca fascicularis GN=SLC25A19 PE=2 SV=1 | 9 | 178 | 1.0E-10 |
| sp|Q5NVC1|TPC_PONAB | Mitochondrial thiamine pyrophosphate carrier OS=Pongo abelii GN=SLC25A19 PE=2 SV=1 | 9 | 178 | 1.0E-10 |
| sp|Q99297|ODC2_YEAST | Mitochondrial 2-oxodicarboxylate carrier 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ODC2 PE=1 SV=1 | 14 | 177 | 2.0E-10 |
| sp|O97649|UCP3_PIG | Mitochondrial uncoupling protein 3 OS=Sus scrofa GN=UCP3 PE=2 SV=1 | 105 | 326 | 2.0E-10 |
| sp|Q7ZYD5|SCMC2_XENLA | Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Xenopus laevis GN=slc25a25 PE=2 SV=1 | 2 | 169 | 2.0E-10 |
| sp|P10566|MRS3_YEAST | Mitochondrial RNA-splicing protein MRS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRS3 PE=1 SV=4 | 113 | 374 | 2.0E-10 |
| sp|Q5PQ27|S2542_XENLA | Mitochondrial coenzyme A transporter SLC25A42 OS=Xenopus laevis GN=slc25a42 PE=2 SV=1 | 112 | 274 | 2.0E-10 |
| sp|Q9HC21|TPC_HUMAN | Mitochondrial thiamine pyrophosphate carrier OS=Homo sapiens GN=SLC25A19 PE=1 SV=1 | 9 | 178 | 2.0E-10 |
| sp|Q8LB08|ADT4_ARATH | ADP,ATP carrier protein ER-ANT1 OS=Arabidopsis thaliana GN=ER-ANT1 PE=2 SV=2 | 9 | 173 | 2.0E-10 |
| sp|A4QNX2|S247B_DANRE | Solute carrier family 25 member 47-B OS=Danio rerio GN=slc25a47b PE=2 SV=1 | 113 | 276 | 3.0E-10 |
| sp|Q8BW66|S2548_MOUSE | Solute carrier family 25 member 48 OS=Mus musculus GN=Slc25a48 PE=1 SV=2 | 15 | 169 | 3.0E-10 |
| sp|P23500|MRS4_YEAST | Mitochondrial RNA-splicing protein MRS4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRS4 PE=1 SV=1 | 113 | 298 | 3.0E-10 |
| sp|P40556|YIA6_YEAST | Mitochondrial nicotinamide adenine dinucleotide transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIA6 PE=1 SV=1 | 9 | 175 | 3.0E-10 |
| sp|A2R5A0|TPC1_ASPNC | Mitochondrial thiamine pyrophosphate carrier 1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=tpc1 PE=3 SV=1 | 8 | 204 | 3.0E-10 |
| sp|P04575|UCP1_MESAU | Mitochondrial brown fat uncoupling protein 1 OS=Mesocricetus auratus GN=UCP1 PE=1 SV=3 | 3 | 192 | 4.0E-10 |
| sp|P56500|UCP2_RAT | Mitochondrial uncoupling protein 2 OS=Rattus norvegicus GN=Ucp2 PE=2 SV=1 | 108 | 326 | 4.0E-10 |
| sp|Q8BMG8|MFTC_MOUSE | Mitochondrial folate transporter/carrier OS=Mus musculus GN=Slc25a32 PE=1 SV=1 | 12 | 287 | 4.0E-10 |
| sp|P70406|UCP2_MOUSE | Mitochondrial uncoupling protein 2 OS=Mus musculus GN=Ucp2 PE=1 SV=1 | 108 | 326 | 5.0E-10 |
| sp|O13844|YFG5_SCHPO | Uncharacterized mitochondrial carrier C19G12.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC19G12.05 PE=3 SV=1 | 15 | 195 | 5.0E-10 |
| sp|Q76P23|PM34_DICDI | Mitochondrial substrate carrier family protein Q OS=Dictyostelium discoideum GN=mcfQ PE=2 SV=1 | 15 | 297 | 5.0E-10 |
| sp|Q9ER18|UCP1_PHOSU | Mitochondrial brown fat uncoupling protein 1 OS=Phodopus sungorus GN=UCP1 PE=2 SV=1 | 3 | 199 | 6.0E-10 |
| sp|P55916|UCP3_HUMAN | Mitochondrial uncoupling protein 3 OS=Homo sapiens GN=UCP3 PE=1 SV=1 | 108 | 326 | 6.0E-10 |
| sp|Q5XH95|SCMC2_XENTR | Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Xenopus tropicalis GN=slc25a25 PE=2 SV=1 | 2 | 169 | 6.0E-10 |
| sp|Q0P483|S2542_DANRE | Mitochondrial coenzyme A transporter SLC25A42 OS=Danio rerio GN=slc25a42 PE=2 SV=1 | 112 | 309 | 6.0E-10 |
| sp|P27080|ADT_CHLRE | ADP,ATP carrier protein OS=Chlamydomonas reinhardtii GN=ABT PE=2 SV=1 | 9 | 182 | 7.0E-10 |
| sp|A3KPP4|S2535_DANRE | Solute carrier family 25 member 35 OS=Danio rerio GN=slc25a35 PE=2 SV=1 | 15 | 175 | 8.0E-10 |
| sp|P29518|BT1_MAIZE | Adenine nucleotide transporter BT1, chloroplastic/amyloplastic/mitochondrial OS=Zea mays GN=BT1 PE=1 SV=1 | 7 | 169 | 9.0E-10 |
| sp|Q0V7M4|SCMC2_BOVIN | Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Bos taurus GN=SLC25A25 PE=2 SV=1 | 2 | 169 | 9.0E-10 |
| sp|Q9DB41|GHC2_MOUSE | Mitochondrial glutamate carrier 2 OS=Mus musculus GN=Slc25a18 PE=1 SV=4 | 108 | 276 | 1.0E-09 |
| sp|Q27257|DIF1_CAEEL | Protein dif-1 OS=Caenorhabditis elegans GN=dif-1 PE=2 SV=1 | 111 | 359 | 1.0E-09 |
| sp|O77792|UCP3_BOVIN | Mitochondrial uncoupling protein 3 OS=Bos taurus GN=UCP3 PE=2 SV=1 | 108 | 326 | 1.0E-09 |
| sp|O97562|UCP2_PIG | Mitochondrial uncoupling protein 2 OS=Sus scrofa GN=UCP2 PE=2 SV=1 | 108 | 326 | 1.0E-09 |
| sp|Q55DY8|MFRN_DICDI | Mitoferrin OS=Dictyostelium discoideum GN=mcfF PE=3 SV=1 | 15 | 181 | 1.0E-09 |
| sp|O95847|UCP4_HUMAN | Mitochondrial uncoupling protein 4 OS=Homo sapiens GN=SLC25A27 PE=2 SV=1 | 113 | 295 | 1.0E-09 |
| sp|Q7T0U6|SCM1B_XENLA | Calcium-binding mitochondrial carrier protein SCaMC-1-B OS=Xenopus laevis GN=slc25a24-b PE=2 SV=1 | 2 | 169 | 1.0E-09 |
| sp|P25874|UCP1_HUMAN | Mitochondrial brown fat uncoupling protein 1 OS=Homo sapiens GN=UCP1 PE=2 SV=3 | 111 | 283 | 2.0E-09 |
| sp|Q8K404|UCP1_DICGR | Mitochondrial brown fat uncoupling protein 1 OS=Dicrostonyx groenlandicus GN=UCP1 PE=2 SV=1 | 3 | 199 | 2.0E-09 |
| sp|A0PC02|UCP1_OCHDA | Mitochondrial brown fat uncoupling protein 1 OS=Ochotona dauurica GN=UCP1 PE=2 SV=1 | 12 | 199 | 2.0E-09 |
| sp|Q6IS41|S2547_MOUSE | Solute carrier family 25 member 47 OS=Mus musculus GN=Slc25a47 PE=2 SV=2 | 50 | 196 | 2.0E-09 |
| sp|Q9N2J1|UCP2_CANLF | Mitochondrial uncoupling protein 2 OS=Canis lupus familiaris GN=UCP2 PE=2 SV=1 | 108 | 326 | 2.0E-09 |
| sp|Q3SZI5|UCP2_BOVIN | Mitochondrial uncoupling protein 2 OS=Bos taurus GN=UCP2 PE=2 SV=1 | 108 | 326 | 2.0E-09 |
| sp|A2ASZ8|SCMC2_MOUSE | Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Mus musculus GN=Slc25a25 PE=1 SV=1 | 2 | 169 | 2.0E-09 |
| sp|O04619|ADNT1_ARATH | Mitochondrial adenine nucleotide transporter ADNT1 OS=Arabidopsis thaliana GN=ADNT1 PE=2 SV=1 | 1 | 92 | 2.0E-09 |
| sp|P53007|TXTP_HUMAN | Tricarboxylate transport protein, mitochondrial OS=Homo sapiens GN=SLC25A1 PE=1 SV=2 | 50 | 195 | 3.0E-09 |
| sp|Q9M038|SFC1_ARATH | Mitochondrial succinate-fumarate transporter 1 OS=Arabidopsis thaliana GN=SFC1 PE=2 SV=1 | 111 | 276 | 3.0E-09 |
| sp|Q8JZU2|TXTP_MOUSE | Tricarboxylate transport protein, mitochondrial OS=Mus musculus GN=Slc25a1 PE=1 SV=1 | 29 | 195 | 3.0E-09 |
| sp|Q6J329|S2547_RAT | Solute carrier family 25 member 47 OS=Rattus norvegicus GN=Slc25a47 PE=2 SV=1 | 50 | 195 | 3.0E-09 |
| sp|Q7ZY36|SCM1A_XENLA | Calcium-binding mitochondrial carrier protein SCaMC-1-A OS=Xenopus laevis GN=slc25a24-a PE=2 SV=2 | 2 | 169 | 3.0E-09 |
| sp|Q54W11|MCFL_DICDI | Mitochondrial substrate carrier family protein L OS=Dictyostelium discoideum GN=mcfL PE=3 SV=1 | 14 | 184 | 4.0E-09 |
| sp|Q9GMZ1|UCP1_CANLF | Mitochondrial brown fat uncoupling protein 1 OS=Canis lupus familiaris GN=UCP1 PE=2 SV=1 | 125 | 283 | 4.0E-09 |
| sp|A2CEQ0|SCM2B_DANRE | Calcium-binding mitochondrial carrier protein SCaMC-2-B OS=Danio rerio GN=slc25a25b PE=3 SV=2 | 2 | 169 | 4.0E-09 |
| sp|P32089|TXTP_RAT | Tricarboxylate transport protein, mitochondrial OS=Rattus norvegicus GN=Slc25a1 PE=1 SV=1 | 29 | 195 | 5.0E-09 |
| sp|Q86HN8|MCFY_DICDI | Mitochondrial substrate carrier family protein Y OS=Dictyostelium discoideum GN=mcfY PE=3 SV=1 | 15 | 181 | 5.0E-09 |
| sp|A2A3V2|S2543_MOUSE | Solute carrier family 25 member 43 OS=Mus musculus GN=Slc25a43 PE=2 SV=1 | 18 | 269 | 5.0E-09 |
| sp|Q8K3P6|SCMC2_RAT | Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Rattus norvegicus GN=Slc25a25 PE=1 SV=1 | 2 | 169 | 6.0E-09 |
| sp|Q12251|YP011_YEAST | Uncharacterized mitochondrial carrier YPR011C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPR011C PE=1 SV=1 | 15 | 175 | 6.0E-09 |
| sp|P32332|OAC1_YEAST | Mitochondrial oxaloacetate transport protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OAC1 PE=1 SV=1 | 112 | 307 | 7.0E-09 |
| sp|Q9CA93|BAC2_ARATH | Mitochondrial arginine transporter BAC2 OS=Arabidopsis thaliana GN=BAC2 PE=1 SV=1 | 13 | 92 | 7.0E-09 |
| sp|Q6PH61|S2534_DANRE | Solute carrier family 25 member 34 OS=Danio rerio GN=slc25a34 PE=2 SV=1 | 29 | 177 | 7.0E-09 |
| sp|P0C582|M2OM_NEUCR | Putative mitochondrial 2-oxoglutarate/malate carrier protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mic-33 PE=3 SV=1 | 10 | 94 | 7.0E-09 |
| sp|P55851|UCP2_HUMAN | Mitochondrial uncoupling protein 2 OS=Homo sapiens GN=UCP2 PE=1 SV=1 | 108 | 326 | 8.0E-09 |
| sp|Q5R5A8|UCP2_PONAB | Mitochondrial uncoupling protein 2 OS=Pongo abelii GN=UCP2 PE=2 SV=1 | 108 | 326 | 8.0E-09 |
| sp|Q75AH6|AGC1_ASHGO | Mitochondrial aspartate-glutamate transporter AGC1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=AGC1 PE=3 SV=2 | 101 | 296 | 9.0E-09 |
| sp|Q9CR58|KMCP1_MOUSE | Kidney mitochondrial carrier protein 1 OS=Mus musculus GN=Slc25a30 PE=1 SV=1 | 116 | 292 | 1.0E-08 |
| sp|P10861|UCP1_BOVIN | Mitochondrial brown fat uncoupling protein 1 (Fragment) OS=Bos taurus GN=UCP1 PE=2 SV=2 | 113 | 283 | 1.0E-08 |
| sp|Q9GMZ1|UCP1_CANLF | Mitochondrial brown fat uncoupling protein 1 OS=Canis lupus familiaris GN=UCP1 PE=2 SV=1 | 12 | 199 | 1.0E-08 |
| sp|Q18P97|UCP1_SUNMU | Mitochondrial brown fat uncoupling protein 1 OS=Suncus murinus GN=UCP1 PE=2 SV=1 | 12 | 199 | 1.0E-08 |
| sp|Q9N2I9|UCP3_CANLF | Mitochondrial uncoupling protein 3 OS=Canis lupus familiaris GN=UCP3 PE=2 SV=1 | 108 | 326 | 1.0E-08 |
| sp|Q9C5M0|DTC_ARATH | Mitochondrial dicarboxylate/tricarboxylate transporter DTC OS=Arabidopsis thaliana GN=DTC PE=1 SV=1 | 106 | 307 | 1.0E-08 |
| sp|Q9SJY5|PUMP5_ARATH | Mitochondrial uncoupling protein 5 OS=Arabidopsis thaliana GN=PUMP5 PE=2 SV=1 | 3 | 195 | 1.0E-08 |
| sp|Q6KCM7|SCMC2_HUMAN | Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Homo sapiens GN=SLC25A25 PE=1 SV=1 | 2 | 169 | 1.0E-08 |
| sp|Q55E45|MCFE_DICDI | Mitochondrial substrate carrier family protein E OS=Dictyostelium discoideum GN=mcfE PE=3 SV=1 | 10 | 195 | 1.0E-08 |
| sp|Q8WUT9|S2543_HUMAN | Solute carrier family 25 member 43 OS=Homo sapiens GN=SLC25A43 PE=2 SV=2 | 18 | 269 | 1.0E-08 |
| sp|Q54RB9|CMC_DICDI | Calcium-binding mitochondrial carrier protein OS=Dictyostelium discoideum GN=mcfO PE=3 SV=1 | 93 | 281 | 2.0E-08 |
| sp|Q5PQM9|KMCP1_RAT | Kidney mitochondrial carrier protein 1 OS=Rattus norvegicus GN=Slc25a30 PE=2 SV=1 | 116 | 292 | 2.0E-08 |
| sp|P25874|UCP1_HUMAN | Mitochondrial brown fat uncoupling protein 1 OS=Homo sapiens GN=UCP1 PE=2 SV=3 | 15 | 192 | 2.0E-08 |
| sp|P56499|UCP3_RAT | Mitochondrial uncoupling protein 3 OS=Rattus norvegicus GN=Ucp3 PE=2 SV=1 | 105 | 326 | 2.0E-08 |
| sp|O97470|ADT_DICDI | Mitochondrial substrate carrier family protein ancA OS=Dictyostelium discoideum GN=ancA PE=1 SV=1 | 114 | 269 | 2.0E-08 |
| sp|A4RF23|TPC1_MAGO7 | Mitochondrial thiamine pyrophosphate carrier 1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=TPC1 PE=3 SV=2 | 3 | 201 | 2.0E-08 |
| sp|Q54DU1|MCFP_DICDI | Mitochondrial substrate carrier family protein P OS=Dictyostelium discoideum GN=mcfP PE=3 SV=1 | 111 | 274 | 2.0E-08 |
| sp|Q2UCW8|TPC1_ASPOR | Mitochondrial thiamine pyrophosphate carrier 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=tpc1 PE=3 SV=1 | 1 | 181 | 2.0E-08 |
| sp|Q54BM3|MCFG_DICDI | Mitochondrial substrate carrier family protein G OS=Dictyostelium discoideum GN=mcfG PE=2 SV=1 | 29 | 194 | 4.0E-08 |
| sp|Q8HXE3|KMCP1_MACFA | Kidney mitochondrial carrier protein 1 OS=Macaca fascicularis GN=SLC25A30 PE=2 SV=1 | 116 | 292 | 4.0E-08 |
| sp|Q505J6|GHC2_RAT | Mitochondrial glutamate carrier 2 OS=Rattus norvegicus GN=Slc25a18 PE=2 SV=2 | 9 | 102 | 5.0E-08 |
| sp|Q9DB41|GHC2_MOUSE | Mitochondrial glutamate carrier 2 OS=Mus musculus GN=Slc25a18 PE=1 SV=4 | 9 | 102 | 5.0E-08 |
| sp|Q10248|YD1K_SCHPO | Uncharacterized mitochondrial carrier C4G9.20c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4G9.20c PE=3 SV=2 | 6 | 186 | 5.0E-08 |
| sp|A0PC02|UCP1_OCHDA | Mitochondrial brown fat uncoupling protein 1 OS=Ochotona dauurica GN=UCP1 PE=2 SV=1 | 108 | 283 | 5.0E-08 |
| sp|A2CEQ0|SCM2B_DANRE | Calcium-binding mitochondrial carrier protein SCaMC-2-B OS=Danio rerio GN=slc25a25b PE=3 SV=2 | 113 | 295 | 5.0E-08 |
| sp|Q0CEN9|TPC1_ASPTN | Mitochondrial thiamine pyrophosphate carrier 1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=tpc1 PE=3 SV=1 | 1 | 198 | 5.0E-08 |
| sp|P56501|UCP3_MOUSE | Mitochondrial uncoupling protein 3 OS=Mus musculus GN=Ucp3 PE=1 SV=1 | 105 | 326 | 6.0E-08 |
| sp|P32331|YMC1_YEAST | Carrier protein YMC1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMC1 PE=3 SV=2 | 1 | 194 | 6.0E-08 |
| sp|Q5SVS4|KMCP1_HUMAN | Kidney mitochondrial carrier protein 1 OS=Homo sapiens GN=SLC25A30 PE=1 SV=1 | 116 | 292 | 7.0E-08 |
| sp|O95258|UCP5_HUMAN | Brain mitochondrial carrier protein 1 OS=Homo sapiens GN=SLC25A14 PE=2 SV=1 | 16 | 193 | 7.0E-08 |
| sp|Q9XI74|PUMP3_ARATH | Mitochondrial uncoupling protein 3 OS=Arabidopsis thaliana GN=PUMP3 PE=2 SV=1 | 2 | 194 | 7.0E-08 |
| sp|Q29RM1|TPC_BOVIN | Mitochondrial thiamine pyrophosphate carrier OS=Bos taurus GN=SLC25A19 PE=2 SV=1 | 9 | 178 | 7.0E-08 |
| sp|Q9ER18|UCP1_PHOSU | Mitochondrial brown fat uncoupling protein 1 OS=Phodopus sungorus GN=UCP1 PE=2 SV=1 | 108 | 283 | 8.0E-08 |
| sp|P04633|UCP1_RAT | Mitochondrial brown fat uncoupling protein 1 OS=Rattus norvegicus GN=Ucp1 PE=1 SV=2 | 3 | 199 | 8.0E-08 |
| sp|P04633|UCP1_RAT | Mitochondrial brown fat uncoupling protein 1 OS=Rattus norvegicus GN=Ucp1 PE=1 SV=2 | 108 | 283 | 8.0E-08 |
| sp|P12242|UCP1_MOUSE | Mitochondrial brown fat uncoupling protein 1 OS=Mus musculus GN=Ucp1 PE=1 SV=2 | 3 | 199 | 8.0E-08 |
| sp|Q54VX4|MCFJ_DICDI | Mitochondrial substrate carrier family protein J OS=Dictyostelium discoideum GN=mcfJ PE=2 SV=1 | 126 | 277 | 8.0E-08 |
| sp|A1DI57|TPC1_NEOFI | Mitochondrial thiamine pyrophosphate carrier 1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=tpc1 PE=3 SV=1 | 8 | 181 | 8.0E-08 |
| sp|Q9H1K4|GHC2_HUMAN | Mitochondrial glutamate carrier 2 OS=Homo sapiens GN=SLC25A18 PE=1 SV=1 | 9 | 102 | 1.0E-07 |
| sp|Q6GQ22|KMCP1_XENLA | Kidney mitochondrial carrier protein 1 OS=Xenopus laevis GN=slc25a30 PE=2 SV=1 | 113 | 292 | 1.0E-07 |
| sp|Q8N5S1|S2541_HUMAN | Solute carrier family 25 member 41 OS=Homo sapiens GN=SLC25A41 PE=2 SV=2 | 8 | 175 | 1.0E-07 |
| sp|Q54RB9|CMC_DICDI | Calcium-binding mitochondrial carrier protein OS=Dictyostelium discoideum GN=mcfO PE=3 SV=1 | 15 | 92 | 2.0E-07 |
| sp|Q9Z2B2|UCP5_MOUSE | Brain mitochondrial carrier protein 1 OS=Mus musculus GN=Slc25a14 PE=1 SV=2 | 16 | 193 | 2.0E-07 |
| sp|P04575|UCP1_MESAU | Mitochondrial brown fat uncoupling protein 1 OS=Mesocricetus auratus GN=UCP1 PE=1 SV=3 | 108 | 283 | 2.0E-07 |
| sp|P12242|UCP1_MOUSE | Mitochondrial brown fat uncoupling protein 1 OS=Mus musculus GN=Ucp1 PE=1 SV=2 | 108 | 283 | 2.0E-07 |
| sp|Q9W720|UCP2_DANRE | Mitochondrial uncoupling protein 2 OS=Danio rerio GN=ucp2 PE=2 SV=1 | 108 | 283 | 2.0E-07 |
| sp|P40556|YIA6_YEAST | Mitochondrial nicotinamide adenine dinucleotide transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIA6 PE=1 SV=1 | 95 | 290 | 2.0E-07 |
| sp|Q9DB41|GHC2_MOUSE | Mitochondrial glutamate carrier 2 OS=Mus musculus GN=Slc25a18 PE=1 SV=4 | 12 | 168 | 3.0E-07 |
| sp|Q21153|CMC1_CAEEL | Probable calcium-binding mitochondrial carrier K02F3.2 OS=Caenorhabditis elegans GN=K02F3.2 PE=3 SV=3 | 13 | 103 | 3.0E-07 |
| sp|Q9H0C2|ADT4_HUMAN | ADP/ATP translocase 4 OS=Homo sapiens GN=SLC25A31 PE=2 SV=1 | 96 | 302 | 3.0E-07 |
| sp|Q4R8M0|ADT4_MACFA | ADP/ATP translocase 4 OS=Macaca fascicularis GN=SLC25A31 PE=2 SV=1 | 96 | 302 | 3.0E-07 |
| sp|O94502|YBT5_SCHPO | Uncharacterized mitochondrial carrier C12D12.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC12D12.05c PE=3 SV=2 | 13 | 275 | 3.0E-07 |
| sp|A7ER02|TPC1_SCLS1 | Mitochondrial thiamine pyrophosphate carrier 1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=tpc1 PE=3 SV=1 | 13 | 194 | 3.0E-07 |
| sp|Q0II44|S2541_BOVIN | Solute carrier family 25 member 41 OS=Bos taurus GN=SLC25A41 PE=2 SV=1 | 3 | 149 | 3.0E-07 |
| sp|Q7T292|MFRN2_DANRE | Mitoferrin-2 OS=Danio rerio GN=slc25a28 PE=2 SV=1 | 113 | 269 | 3.0E-07 |
| sp|Q54EV4|MCFA_DICDI | Mitochondrial substrate carrier family protein A OS=Dictyostelium discoideum GN=mcfA PE=3 SV=1 | 16 | 93 | 4.0E-07 |
| sp|Q54S10|MCFU_DICDI | Mitochondrial substrate carrier family protein U OS=Dictyostelium discoideum GN=mcfU PE=3 SV=1 | 111 | 277 | 5.0E-07 |
| sp|P14271|UCP1_RABIT | Mitochondrial brown fat uncoupling protein 1 OS=Oryctolagus cuniculus GN=UCP1 PE=2 SV=1 | 108 | 283 | 6.0E-07 |
| sp|Q54PY7|M2OM_DICDI | Probable mitochondrial 2-oxoglutarate/malate carrier protein OS=Dictyostelium discoideum GN=ucpC PE=3 SV=1 | 4 | 199 | 6.0E-07 |
| sp|Q84UC7|BAC1_ARATH | Mitochondrial arginine transporter BAC1 OS=Arabidopsis thaliana GN=BAC1 PE=1 SV=1 | 114 | 288 | 6.0E-07 |
| sp|Q54MZ4|MCFB_DICDI | Mitochondrial substrate carrier family protein B OS=Dictyostelium discoideum GN=mcfB PE=3 SV=1 | 10 | 92 | 6.0E-07 |
| sp|Q6ZT89|S2548_HUMAN | Solute carrier family 25 member 48 OS=Homo sapiens GN=SLC25A48 PE=1 SV=2 | 116 | 276 | 6.0E-07 |
| sp|Q3MHI3|S2548_BOVIN | Solute carrier family 25 member 48 OS=Bos taurus GN=SLC25A48 PE=2 SV=1 | 113 | 276 | 6.0E-07 |
| sp|Q86HN8|MCFY_DICDI | Mitochondrial substrate carrier family protein Y OS=Dictyostelium discoideum GN=mcfY PE=3 SV=1 | 113 | 277 | 7.0E-07 |
| sp|Q55E85|MCFD_DICDI | Mitochondrial substrate carrier family protein D OS=Dictyostelium discoideum GN=mcfD PE=3 SV=1 | 15 | 88 | 7.0E-07 |
| sp|Q9VAY3|MFRN_DROME | Mitoferrin OS=Drosophila melanogaster GN=mfrn PE=2 SV=1 | 105 | 269 | 7.0E-07 |
| sp|Q9UBX3|DIC_HUMAN | Mitochondrial dicarboxylate carrier OS=Homo sapiens GN=SLC25A10 PE=1 SV=2 | 4 | 169 | 9.0E-07 |
| sp|Q5XGI1|KMCP1_XENTR | Kidney mitochondrial carrier protein 1 OS=Xenopus tropicalis GN=slc25a30 PE=2 SV=1 | 113 | 292 | 1.0E-06 |
| sp|Q5HZE0|MCATL_RAT | Mitochondrial basic amino acids transporter OS=Rattus norvegicus GN=Slc25a29 PE=2 SV=1 | 208 | 359 | 1.0E-06 |
| sp|P39953|YEA6_YEAST | Mitochondrial nicotinamide adenine dinucleotide transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YEA6 PE=1 SV=1 | 111 | 274 | 1.0E-06 |
| sp|P31691|ADT_ORYSJ | ADP,ATP carrier protein, mitochondrial OS=Oryza sativa subsp. japonica GN=Os02g0718900 PE=2 SV=1 | 24 | 182 | 1.0E-06 |
| sp|A4RF23|TPC1_MAGO7 | Mitochondrial thiamine pyrophosphate carrier 1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=TPC1 PE=3 SV=2 | 113 | 284 | 1.0E-06 |
| sp|Q8BL03|MCATL_MOUSE | Mitochondrial basic amino acids transporter OS=Mus musculus GN=Slc25a29 PE=1 SV=1 | 208 | 359 | 2.0E-06 |
| sp|P10861|UCP1_BOVIN | Mitochondrial brown fat uncoupling protein 1 (Fragment) OS=Bos taurus GN=UCP1 PE=2 SV=2 | 12 | 183 | 2.0E-06 |
| sp|Q54S10|MCFU_DICDI | Mitochondrial substrate carrier family protein U OS=Dictyostelium discoideum GN=mcfU PE=3 SV=1 | 3 | 92 | 2.0E-06 |
| sp|Q9W725|UCP2_CYPCA | Mitochondrial uncoupling protein 2 OS=Cyprinus carpio GN=ucp2 PE=2 SV=1 | 108 | 283 | 2.0E-06 |
| sp|O95847|UCP4_HUMAN | Mitochondrial uncoupling protein 4 OS=Homo sapiens GN=SLC25A27 PE=2 SV=1 | 2 | 184 | 2.0E-06 |
| sp|Q55E45|MCFE_DICDI | Mitochondrial substrate carrier family protein E OS=Dictyostelium discoideum GN=mcfE PE=3 SV=1 | 1 | 92 | 2.0E-06 |
| sp|Q5IS35|TPC_MACFA | Mitochondrial thiamine pyrophosphate carrier OS=Macaca fascicularis GN=SLC25A19 PE=2 SV=1 | 114 | 273 | 2.0E-06 |
| sp|Q9H936|GHC1_HUMAN | Mitochondrial glutamate carrier 1 OS=Homo sapiens GN=SLC25A22 PE=1 SV=1 | 2 | 106 | 3.0E-06 |
| sp|Q5RD81|GHC1_PONAB | Mitochondrial glutamate carrier 1 OS=Pongo abelii GN=SLC25A22 PE=2 SV=1 | 2 | 106 | 3.0E-06 |
| sp|Q5SWT3|S2535_MOUSE | Solute carrier family 25 member 35 OS=Mus musculus GN=Slc25a35 PE=1 SV=2 | 14 | 175 | 3.0E-06 |
| sp|A2Q879|CTU1_ASPNC | Cytoplasmic tRNA 2-thiolation protein 1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=ncs6 PE=3 SV=1 | 600 | 630 | 4.0E-06 |
| sp|Q41629|ADT1_WHEAT | ADP,ATP carrier protein 1, mitochondrial OS=Triticum aestivum GN=ANT-G1 PE=3 SV=1 | 24 | 182 | 4.0E-06 |
| sp|Q1E7P0|TPC1_COCIM | Mitochondrial thiamine pyrophosphate carrier 1 OS=Coccidioides immitis (strain RS) GN=TPC1 PE=3 SV=1 | 13 | 181 | 4.0E-06 |
| sp|A1DI57|TPC1_NEOFI | Mitochondrial thiamine pyrophosphate carrier 1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=tpc1 PE=3 SV=1 | 106 | 268 | 4.0E-06 |
| sp|Q7S2H8|TPC1_NEUCR | Mitochondrial thiamine pyrophosphate carrier 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tpc-1 PE=3 SV=1 | 3 | 181 | 6.0E-06 |
| sp|O04619|ADNT1_ARATH | Mitochondrial adenine nucleotide transporter ADNT1 OS=Arabidopsis thaliana GN=ADNT1 PE=2 SV=1 | 112 | 274 | 8.0E-06 |
| sp|Q2YDD9|ADT4_BOVIN | ADP/ATP translocase 4 OS=Bos taurus GN=SLC25A31 PE=2 SV=1 | 113 | 302 | 9.0E-06 |
| sp|P04710|ADT1_YEAST | ADP,ATP carrier protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AAC1 PE=1 SV=1 | 111 | 273 | 9.0E-06 |
| sp|A7ER02|TPC1_SCLS1 | Mitochondrial thiamine pyrophosphate carrier 1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=tpc1 PE=3 SV=1 | 106 | 233 | 1.0E-05 |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| No | 1 - 20 | 0.5 |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >Ophun1|77 MSQEKPLPFVYQFAAGAVAGVSEILVMYPLDVAKTRIQLQTGKGTGAESYNGMVDCFRKIVRNEGFSRLYRGISA PVLMEAPKRAIKFGAFDGWGKTYRRLFATPEMTQPLSILTGATAGVTEAFVVVPFELIKIRLQDKSSMGRYTGLT DCLVKTVRGEGLLALYQGLESTMWRHAVWNAGYFGVIFQVKRLMQTDESNKGKKLFSDFLSGAIGGTAGTILNTP FDVVKSRIQNTPKVPGRAPKYNWAWPSVLTVFKEEGAAALYKGFLPKVCRDCFIAAFENEVHHTIISSNLFYPGE RVAIGASGGKDSTVLASVLKTLNERHKYGLDLVLLSVDEGIKGYRDDSLETVKRNAAQYEMPLQIVGYDELYGWT MDQVVETIGKKGNCTYCGVFRRQALDRGAKLLNIKHVVTGHNADDVAETILMNLLRGDLPRLSRSTSIMTGNSAS DVKRSKPLKYAYEKEIVLYAHHKKLDYFSTECIYSPEAFRGTARSLIKSLEKVRPSAILDIVRSGEDMARLTPDK GQGDCDCGDDEGMGGGCSSANAGTSRITPQEVRQESLETEITSIGTSETDGSVKLPVRTRRQRNGERDAAPAPLQ TLGRCIKCGYMSSQAMCQACTLLENLNKNRADIVL* |
| Coding | >Ophun1|77 ATGTCGCAGGAGAAGCCGCTCCCGTTCGTGTACCAGTTCGCGGCTGGCGCTGTCGCTGGCGTCTCCGAGATCTTG GTAATGTACCCGCTCGACGTGGCCAAGACGCGAATACAGCTTCAGACGGGCAAGGGTACGGGTGCGGAGTCTTAT AATGGCATGGTCGACTGCTTCCGCAAAATCGTCCGGAACGAAGGATTCTCCCGCTTGTACCGCGGCATCTCAGCT CCTGTACTAATGGAAGCACCCAAGCGAGCCATCAAATTCGGCGCTTTCGATGGTTGGGGCAAGACTTACCGCCGC CTCTTCGCAACGCCGGAAATGACGCAGCCGCTCTCCATCCTGACGGGCGCAACGGCTGGAGTGACCGAGGCCTTT GTCGTGGTTCCCTTTGAGCTCATCAAGATACGTCTGCAGGATAAGTCGTCCATGGGACGCTACACCGGCTTGACT GACTGCCTAGTCAAGACGGTCAGAGGAGAAGGTCTTCTGGCGCTCTATCAGGGTCTTGAGAGTACCATGTGGCGG CATGCCGTATGGAACGCCGGCTACTTCGGGGTCATCTTCCAGGTCAAGCGTCTGATGCAGACTGATGAGTCGAAC AAGGGGAAGAAGCTCTTCAGCGACTTCCTCAGTGGTGCAATCGGCGGAACGGCTGGCACAATACTGAATACGCCA TTCGACGTTGTGAAATCACGCATTCAGAATACGCCCAAGGTTCCTGGACGCGCGCCAAAGTACAACTGGGCCTGG CCTTCGGTCTTGACGGTCTTCAAGGAGGAGGGCGCCGCAGCGCTGTACAAGGGGTTTCTCCCAAAGGTCTGCAGA GACTGCTTCATCGCGGCGTTCGAAAACGAAGTCCACCACACCATCATCTCGTCCAACCTCTTCTACCCTGGCGAG CGAGTCGCCATCGGAGCCTCGGGCGGCAAGGACTCTACTGTCCTGGCCTCAGTCCTCAAGACACTCAACGAGCGG CACAAGTACGGGCTCGACCTGGTTCTTCTGAGCGTTGACGAGGGCATCAAAGGATACCGCGATGACTCCCTCGAG ACGGTCAAGCGGAATGCGGCGCAGTACGAGATGCCCCTGCAGATTGTCGGTTACGATGAGCTCTACGGCTGGACC ATGGACCAAGTCGTCGAGACGATAGGCAAAAAGGGAAACTGCACCTACTGCGGCGTCTTTCGGAGACAAGCCCTG GATCGAGGTGCCAAGCTACTCAATATCAAGCATGTCGTCACGGGCCACAACGCAGACGACGTGGCCGAGACGATT CTCATGAACCTCCTTCGCGGCGATCTTCCCCGGTTGTCGCGGAGCACCAGCATCATGACTGGCAATTCAGCCAGT GACGTCAAAAGAAGCAAACCCCTCAAGTACGCGTACGAAAAGGAAATCGTCTTGTACGCCCACCACAAGAAACTG GACTACTTCAGCACCGAGTGCATATACAGCCCCGAGGCATTTCGAGGAACTGCGAGGAGCCTCATCAAGAGCCTG GAAAAGGTCCGGCCGAGCGCGATTCTCGACATCGTGAGGAGCGGCGAGGACATGGCGCGGCTGACGCCGGACAAG GGCCAAGGGGACTGCGACTGTGGTGATGACGAGGGTATGGGGGGTGGCTGCTCATCGGCAAACGCTGGCACGTCG AGGATCACGCCGCAAGAGGTTCGTCAGGAAAGCCTCGAGACGGAAATCACCTCCATTGGGACATCCGAGACAGAC GGGTCGGTCAAGTTGCCTGTGAGGACTCGGCGACAGAGAAATGGCGAAAGGGATGCCGCTCCTGCGCCGCTGCAG ACGCTCGGCCGGTGTATCAAGTGTGGTTACATGTCAAGTCAGGCAATGTGCCAGGCGTGCACGCTTTTGGAGAAC TTGAATAAGAACAGGGCTGACATCGTCCTATGA |
| Transcript | >Ophun1|77 ATGTCGCAGGAGAAGCCGCTCCCGTTCGTGTACCAGTTCGCGGCTGGCGCTGTCGCTGGCGTCTCCGAGATCTTG GTAATGTACCCGCTCGACGTGGCCAAGACGCGAATACAGCTTCAGACGGGCAAGGGTACGGGTGCGGAGTCTTAT AATGGCATGGTCGACTGCTTCCGCAAAATCGTCCGGAACGAAGGATTCTCCCGCTTGTACCGCGGCATCTCAGCT CCTGTACTAATGGAAGCACCCAAGCGAGCCATCAAATTCGGCGCTTTCGATGGTTGGGGCAAGACTTACCGCCGC CTCTTCGCAACGCCGGAAATGACGCAGCCGCTCTCCATCCTGACGGGCGCAACGGCTGGAGTGACCGAGGCCTTT GTCGTGGTTCCCTTTGAGCTCATCAAGATACGTCTGCAGGATAAGTCGTCCATGGGACGCTACACCGGCTTGACT GACTGCCTAGTCAAGACGGTCAGAGGAGAAGGTCTTCTGGCGCTCTATCAGGGTCTTGAGAGTACCATGTGGCGG CATGCCGTATGGAACGCCGGCTACTTCGGGGTCATCTTCCAGGTCAAGCGTCTGATGCAGACTGATGAGTCGAAC AAGGGGAAGAAGCTCTTCAGCGACTTCCTCAGTGGTGCAATCGGCGGAACGGCTGGCACAATACTGAATACGCCA TTCGACGTTGTGAAATCACGCATTCAGAATACGCCCAAGGTTCCTGGACGCGCGCCAAAGTACAACTGGGCCTGG CCTTCGGTCTTGACGGTCTTCAAGGAGGAGGGCGCCGCAGCGCTGTACAAGGGGTTTCTCCCAAAGGTCTGCAGA GACTGCTTCATCGCGGCGTTCGAAAACGAAGTCCACCACACCATCATCTCGTCCAACCTCTTCTACCCTGGCGAG CGAGTCGCCATCGGAGCCTCGGGCGGCAAGGACTCTACTGTCCTGGCCTCAGTCCTCAAGACACTCAACGAGCGG CACAAGTACGGGCTCGACCTGGTTCTTCTGAGCGTTGACGAGGGCATCAAAGGATACCGCGATGACTCCCTCGAG ACGGTCAAGCGGAATGCGGCGCAGTACGAGATGCCCCTGCAGATTGTCGGTTACGATGAGCTCTACGGCTGGACC ATGGACCAAGTCGTCGAGACGATAGGCAAAAAGGGAAACTGCACCTACTGCGGCGTCTTTCGGAGACAAGCCCTG GATCGAGGTGCCAAGCTACTCAATATCAAGCATGTCGTCACGGGCCACAACGCAGACGACGTGGCCGAGACGATT CTCATGAACCTCCTTCGCGGCGATCTTCCCCGGTTGTCGCGGAGCACCAGCATCATGACTGGCAATTCAGCCAGT GACGTCAAAAGAAGCAAACCCCTCAAGTACGCGTACGAAAAGGAAATCGTCTTGTACGCCCACCACAAGAAACTG GACTACTTCAGCACCGAGTGCATATACAGCCCCGAGGCATTTCGAGGAACTGCGAGGAGCCTCATCAAGAGCCTG GAAAAGGTCCGGCCGAGCGCGATTCTCGACATCGTGAGGAGCGGCGAGGACATGGCGCGGCTGACGCCGGACAAG GGCCAAGGGGACTGCGACTGTGGTGATGACGAGGGTATGGGGGGTGGCTGCTCATCGGCAAACGCTGGCACGTCG AGGATCACGCCGCAAGAGGTTCGTCAGGAAAGCCTCGAGACGGAAATCACCTCCATTGGGACATCCGAGACAGAC GGGTCGGTCAAGTTGCCTGTGAGGACTCGGCGACAGAGAAATGGCGAAAGGGATGCCGCTCCTGCGCCGCTGCAG ACGCTCGGCCGGTGTATCAAGTGTGGTTACATGTCAAGTCAGGCAATGTGCCAGGCGTGCACGCTTTTGGAGAAC TTGAATAAGAACAGGGCTGACATCGTCCTATGA |
| Gene | >Ophun1|77 ATGTCGCAGGAGAAGCCGCTCCCGTTCGTGTACCAGTTCGCGGCTGGTAAGTGTCTATCTTTTCACGGAGGAAGA GAGGAAGCTGACTCTATTTCTGCATAGGCGCTGTCGCTGGCGTCTCCGAGGTGCGGACTGCTATCTACCTACCAA CCTACCTACGAATACTCGCTGCCCTGGAGTCGAACTGACAATTTCTTTCGCGGATACTAGATCTTGGTAATGTAC CCGCTCGACGTGGCCAAGACGCGAATGTAATGATGCTCTTCATCTTCCCTTCTGCGACGAGGTACGCTGACCAGG GGCAACAGACAGCTTCAGACGGGCAAGGGTACGGGTGCGGAGTCTTATAATGGCATGGTCGACTGCTTCCGCAAA ATCGTCCGGAACGAAGGGTACGTTTCCATCTTTCCGAGTTCCAGCGAGCTTCCCCCCCCTGAGTCCTAGTCAAAG CTCACAACAGGAGGAACAGATTCTCCCGCTTGTACCGCGGCATCTCAGCTCCTGTACTAATGGAAGCACCCAAGC GAGCCATCAAATTCGGCGCTTTCGATGGTTGGGGCAAGACTTACCGCCGCCTCTTCGCAACGCCGGAAATGACGC AGCCGCTCTCCATCCTGACGGGCGCAACGGCTGGAGTGACCGAGGCCTTTGTCGTGGTTCCCTTTGAGCTCATCA AGATACGTCTGCAGGATAAGTCGTCCATGGGACGCTACACCGGCTTGACTGACTGCCTAGTCAAGACGGTCAGAG GAGAAGGTCTTCTGGCGCTCTATCAGGGTCTTGAGAGTACCATGTGGCGGCATGCCGTATGGAACGCCGGCTACT TCGGGGTCATCTTCCAGGTCAAGCGTCTGATGCAGACTGATGAGTCGAACAAGGGGAAGAAGCTCTTCAGCGACT TCCTCAGTGGTGCAATCGGCGGAACGGCTGGCACAATACTGAATACGCCATTCGACGTTGTGAAATCACGCATTC AGAATACGCCCAAGGTTCCTGGACGCGCGCCAAAGTACAACTGGGCCTGGCCTTCGGTCTTGACGGTCTTCAAGG AGGAGGGCGCCGCAGCGCTGTACAAGGGGTTTCTCCCAAAGGTCCTTCGGCTTGGGCCCGGTGGTGGAATACTAC TAGTGGTGTATACTAACGTCATGGACACGTTCCGCAAGTGGCACTCGTAATGCAAAGAGGAACGTCGTCTTCTGC TTCATTGTGCTCAGTCGGTGATTGTGATGTGATCACGTGACTCAACTCTATCATATCACGTGATCTCTGATGGCA TCTTCTGCATGACGAGTTGACGGCCATTGCAATTCTGTCCGTTCAACAGCCATTTGACAAGAGATGGTCAAATGC GATAACTTGCAATCCTTACGCACTGCAACCGCAATATTGGCGGTAAAGGACAGATGGAAGATTGAAGTGTTTCAC GCAAACTGATTCATCAGGCCCAGAGTTGTCTCCTTGTCGCACCTCCACCTCACCATGCCCCCTACACCCTGCGTG CTTTGCCGAAACCAAAGGGCTGTCGTCAAGAGACCAAAAAACCACGAAAAGGTCTGCAGAGACTGCTTCATCGCG GCGTTCGAAAACGAAGTCCACCACACCATCATCTCGTCCAACCTCTTCTACCCTGGCGAGCGAGTCGCCATCGGA GCCTCGGGCGGCAAGGACTCTACTGTCCTGGCCTCAGTCCTCAAGACACTCAACGAGCGGCACAAGTACGGGCTC GACCTGGTTCTTCTGAGCGTTGACGAGGGCATCAAAGGATACCGCGATGACTCCCTCGAGACGGTCAAGCGGAAT GCGGCGCAGTACGAGATGCCCCTGCAGATTGTCGGTTACGATGAGCTCTACGGCTGGACCATGGACCAAGTCGTC GAGACGATAGGCAAAAAGGGAAACTGCACCTACTGCGGCGTCTTTCGGAGACAAGCCCTGGATCGAGGTGCCAAG CTACTCAATATCAAGCATGTCGTCACGGGCCACAACGCAGACGACGTGGCCGAGACGATTCTCATGAACCTCCTT CGCGGCGATCTTCCCCGGTTGTCGCGGAGCACCAGCATCATGACTGGCAATTCAGCCAGTGACGTCAAAAGAAGC AAACCCCTCAAGTACGCGTACGAAAAGGAAATCGTCTTGTACGCCCACCACAAGAAACTGGACTACTTCAGCACC GAGTGCATATACAGCCCCGAGGCATTTCGAGGAACTGCGAGGAGCCTCATCAAGAGCCTGGAAAAGGTCCGGCCG AGCGCGATTCTCGACATCGTGAGGAGCGGCGAGGACATGGCGCGGCTGACGCCGGACAAGGGCCAAGGGGACTGC GACTGTGGTGATGACGAGGGTATGGGGGGTGGCTGCTCATCGGCAAACGCTGGCACGTCGAGGATCACGCCGCAA GAGGTTCGTCAGGAAAGCCTCGAGACGGAAATCACCTCCATTGGGACATCCGAGACAGACGGGTCGGTCAAGTTG CCTGTGAGGACTCGGCGACAGAGAAATGGCGAAAGGGATGCCGCTCCTGCGCCGCTGCAGACGCTCGGCCGGTGT ATCAAGTGTGGTTACATGTCAAGTCAGGCAATGTGCCAGGCGTGCACGCTTTTGGAGAACTTGAATAAGAACAGG GCTGACATCGTCCTATGA |