Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7615
Gene name
LocationContig_997:3298..3761
Strand-
Gene length (bp)463
Transcript length (bp)258
Coding sequence length (bp)258
Protein length (aa) 86

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07189 SF3b10 Splicing factor 3B subunit 10 (SF3b10) 1.1E-37 4 81

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9LW64|SF3BA_ARATH Uncharacterized protein At3g23325 OS=Arabidopsis thaliana GN=At3g23325 PE=3 SV=1 2 85 1.0E-30
sp|P58728|SF3BB_ARATH Uncharacterized protein At4g14342 OS=Arabidopsis thaliana GN=At4g14342 PE=3 SV=1 2 85 6.0E-30
sp|Q9P7R6|YHV5_SCHPO Uncharacterized protein C211.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC211.05 PE=3 SV=1 3 82 3.0E-29
sp|Q9BWJ5|SF3B5_HUMAN Splicing factor 3B subunit 5 OS=Homo sapiens GN=SF3B5 PE=1 SV=1 4 83 6.0E-27
sp|Q56K13|SF3B5_BOVIN Splicing factor 3B subunit 5 OS=Bos taurus GN=SF3B5 PE=3 SV=1 4 83 6.0E-27
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9LW64|SF3BA_ARATH Uncharacterized protein At3g23325 OS=Arabidopsis thaliana GN=At3g23325 PE=3 SV=1 2 85 1.0E-30
sp|P58728|SF3BB_ARATH Uncharacterized protein At4g14342 OS=Arabidopsis thaliana GN=At4g14342 PE=3 SV=1 2 85 6.0E-30
sp|Q9P7R6|YHV5_SCHPO Uncharacterized protein C211.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC211.05 PE=3 SV=1 3 82 3.0E-29
sp|Q9BWJ5|SF3B5_HUMAN Splicing factor 3B subunit 5 OS=Homo sapiens GN=SF3B5 PE=1 SV=1 4 83 6.0E-27
sp|Q56K13|SF3B5_BOVIN Splicing factor 3B subunit 5 OS=Bos taurus GN=SF3B5 PE=3 SV=1 4 83 6.0E-27
sp|Q9VHI4|SF3B5_DROME Probable splicing factor 3B subunit 5 OS=Drosophila melanogaster GN=CG11985 PE=1 SV=1 3 83 2.0E-26
sp|Q923D4|SF3B5_MOUSE Splicing factor 3B subunit 5 OS=Mus musculus GN=Sf3b5 PE=1 SV=1 4 83 1.0E-25
sp|Q55BF5|SF3B5_DICDI Splicing factor 3B subunit 5 OS=Dictyostelium discoideum GN=sf3b5 PE=3 SV=1 9 85 7.0E-23
sp|P0C074|YSF3_YEAST RDS3 complex subunit 10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YSF3 PE=1 SV=1 18 73 4.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2083
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4006
Ophiocordyceps australis map64 (Brazil) OphauB2|7400
Ophiocordyceps camponoti-floridani Ophcf2|06213
Ophiocordyceps camponoti-rufipedis Ophun1|7615 (this protein)
Ophiocordyceps kimflemingae Ophio5|7119
Ophiocordyceps subramaniannii Hirsu2|2414

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7615
MAADKLRTQQELERLQAKYVGTGHPDTTSWEWKTNVQRDTFSSIVGHRPLLAYIALAENEPICKVRAAMIRKMVQ
PCGPPPPRED*
Coding >Ophun1|7615
ATGGCGGCCGACAAGCTCCGCACGCAGCAGGAACTCGAGCGCCTTCAAGCCAAGTACGTCGGCACCGGCCACCCG
GACACCACGAGCTGGGAGTGGAAGACCAACGTGCAGCGCGACACCTTTTCGTCCATTGTCGGGCATCGGCCGTTG
CTGGCGTATATTGCTCTTGCGGAGAATGAGCCCATCTGCAAGGTTCGCGCCGCTATGATTCGTAAAATGGTTCAG
CCTTGTGGTCCACCTCCGCCTCGCGAAGATTGA
Transcript >Ophun1|7615
ATGGCGGCCGACAAGCTCCGCACGCAGCAGGAACTCGAGCGCCTTCAAGCCAAGTACGTCGGCACCGGCCACCCG
GACACCACGAGCTGGGAGTGGAAGACCAACGTGCAGCGCGACACCTTTTCGTCCATTGTCGGGCATCGGCCGTTG
CTGGCGTATATTGCTCTTGCGGAGAATGAGCCCATCTGCAAGGTTCGCGCCGCTATGATTCGTAAAATGGTTCAG
CCTTGTGGTCCACCTCCGCCTCGCGAAGATTGA
Gene >Ophun1|7615
ATGGCGGTTGGGATGTTTAGCCGAGATTCAGCCGGTGATAACAACTCAGAATCCCAATCTCCCGATTCATCACCA
AACCTCATCCACCGCATCCAATCCACCCACAATGGCAAGCACCCCCTCTTCCATGAACTCCAACACAATCTAACC
CCCTGCAGGCCGACAAGCTCCGCACGCAGCAGGAACTCGAGCGCCTTCAAGCCAAGTACGTCGGCACCGGCCACC
CGGACACCACGAGCTGGGAGTGGAAGACCAACGTGCAGCGCGACACCTTTTCGTCCATTGTCGGGCATCGGCCGT
TGCTGGCGTATATTGCTCTTGCGGAGAATGAGCCCATCTGCAAGGTTCGCGCCGCTATGATTCGTGTAAGTTTGC
CCGTGTGAGGGGAGAAGAGGCTGGTTTACTGAAGGTGTCGCAGAAAATGGTTCAGCCTTGTGGTCCACCTCCGCC
TCGCGAAGATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail