Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7614
Gene name
LocationContig_997:1741..3182
Strand+
Gene length (bp)1441
Transcript length (bp)1023
Coding sequence length (bp)1023
Protein length (aa) 341

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01454 MAGE MAGE homology domain 2.0E-60 89 286

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7U4|NSE3_SCHPO Non-structural maintenance of chromosome element 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nse3 PE=1 SV=1 85 298 3.0E-09

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7614
MLSKQTMLEAIVRSLVLRPRTKRAQSQSSTLKVVGDMKDDDDDSEQDAPPRRRPNRNASDDDLDDESTDGLDLNG
DSGNEVDVRLAKKLVRYALSCEYSRTAIRRDGIKERVLGNNHGRSFKKVLELAQKQLRAVWGMELRELPVREKMT
LHEKRQAMKSASQARGGSGAYILTSTLPEPYRSAAVLRPSKTPGEDDEAIYAGFYTLVLAFIWLSSGELSDQKLR
RCLVRLNADRNLADEKTDMTLKRMERQGYVVKKVERPPVGHEAGEPLTTWHVGPRAKEEVGLDGVMGMVREVYGS
EWGPDLEAKLHLSLGIKARPGVEGAGGASERRANGGGEAE*
Coding >Ophun1|7614
ATGTTGAGCAAACAGACGATGCTAGAAGCAATCGTGAGGTCATTGGTATTGCGACCTCGGACGAAGAGGGCACAA
TCGCAATCCTCCACGCTCAAGGTGGTGGGTGACATGAAGGACGACGACGACGACTCAGAACAAGACGCGCCTCCC
CGCCGGCGCCCGAACCGCAACGCCTCAGACGATGACCTCGACGACGAATCAACCGACGGCCTCGATCTCAACGGC
GACTCTGGCAACGAAGTCGATGTCCGGCTCGCCAAGAAGCTGGTCCGGTACGCCCTCTCGTGCGAGTACTCGCGT
ACCGCGATCCGGAGAGATGGCATCAAGGAGAGGGTTCTCGGGAATAATCATGGGCGCTCGTTTAAAAAGGTGTTG
GAACTTGCGCAGAAGCAGCTTCGAGCGGTTTGGGGCATGGAGTTGCGCGAACTGCCCGTGCGCGAGAAGATGACT
CTTCACGAGAAACGCCAAGCCATGAAGTCGGCCTCGCAGGCTAGGGGAGGATCCGGCGCCTACATTCTGACGTCG
ACGCTGCCCGAACCGTACCGAAGCGCGGCGGTGCTGCGACCGTCCAAGACACCAGGCGAGGACGACGAGGCCATC
TACGCCGGCTTCTACACCCTGGTCCTGGCCTTTATATGGCTCAGCAGCGGCGAGCTAAGCGACCAGAAGCTCAGA
CGTTGCCTCGTCCGGCTCAACGCGGACCGCAACCTGGCCGACGAGAAGACGGACATGACTCTCAAGCGGATGGAG
AGGCAGGGCTACGTGGTGAAGAAGGTGGAGAGGCCGCCCGTCGGCCACGAGGCGGGAGAGCCGCTTACGACGTGG
CACGTCGGTCCGCGCGCCAAGGAAGAGGTCGGGTTGGATGGCGTCATGGGTATGGTTCGCGAGGTGTATGGCAGC
GAATGGGGTCCGGATTTGGAGGCGAAGCTGCATCTGAGCTTGGGGATCAAGGCGCGGCCGGGTGTCGAGGGCGCG
GGGGGGGCGAGCGAGAGGCGAGCGAATGGGGGTGGTGAGGCCGAGTGA
Transcript >Ophun1|7614
ATGTTGAGCAAACAGACGATGCTAGAAGCAATCGTGAGGTCATTGGTATTGCGACCTCGGACGAAGAGGGCACAA
TCGCAATCCTCCACGCTCAAGGTGGTGGGTGACATGAAGGACGACGACGACGACTCAGAACAAGACGCGCCTCCC
CGCCGGCGCCCGAACCGCAACGCCTCAGACGATGACCTCGACGACGAATCAACCGACGGCCTCGATCTCAACGGC
GACTCTGGCAACGAAGTCGATGTCCGGCTCGCCAAGAAGCTGGTCCGGTACGCCCTCTCGTGCGAGTACTCGCGT
ACCGCGATCCGGAGAGATGGCATCAAGGAGAGGGTTCTCGGGAATAATCATGGGCGCTCGTTTAAAAAGGTGTTG
GAACTTGCGCAGAAGCAGCTTCGAGCGGTTTGGGGCATGGAGTTGCGCGAACTGCCCGTGCGCGAGAAGATGACT
CTTCACGAGAAACGCCAAGCCATGAAGTCGGCCTCGCAGGCTAGGGGAGGATCCGGCGCCTACATTCTGACGTCG
ACGCTGCCCGAACCGTACCGAAGCGCGGCGGTGCTGCGACCGTCCAAGACACCAGGCGAGGACGACGAGGCCATC
TACGCCGGCTTCTACACCCTGGTCCTGGCCTTTATATGGCTCAGCAGCGGCGAGCTAAGCGACCAGAAGCTCAGA
CGTTGCCTCGTCCGGCTCAACGCGGACCGCAACCTGGCCGACGAGAAGACGGACATGACTCTCAAGCGGATGGAG
AGGCAGGGCTACGTGGTGAAGAAGGTGGAGAGGCCGCCCGTCGGCCACGAGGCGGGAGAGCCGCTTACGACGTGG
CACGTCGGTCCGCGCGCCAAGGAAGAGGTCGGGTTGGATGGCGTCATGGGTATGGTTCGCGAGGTGTATGGCAGC
GAATGGGGTCCGGATTTGGAGGCGAAGCTGCATCTGAGCTTGGGGATCAAGGCGCGGCCGGGTGTCGAGGGCGCG
GGGGGGGCGAGCGAGAGGCGAGCGAATGGGGGTGGTGAGGCCGAGTGA
Gene >Ophun1|7614
ATGTTGAGCAAACAGACGATGCTAGAAGCAATCGTGAGGTCATTGGTATTGCGACCTCGGACGAAGAGGGCACAA
TCGCAATCCTCCACGCTCAAGGTGGTGGGTGACATGAAGGTGAGAAGAGAAAGCTCTTCACAGGGATCGTCAAGA
ATTTTTGCGGCGATAAGGGTGCTGATAAGCGATAAGCTGATAAGCCTTTTTTGGTCTTGGCGCGTCTCTTCGCGT
CTTGATGAGAGATCAGCAGCAGTCCGTTTCATTATAGGCATTTATCTTGAGGGCGGTCGCAGCATAAGCGCAGCC
AGAGATACCGCTTCATCTCGTTTCAATCTCATATCCGAACCGGAAGAATGCCTCCGCAAAGGAGAAGACGCCCGG
TAACCCCCGCGTCTCCCGCCCAGACTGCCCAACTAACCACGACGACCAGGACGACGACGACGACTCAGAACAAGA
CGCGCCTCCCCGCCGGCGCCCGAACCGCAACGCCTCAGACGATGACCTCGACGACGAATCAACCGACGGCCTCGA
TCTCAACGGCGACTCTGGCAACGAAGTCGATGTCCGGCTCGCCAAGAAGCTGGTCCGGTACGCCCTCTCGTGCGA
GTACTCGCGTACCGCGATCCGGAGAGATGGCATCAAGGAGAGGGGTAGGTCTCTTCTTTGTGTTTTGGCTTGGTC
TTTCGCTGATGTTGTCGTGCAAGTTCTCGGGAATAATCATGGGCGCTCGTTTAAAAAGGTGTTGGAACTTGCGCA
GAAGCAGCTTCGAGCGGTTTGGGGCATGGAGTTGCGCGAACTGCCCGTGCGCGAGAAGATGACTCTTCACGAGAA
ACGCCAAGGTCAGTTTGACCATATCTCGCGCGACAAGTACACAGATTGACAGTACGATGCAGCCATGAAGTCGGC
CTCGCAGGCTAGGGGAGGATCCGGCGCCTACATTCTGACGTCGACGCTGCCCGAACCGTACCGAAGCGCGGCGGT
GCTGCGACCGTCCAAGACACCAGGCGAGGACGACGAGGCCATCTACGCCGGCTTCTACACCCTGGTCCTGGCCTT
TATATGGCTCAGCAGCGGCGAGCTAAGCGACCAGAAGCTCAGACGTTGCCTCGTCCGGCTCAACGCGGACCGCAA
CCTGGCCGACGAGAAGACGGACATGACTCTCAAGCGGATGGAGAGGCAGGGCTACGTGGTGAAGAAGGTGGAGAG
GCCGCCCGTCGGCCACGAGGCGGGAGAGCCGCTTACGACGTGGCACGTCGGTCCGCGCGCCAAGGAAGAGGTCGG
GTTGGATGGCGTCATGGGTATGGTTCGCGAGGTGTATGGCAGCGAATGGGGTCCGGATTTGGAGGCGAAGCTGCA
TCTGAGCTTGGGGATCAAGGCGCGGCCGGGTGTCGAGGGCGCGGGGGGGGCGAGCGAGAGGCGAGCGAATGGGGG
TGGTGAGGCCGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail