Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|766
Gene name
LocationContig_1263:944..2967
Strand-
Gene length (bp)2023
Transcript length (bp)1881
Coding sequence length (bp)1881
Protein length (aa) 627

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07719 TPR_2 Tetratricopeptide repeat 1.4E-05 474 504
PF13431 TPR_17 Tetratricopeptide repeat 4.9E-05 462 494
PF13432 TPR_16 Tetratricopeptide repeat 3.0E-04 316 369
PF13432 TPR_16 Tetratricopeptide repeat 2.1E-04 377 428
PF13432 TPR_16 Tetratricopeptide repeat 2.1E-03 450 501
PF13181 TPR_8 Tetratricopeptide repeat 2.6E-02 372 402
PF13181 TPR_8 Tetratricopeptide repeat 4.7E-04 406 437
PF13181 TPR_8 Tetratricopeptide repeat 2.3E-01 475 505

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P23231|TOM70_NEUCR Mitochondrial import receptor subunit tom70 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tom70 PE=2 SV=3 4 622 0.0E+00
sp|O14217|TOM70_SCHPO Probable mitochondrial import receptor subunit tom70 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tom70 PE=1 SV=1 26 613 1.0E-158
sp|P07213|TOM70_YEAST Mitochondrial import receptor subunit TOM70 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TOM70 PE=1 SV=2 28 611 4.0E-72
sp|A6ZRW3|TOM70_YEAS7 Mitochondrial import receptor subunit TOM70 OS=Saccharomyces cerevisiae (strain YJM789) GN=TOM70 PE=3 SV=1 28 611 4.0E-72
sp|O94826|TOM70_HUMAN Mitochondrial import receptor subunit TOM70 OS=Homo sapiens GN=TOMM70A PE=1 SV=1 42 604 1.0E-64
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P23231|TOM70_NEUCR Mitochondrial import receptor subunit tom70 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tom70 PE=2 SV=3 4 622 0.0E+00
sp|O14217|TOM70_SCHPO Probable mitochondrial import receptor subunit tom70 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tom70 PE=1 SV=1 26 613 1.0E-158
sp|P07213|TOM70_YEAST Mitochondrial import receptor subunit TOM70 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TOM70 PE=1 SV=2 28 611 4.0E-72
sp|A6ZRW3|TOM70_YEAS7 Mitochondrial import receptor subunit TOM70 OS=Saccharomyces cerevisiae (strain YJM789) GN=TOM70 PE=3 SV=1 28 611 4.0E-72
sp|O94826|TOM70_HUMAN Mitochondrial import receptor subunit TOM70 OS=Homo sapiens GN=TOMM70A PE=1 SV=1 42 604 1.0E-64
sp|Q75Q39|TOM70_RAT Mitochondrial import receptor subunit TOM70 OS=Rattus norvegicus GN=Tomm70a PE=1 SV=1 79 604 1.0E-63
sp|Q9CZW5|TOM70_MOUSE Mitochondrial import receptor subunit TOM70 OS=Mus musculus GN=Tomm70a PE=1 SV=2 137 604 1.0E-62
sp|P38825|TOM71_YEAST Protein TOM71 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TOM71 PE=1 SV=1 114 611 4.0E-56
sp|Q3KRD5|TOM34_RAT Mitochondrial import receptor subunit TOM34 OS=Rattus norvegicus GN=Tomm34 PE=1 SV=1 135 432 9.0E-15
sp|F1RBN2|SPAG1_DANRE Sperm-associated antigen 1A OS=Danio rerio GN=spag1a PE=2 SV=1 37 424 1.0E-14
sp|Q15785|TOM34_HUMAN Mitochondrial import receptor subunit TOM34 OS=Homo sapiens GN=TOMM34 PE=1 SV=2 135 399 6.0E-14
sp|Q07617|SPAG1_HUMAN Sperm-associated antigen 1 OS=Homo sapiens GN=SPAG1 PE=1 SV=3 124 246 1.0E-13
sp|Q9CYG7|TOM34_MOUSE Mitochondrial import receptor subunit TOM34 OS=Mus musculus GN=Tomm34 PE=1 SV=1 135 386 1.0E-13
sp|A4K2V0|TOM34_PONAB Mitochondrial import receptor subunit TOM34 OS=Pongo abelii GN=TOMM34 PE=2 SV=1 135 399 2.0E-13
sp|Q9MUK5|TOC64_PEA Translocon at the outer membrane of chloroplasts 64 OS=Pisum sativum GN=TOC64 PE=1 SV=1 137 246 1.0E-12
sp|Q84K11|PPP5_SOLLC Serine/threonine-protein phosphatase 5 OS=Solanum lycopersicum GN=PP5 PE=1 SV=1 133 223 2.0E-12
sp|Q80ZX8|SPAG1_MOUSE Sperm-associated antigen 1 OS=Mus musculus GN=Spag1 PE=1 SV=1 121 246 2.0E-12
sp|Q68FQ7|RPAP3_RAT RNA polymerase II-associated protein 3 OS=Rattus norvegicus GN=Rpap3 PE=1 SV=1 101 433 5.0E-12
sp|O13797|SGT2_SCHPO Small glutamine-rich tetratricopeptide repeat-containing protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sgt2 PE=3 SV=1 116 209 7.0E-12
sp|O18158|OGT1_CAEEL UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase OS=Caenorhabditis elegans GN=ogt-1 PE=1 SV=2 339 609 8.0E-12
sp|Q5U2X2|SPAG1_RAT Sperm-associated antigen 1 OS=Rattus norvegicus GN=Spag1 PE=1 SV=1 121 246 2.0E-11
sp|Q8NBP0|TTC13_HUMAN Tetratricopeptide repeat protein 13 OS=Homo sapiens GN=TTC13 PE=2 SV=3 356 550 4.0E-11
sp|Q8CGY8|OGT1_MOUSE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Mus musculus GN=Ogt PE=1 SV=2 339 609 2.0E-10
sp|P56558|OGT1_RAT UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Rattus norvegicus GN=Ogt PE=1 SV=1 339 609 2.0E-10
sp|O15294|OGT1_HUMAN UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Homo sapiens GN=OGT PE=1 SV=3 339 609 2.0E-10
sp|Q27HV0|OGT1_PIG UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Sus scrofa GN=OGT PE=2 SV=1 339 609 2.0E-10
sp|Q12118|SGT2_YEAST Small glutamine-rich tetratricopeptide repeat-containing protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SGT2 PE=1 SV=1 128 247 2.0E-10
sp|P81436|OGT1_RABIT UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Oryctolagus cuniculus GN=OGT PE=1 SV=2 339 609 2.0E-10
sp|Q99614|TTC1_HUMAN Tetratricopeptide repeat protein 1 OS=Homo sapiens GN=TTC1 PE=1 SV=1 100 269 2.0E-10
sp|Q54VG4|SGT_DICDI Small glutamine-rich tetratricopeptide repeat-containing protein OS=Dictyostelium discoideum GN=sgt PE=1 SV=1 133 220 3.0E-10
sp|Q8CGY8|OGT1_MOUSE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Mus musculus GN=Ogt PE=1 SV=2 317 580 8.0E-10
sp|P56558|OGT1_RAT UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Rattus norvegicus GN=Ogt PE=1 SV=1 317 580 9.0E-10
sp|O15294|OGT1_HUMAN UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Homo sapiens GN=OGT PE=1 SV=3 317 580 1.0E-09
sp|Q27HV0|OGT1_PIG UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Sus scrofa GN=OGT PE=2 SV=1 317 580 1.0E-09
sp|P81436|OGT1_RABIT UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Oryctolagus cuniculus GN=OGT PE=1 SV=2 317 580 1.0E-09
sp|P0CT30|SGT2_USTMA Small glutamine-rich tetratricopeptide repeat-containing protein 2 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_10205 PE=3 SV=1 133 230 1.0E-09
sp|Q9H6T3|RPAP3_HUMAN RNA polymerase II-associated protein 3 OS=Homo sapiens GN=RPAP3 PE=1 SV=2 136 394 2.0E-09
sp|F4KCL7|OE64M_ARATH Outer envelope protein 64, mitochondrial OS=Arabidopsis thaliana GN=OM64 PE=1 SV=1 136 246 2.0E-09
sp|Q04737|Y751_SYNY3 TPR repeat-containing protein slr0751 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0751 PE=3 SV=1 340 458 2.0E-09
sp|Q84XU2|PPP5_ARATH Serine/threonine-protein phosphatase 5 OS=Arabidopsis thaliana GN=PAPP5 PE=1 SV=1 133 223 2.0E-09
sp|O54981|STIP1_CRIGR Stress-induced-phosphoprotein 1 OS=Cricetulus griseus GN=STIP1 PE=2 SV=1 136 575 3.0E-09
sp|Q9LVH5|OE64C_ARATH Outer envelope protein 64, chloroplastic OS=Arabidopsis thaliana GN=OEP64 PE=1 SV=1 137 247 3.0E-09
sp|Q9M8Y0|SEC_ARATH Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SEC OS=Arabidopsis thaliana GN=SEC PE=2 SV=1 310 573 3.0E-09
sp|Q60864|STIP1_MOUSE Stress-induced-phosphoprotein 1 OS=Mus musculus GN=Stip1 PE=1 SV=1 136 575 4.0E-09
sp|O35814|STIP1_RAT Stress-induced-phosphoprotein 1 OS=Rattus norvegicus GN=Stip1 PE=1 SV=1 136 575 4.0E-09
sp|Q9D706|RPAP3_MOUSE RNA polymerase II-associated protein 3 OS=Mus musculus GN=Rpap3 PE=1 SV=1 115 394 4.0E-09
sp|Q07617|SPAG1_HUMAN Sperm-associated antigen 1 OS=Homo sapiens GN=SPAG1 PE=1 SV=3 134 398 5.0E-09
sp|Q3ZBR5|TTC1_BOVIN Tetratricopeptide repeat protein 1 OS=Bos taurus GN=TTC1 PE=2 SV=1 118 257 6.0E-09
sp|Q91Z38|TTC1_MOUSE Tetratricopeptide repeat protein 1 OS=Mus musculus GN=Ttc1 PE=1 SV=1 99 269 9.0E-09
sp|P31948|STIP1_HUMAN Stress-induced-phosphoprotein 1 OS=Homo sapiens GN=STIP1 PE=1 SV=1 136 575 1.0E-08
sp|Q60864|STIP1_MOUSE Stress-induced-phosphoprotein 1 OS=Mus musculus GN=Stip1 PE=1 SV=1 124 227 2.0E-08
sp|O35814|STIP1_RAT Stress-induced-phosphoprotein 1 OS=Rattus norvegicus GN=Stip1 PE=1 SV=1 124 227 2.0E-08
sp|P31948|STIP1_HUMAN Stress-induced-phosphoprotein 1 OS=Homo sapiens GN=STIP1 PE=1 SV=1 124 227 2.0E-08
sp|P15705|STI1_YEAST Heat shock protein STI1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STI1 PE=1 SV=1 133 210 2.0E-08
sp|Q3ZBZ8|STIP1_BOVIN Stress-induced-phosphoprotein 1 OS=Bos taurus GN=STIP1 PE=2 SV=1 136 575 2.0E-08
sp|O70593|SGTA_RAT Small glutamine-rich tetratricopeptide repeat-containing protein alpha OS=Rattus norvegicus GN=Sgta PE=1 SV=1 127 230 3.0E-08
sp|Q86TV6|TTC7B_HUMAN Tetratricopeptide repeat protein 7B OS=Homo sapiens GN=TTC7B PE=1 SV=3 366 514 3.0E-08
sp|Q8BJU0|SGTA_MOUSE Small glutamine-rich tetratricopeptide repeat-containing protein alpha OS=Mus musculus GN=Sgta PE=1 SV=2 127 230 3.0E-08
sp|Q80W98|SGTB_RAT Small glutamine-rich tetratricopeptide repeat-containing protein beta OS=Rattus norvegicus GN=Sgtb PE=1 SV=1 131 301 3.0E-08
sp|Q3ZBZ8|STIP1_BOVIN Stress-induced-phosphoprotein 1 OS=Bos taurus GN=STIP1 PE=2 SV=1 124 227 4.0E-08
sp|Q8ILC1|STI1L_PLAF7 STI1-like protein OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0324 PE=3 SV=1 123 462 4.0E-08
sp|Q8VD33|SGTB_MOUSE Small glutamine-rich tetratricopeptide repeat-containing protein beta OS=Mus musculus GN=Sgtb PE=1 SV=1 131 301 4.0E-08
sp|O54981|STIP1_CRIGR Stress-induced-phosphoprotein 1 OS=Cricetulus griseus GN=STIP1 PE=2 SV=1 124 227 5.0E-08
sp|Q5ZKQ3|RPAP3_CHICK RNA polymerase II-associated protein 3 OS=Gallus gallus GN=RPAP3 PE=2 SV=1 137 390 5.0E-08
sp|Q84JR9|TTL4_ARATH TPR repeat-containing thioredoxin TTL4 OS=Arabidopsis thaliana GN=TTL4 PE=2 SV=1 132 223 5.0E-08
sp|Q5VJS5|DYXC1_RAT Dyslexia susceptibility 1 candidate gene 1 protein homolog OS=Rattus norvegicus GN=Dyx1c1 PE=1 SV=1 111 230 5.0E-08
sp|Q6DGE9|UN45B_DANRE Protein unc-45 homolog B OS=Danio rerio GN=unc45b PE=1 SV=2 131 230 6.0E-08
sp|Q07617|SPAG1_HUMAN Sperm-associated antigen 1 OS=Homo sapiens GN=SPAG1 PE=1 SV=3 136 247 1.0E-07
sp|Q80ZX8|SPAG1_MOUSE Sperm-associated antigen 1 OS=Mus musculus GN=Spag1 PE=1 SV=1 136 266 1.0E-07
sp|Q32LM2|SGTA_BOVIN Small glutamine-rich tetratricopeptide repeat-containing protein alpha OS=Bos taurus GN=SGTA PE=2 SV=1 127 230 1.0E-07
sp|Q5R8D8|DNJC7_PONAB DnaJ homolog subfamily C member 7 OS=Pongo abelii GN=DNAJC7 PE=2 SV=1 114 223 1.0E-07
sp|Q99615|DNJC7_HUMAN DnaJ homolog subfamily C member 7 OS=Homo sapiens GN=DNAJC7 PE=1 SV=2 114 223 1.0E-07
sp|Q9CYG7|TOM34_MOUSE Mitochondrial import receptor subunit TOM34 OS=Mus musculus GN=Tomm34 PE=1 SV=1 132 216 2.0E-07
sp|Q4R8N7|STIP1_MACFA Stress-induced-phosphoprotein 1 OS=Macaca fascicularis GN=STIP1 PE=2 SV=1 124 236 2.0E-07
sp|Q96EQ0|SGTB_HUMAN Small glutamine-rich tetratricopeptide repeat-containing protein beta OS=Homo sapiens GN=SGTB PE=1 SV=1 131 301 2.0E-07
sp|Q58741|Y1345_METJA TPR repeat-containing protein MJ1345 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1345 PE=3 SV=1 308 577 2.0E-07
sp|O43765|SGTA_HUMAN Small glutamine-rich tetratricopeptide repeat-containing protein alpha OS=Homo sapiens GN=SGTA PE=1 SV=1 127 230 2.0E-07
sp|Q9SRS9|CHIP_ARATH E3 ubiquitin-protein ligase CHIP OS=Arabidopsis thaliana GN=CHIP PE=1 SV=1 133 220 2.0E-07
sp|Q43468|HSOP1_SOYBN Hsp70-Hsp90 organizing protein 1 OS=Glycine max GN=HOP1 PE=1 SV=2 127 407 2.0E-07
sp|Q9SIN1|TTL3_ARATH Inactive TPR repeat-containing thioredoxin TTL3 OS=Arabidopsis thaliana GN=TTL3 PE=1 SV=2 135 223 3.0E-07
sp|Q8R368|DYXC1_MOUSE Dyslexia susceptibility 1 candidate gene 1 protein homolog OS=Mus musculus GN=Dyx1c1 PE=1 SV=2 111 230 3.0E-07
sp|Q863A5|DYXC1_GORGO Dyslexia susceptibility 1 candidate gene 1 protein homolog OS=Gorilla gorilla gorilla GN=DYX1C1 PE=3 SV=1 115 230 3.0E-07
sp|Q9MAH1|TTL1_ARATH TPR repeat-containing thioredoxin TTL1 OS=Arabidopsis thaliana GN=TTL1 PE=1 SV=1 133 225 3.0E-07
sp|Q8WXU2|DYXC1_HUMAN Dyslexia susceptibility 1 candidate gene 1 protein OS=Homo sapiens GN=DYX1C1 PE=1 SV=2 115 230 3.0E-07
sp|Q863A6|DYXC1_PANPA Dyslexia susceptibility 1 candidate gene 1 protein homolog OS=Pan paniscus GN=DYX1C1 PE=3 SV=1 115 230 3.0E-07
sp|Q863A7|DYXC1_PANTR Dyslexia susceptibility 1 candidate gene 1 protein homolog OS=Pan troglodytes GN=DYX1C1 PE=3 SV=1 115 230 3.0E-07
sp|Q4R8N7|STIP1_MACFA Stress-induced-phosphoprotein 1 OS=Macaca fascicularis GN=STIP1 PE=2 SV=1 136 545 4.0E-07
sp|Q863A4|DYXC1_PONPY Dyslexia susceptibility 1 candidate gene 1 protein homolog OS=Pongo pygmaeus GN=DYX1C1 PE=3 SV=1 115 230 4.0E-07
sp|O18158|OGT1_CAEEL UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase OS=Caenorhabditis elegans GN=ogt-1 PE=1 SV=2 286 502 6.0E-07
sp|Q9QYI3|DNJC7_MOUSE DnaJ homolog subfamily C member 7 OS=Mus musculus GN=Dnajc7 PE=1 SV=2 114 223 6.0E-07
sp|Q5U2X2|SPAG1_RAT Sperm-associated antigen 1 OS=Rattus norvegicus GN=Spag1 PE=1 SV=1 136 250 7.0E-07
sp|Q9USI5|STI1_SCHPO Heat shock protein sti1 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sti1 PE=3 SV=1 133 209 8.0E-07
sp|Q58350|Y940_METJA TPR repeat-containing protein MJ0940 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0940 PE=3 SV=1 274 502 8.0E-07
sp|Q3KRD5|TOM34_RAT Mitochondrial import receptor subunit TOM34 OS=Rattus norvegicus GN=Tomm34 PE=1 SV=1 136 225 9.0E-07
sp|O18158|OGT1_CAEEL UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase OS=Caenorhabditis elegans GN=ogt-1 PE=1 SV=2 317 577 2.0E-06
sp|O43049|PPT1_SCHPO Serine/threonine-protein phosphatase T OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppt1 PE=3 SV=2 133 268 2.0E-06
sp|D7REX8|UN45B_XENTR Protein unc-45 homolog B OS=Xenopus tropicalis GN=unc45b PE=1 SV=1 134 223 2.0E-06
sp|F8RP11|HSOP_WHEAT Hsp70-Hsp90 organizing protein OS=Triticum aestivum GN=HOP PE=1 SV=1 137 282 2.0E-06
sp|Q68F64|UN45B_XENLA Protein unc-45 homolog B OS=Xenopus laevis GN=unc45b PE=2 SV=1 134 223 2.0E-06
sp|Q96AY4|TTC28_HUMAN Tetratricopeptide repeat protein 28 OS=Homo sapiens GN=TTC28 PE=1 SV=4 135 230 2.0E-06
sp|Q54IP0|DNJC7_DICDI DnaJ homolog subfamily C member 7 homolog OS=Dictyostelium discoideum GN=dnajc7 PE=1 SV=1 137 230 2.0E-06
sp|Q5XEP2|HSOP2_ARATH Hsp70-Hsp90 organizing protein 2 OS=Arabidopsis thaliana GN=HOP2 PE=1 SV=1 137 220 2.0E-06
sp|Q8NBP0|TTC13_HUMAN Tetratricopeptide repeat protein 13 OS=Homo sapiens GN=TTC13 PE=2 SV=3 337 470 3.0E-06
sp|Q6NU95|RPAP3_XENLA RNA polymerase II-associated protein 3 OS=Xenopus laevis GN=rpap3 PE=2 SV=1 109 389 3.0E-06
sp|Q9SIN1|TTL3_ARATH Inactive TPR repeat-containing thioredoxin TTL3 OS=Arabidopsis thaliana GN=TTL3 PE=1 SV=2 135 210 5.0E-06
sp|F4JS25|SRFR1_ARATH Suppressor of RPS4-RLD 1 OS=Arabidopsis thaliana GN=SRFR1 PE=1 SV=1 343 503 5.0E-06
sp|Q8CGY6|UN45B_MOUSE Protein unc-45 homolog B OS=Mus musculus GN=Unc45b PE=1 SV=1 130 251 6.0E-06
sp|Q84JR9|TTL4_ARATH TPR repeat-containing thioredoxin TTL4 OS=Arabidopsis thaliana GN=TTL4 PE=2 SV=1 135 252 7.0E-06
sp|Q58741|Y1345_METJA TPR repeat-containing protein MJ1345 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1345 PE=3 SV=1 337 502 8.0E-06
sp|Q57711|Y941_METJA TPR repeat-containing protein MJ0941 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0941 PE=3 SV=3 316 471 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 37 59 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|766
MASPAPSMPPGPPAGVVLEPPPSAWDRLASWVSENKAVVYTIAGVAVVVTGAGVVYYLGSDPSKSDSSPKLSKKE
RRKRKEAERKAAETKSSPESSKSPPAAAAVSAESDSDLPDIDEATVGNLTQQERDGHAAKLKQAGNKAYGDKAYN
RAIDLYSRAILCKPDPVFYSNRAACYSAMSDWDKVVEDTTAAINMDPYYVKAINRRATAYEHQKKYSDALLDFTA
SCIIDNFKSDSTAQAVERLLKIIGEQRAKEMMATRTPKLPSPVFIGNYLQSFRQRPRPSGLEDTAELDPDHGSGQ
LQLGLRCLEKKTADGYEEARLAFEKALELGGLGEHEALAYNLRGTMRTLLGNHADAVKDFDRSIELDPGMIQSYI
KRASISLELGDTAKADAEFSKAIEQNSSDPDVYYHRAQANFIKGDLSEAQKDYQKSIDLDKDFIFSHIQLGVTQY
KMGSIASSMATFRRCMKNFPKTSDVYNYYGELLLDQGNYAEAVEKFDTAIELEKQSKPMAINVLALINKSLALFH
WKQDFEEPQKLCQKALIIDPECDIAVATMAQLLLQQNNVAEAVKYFERTAELARTEGEIINALSYAEATRTQVKV
TEKYPKLAAKLAGGGGAPPGLRMGPQ*
Coding >Ophun1|766
ATGGCCAGTCCTGCTCCGTCGATGCCTCCAGGGCCGCCTGCCGGTGTCGTCCTCGAGCCTCCCCCCTCGGCCTGG
GATCGCCTGGCTTCGTGGGTGTCGGAGAATAAAGCCGTCGTCTACACCATCGCCGGCGTCGCTGTCGTCGTCACA
GGTGCCGGTGTCGTCTATTATCTCGGCTCTGATCCGTCAAAGTCGGATTCGTCTCCCAAGCTCAGCAAAAAGGAG
AGGCGGAAGCGGAAAGAGGCCGAGCGTAAGGCTGCAGAGACAAAGTCCAGCCCGGAATCCTCCAAATCGCCTCCG
GCTGCCGCTGCCGTATCCGCCGAGAGCGACTCGGACCTGCCCGACATCGACGAGGCGACTGTGGGCAACCTGACG
CAACAAGAGCGCGACGGCCATGCCGCCAAGCTCAAGCAGGCCGGAAACAAGGCATACGGTGACAAGGCCTACAAC
CGGGCCATCGACCTCTACTCCCGCGCCATCCTCTGCAAGCCCGACCCCGTCTTCTACTCCAACCGCGCCGCCTGC
TATAGCGCAATGAGCGATTGGGACAAGGTCGTCGAGGACACGACGGCAGCCATCAACATGGACCCCTACTACGTC
AAAGCCATCAATCGCCGGGCAACGGCTTACGAGCACCAGAAGAAGTACTCGGATGCCCTGCTCGACTTTACCGCC
TCGTGCATCATCGACAACTTCAAGAGCGATTCCACCGCCCAGGCTGTCGAGAGGCTTCTCAAGATCATCGGCGAG
CAACGAGCCAAGGAAATGATGGCCACGCGAACTCCGAAGCTCCCCAGCCCCGTCTTCATCGGCAACTACCTCCAG
AGCTTCCGCCAAAGGCCGCGCCCCTCGGGGCTCGAAGACACGGCCGAGCTGGATCCGGATCATGGCAGTGGCCAG
CTGCAGTTGGGTCTCCGCTGTCTCGAGAAGAAGACGGCTGACGGTTACGAAGAGGCACGGCTGGCGTTCGAAAAG
GCTCTCGAGCTCGGCGGCCTCGGAGAGCACGAGGCTCTGGCCTACAATCTCAGGGGCACCATGCGCACTCTTCTC
GGCAACCACGCCGATGCCGTCAAGGACTTTGACCGCAGCATCGAGCTCGACCCGGGCATGATTCAGAGCTACATC
AAGCGCGCCAGCATCAGCCTCGAGCTCGGCGATACGGCAAAGGCCGACGCCGAGTTCTCCAAGGCCATTGAGCAG
AACAGCTCCGACCCGGATGTCTACTACCACCGCGCACAGGCCAACTTTATCAAAGGCGACCTGTCGGAGGCTCAG
AAAGACTACCAAAAGTCCATCGACCTGGACAAGGACTTCATCTTCTCCCACATCCAGCTGGGCGTGACGCAGTAC
AAGATGGGCTCCATTGCCTCGTCCATGGCTACCTTTCGCCGCTGCATGAAGAATTTCCCCAAGACCTCTGACGTC
TACAATTACTACGGTGAGCTGCTGCTCGATCAGGGCAATTATGCCGAGGCGGTCGAGAAGTTCGACACGGCCATA
GAGCTGGAGAAGCAGTCTAAGCCGATGGCCATCAACGTGCTGGCCCTCATCAACAAGTCGCTGGCTCTCTTCCAC
TGGAAGCAGGACTTTGAAGAGCCGCAGAAGCTGTGCCAAAAGGCCCTCATCATTGACCCGGAATGCGACATCGCC
GTCGCCACCATGGCCCAGCTTCTCCTCCAGCAGAACAACGTGGCGGAGGCAGTCAAGTACTTTGAGCGCACGGCC
GAGTTGGCCCGCACCGAGGGCGAGATCATCAACGCCCTCTCGTACGCCGAGGCGACGAGGACGCAGGTCAAGGTG
ACGGAGAAGTATCCCAAGTTGGCGGCCAAGCTGGCGGGCGGTGGCGGCGCTCCCCCGGGCCTACGGATGGGCCCT
CAATGA
Transcript >Ophun1|766
ATGGCCAGTCCTGCTCCGTCGATGCCTCCAGGGCCGCCTGCCGGTGTCGTCCTCGAGCCTCCCCCCTCGGCCTGG
GATCGCCTGGCTTCGTGGGTGTCGGAGAATAAAGCCGTCGTCTACACCATCGCCGGCGTCGCTGTCGTCGTCACA
GGTGCCGGTGTCGTCTATTATCTCGGCTCTGATCCGTCAAAGTCGGATTCGTCTCCCAAGCTCAGCAAAAAGGAG
AGGCGGAAGCGGAAAGAGGCCGAGCGTAAGGCTGCAGAGACAAAGTCCAGCCCGGAATCCTCCAAATCGCCTCCG
GCTGCCGCTGCCGTATCCGCCGAGAGCGACTCGGACCTGCCCGACATCGACGAGGCGACTGTGGGCAACCTGACG
CAACAAGAGCGCGACGGCCATGCCGCCAAGCTCAAGCAGGCCGGAAACAAGGCATACGGTGACAAGGCCTACAAC
CGGGCCATCGACCTCTACTCCCGCGCCATCCTCTGCAAGCCCGACCCCGTCTTCTACTCCAACCGCGCCGCCTGC
TATAGCGCAATGAGCGATTGGGACAAGGTCGTCGAGGACACGACGGCAGCCATCAACATGGACCCCTACTACGTC
AAAGCCATCAATCGCCGGGCAACGGCTTACGAGCACCAGAAGAAGTACTCGGATGCCCTGCTCGACTTTACCGCC
TCGTGCATCATCGACAACTTCAAGAGCGATTCCACCGCCCAGGCTGTCGAGAGGCTTCTCAAGATCATCGGCGAG
CAACGAGCCAAGGAAATGATGGCCACGCGAACTCCGAAGCTCCCCAGCCCCGTCTTCATCGGCAACTACCTCCAG
AGCTTCCGCCAAAGGCCGCGCCCCTCGGGGCTCGAAGACACGGCCGAGCTGGATCCGGATCATGGCAGTGGCCAG
CTGCAGTTGGGTCTCCGCTGTCTCGAGAAGAAGACGGCTGACGGTTACGAAGAGGCACGGCTGGCGTTCGAAAAG
GCTCTCGAGCTCGGCGGCCTCGGAGAGCACGAGGCTCTGGCCTACAATCTCAGGGGCACCATGCGCACTCTTCTC
GGCAACCACGCCGATGCCGTCAAGGACTTTGACCGCAGCATCGAGCTCGACCCGGGCATGATTCAGAGCTACATC
AAGCGCGCCAGCATCAGCCTCGAGCTCGGCGATACGGCAAAGGCCGACGCCGAGTTCTCCAAGGCCATTGAGCAG
AACAGCTCCGACCCGGATGTCTACTACCACCGCGCACAGGCCAACTTTATCAAAGGCGACCTGTCGGAGGCTCAG
AAAGACTACCAAAAGTCCATCGACCTGGACAAGGACTTCATCTTCTCCCACATCCAGCTGGGCGTGACGCAGTAC
AAGATGGGCTCCATTGCCTCGTCCATGGCTACCTTTCGCCGCTGCATGAAGAATTTCCCCAAGACCTCTGACGTC
TACAATTACTACGGTGAGCTGCTGCTCGATCAGGGCAATTATGCCGAGGCGGTCGAGAAGTTCGACACGGCCATA
GAGCTGGAGAAGCAGTCTAAGCCGATGGCCATCAACGTGCTGGCCCTCATCAACAAGTCGCTGGCTCTCTTCCAC
TGGAAGCAGGACTTTGAAGAGCCGCAGAAGCTGTGCCAAAAGGCCCTCATCATTGACCCGGAATGCGACATCGCC
GTCGCCACCATGGCCCAGCTTCTCCTCCAGCAGAACAACGTGGCGGAGGCAGTCAAGTACTTTGAGCGCACGGCC
GAGTTGGCCCGCACCGAGGGCGAGATCATCAACGCCCTCTCGTACGCCGAGGCGACGAGGACGCAGGTCAAGGTG
ACGGAGAAGTATCCCAAGTTGGCGGCCAAGCTGGCGGGCGGTGGCGGCGCTCCCCCGGGCCTACGGATGGGCCCT
CAATGA
Gene >Ophun1|766
ATGGCCAGTCCTGCTCCGTCGATGCCTCCAGGGCCGCCTGCCGGTGTCGTCCTCGAGCCTCCCCCCTCGGCCTGG
GATCGCCTGGCTTCGTGGGTGTCGGAGAATAAAGCCGTCGTCTACACCATCGCCGGCGTCGCTGTCGTCGTCACA
GGTGCCGGTGTCGTCTATTATCTCGGCTCTGATCCGGTGAGCTATCTTTTCTTGCTACTGCGTCTTCCTGCTCCT
CTCAACTTGTTATCGCTGACCCGTCGCGATGACACAGTCAAAGTCGGATTCGTCTCCCAAGCTCAGCAAAAAGGA
GAGGCGGAAGCGGAAAGAGGCCGAGCGTAAGGCTGCAGAGACAAAGTCCAGCCCGGAATCCTCCAAATCGCCTCC
GGCTGCCGCTGCCGTATCCGCCGAGAGCGACTCGGACCTGCCCGACATCGACGAGGCGACTGTGGGCAACCTGAC
GCAACAAGAGCGCGACGGCCATGCCGCCAAGCTCAAGCAGGCCGGAAACAAGGCATACGGTGACAAGGCCTACAA
CCGGGCCATCGACCTCTACTCCCGCGCCATCCTCTGCAAGCCCGACCCCGTCTTCTACTCCAACCGCGCCGCCTG
CTATAGCGCAATGAGCGATTGGGACAAGGTCGTCGAGGACACGACGGCAGCCATCAACATGGACCCCTACTACGT
CAAAGCCATCAATCGCCGGGCAACGGCTTACGAGCACCAGAAGAAGTACTCGGATGCCCTGCTCGACTTTACCGC
CTCGTGCATCATCGACAACTTCAAGAGCGATTCCACCGCCCAGGCTGTCGAGAGGCTTCTCAAGATCATCGGCGA
GCAACGAGCCAAGGAAATGATGGCCACGCGAACTCCGAAGCTCCCCAGCCCCGTCTTCATCGGCAACTACCTCCA
GAGCTTCCGCCAAAGGCCGCGCCCCTCGGGGCTCGAAGACACGGCCGAGCTGGATCCGGATCATGGCAGTGGCCA
GCTGCAGTTGGGTCTCCGCTGTCTCGAGAAGAAGACGGCTGACGGTTACGAAGAGGCACGGCTGGCGTTCGAAAA
GGCTCTCGAGCTCGGCGGCCTCGGAGAGCACGAGGCTCTGGCCTACAATCTCAGGGGCACCATGCGCACTCTTCT
CGGCAACCACGCCGATGCCGTCAAGGACTTTGACCGCAGCATCGAGCTCGACCCGGGCATGATTCAGAGCTACAT
CAAGCGCGCCAGCATCAGCCTCGAGCTCGGCGATACGGCAAAGGCCGACGCCGAGTTCTCCAAGGCCATTGAGCA
GAACAGCTCCGACCCGGATGTCTACTACCACCGCGCACAGGCCAACTTTATCAAAGGCGACCTGTCGGAGGCTCA
GAAAGACTACCAAAAGTCCATCGACCTGGACAAGGACTTCATCTTCTCCCACATCCAGCTGGGCGTGACGCAGTA
CAAGATGGGCTCCATTGCCTCGTCCATGGCTACCTTTCGCCGCTGCATGAAGAATTTCCCCAAGACCTCTGACGT
CTACAATTACTACGGTGAGCTGCTGCTCGATCAGGGCAATTATGCCGAGGCGGTCGAGAAGTTCGACACGGCCAT
AGAGCTGGAGAAGCAGTCTAAGCCGATGGCCATCAACGTGCTGGCCCTCATCAACAAGTCGCTGGCTCTCTTCCA
CTGGAAGCAGGACTTTGAAGAGCCGCAGAAGCTGTGCCAAAAGGCCCTCATCAGTAAGCCCCATTCCCTCACGTC
TCCCATAGAAGCGAAGGGAATTGCTGACGGACGTCGCCTCGCAGTTGACCCGGAATGCGACATCGCCGTCGCCAC
CATGGCCCAGCTTCTCCTCCAGCAGAACAACGTGGCGGAGGCAGTCAAGTACTTTGAGCGCACGGCCGAGTTGGC
CCGCACCGAGGGCGAGATCATCAACGCCCTCTCGTACGCCGAGGCGACGAGGACGCAGGTCAAGGTGACGGAGAA
GTATCCCAAGTTGGCGGCCAAGCTGGCGGGCGGTGGCGGCGCTCCCCCGGGCCTACGGATGGGCCCTCAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail