Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7602
Gene name
LocationContig_99:28089..29436
Strand-
Gene length (bp)1347
Transcript length (bp)1347
Coding sequence length (bp)1347
Protein length (aa) 449

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup377
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1721
Ophiocordyceps australis 1348a (Ghana) OphauG2|6957
Ophiocordyceps australis map64 (Brazil) OphauB2|7725
Ophiocordyceps camponoti-floridani Ophcf2|05576
Ophiocordyceps camponoti-rufipedis Ophun1|7602 (this protein)
Ophiocordyceps kimflemingae Ophio5|2612
Ophiocordyceps subramaniannii Hirsu2|1069
Ophiocordyceps subramaniannii Hirsu2|5673
Ophiocordyceps subramaniannii Hirsu2|5701

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7602
MAILNQSHDILFCILDLLPPPSLNSTSKLTKPIRSVTEARLYNSVTAAWAPASVPPPTALLLRTLLERPDLSRCV
RHLRLVGDGFGHEVRVCEPPSFTLDSASLARASALISAMGVSFADMWISELQSGSIDAIVATLLVTMPNLETLYL
DPNFTVRSRVLGSLFQSTLVETPDNRHHHQLPSFRNLRNVTFSRRFNEHLQLYINNSADLLPLFYLPNLQHLSIS
LDNPLCFDWPAEAPKAPSLKSLEVSRLREAALASLLAPLSQLQHLRWNCFYQPDLDEGISTNVIQLDLMIKAFHQ
VRHTLTDLTVTAETRRSIMAFYEPPPVQIRGSLDGLLHLGALRRLSMPWVFLMGFSESSTCLRLPLPSSLEELVL
TDDLADKGQWQWYDDSIVSAIKSQLECWDRPTDSSLRRIVLPIPLQGGQMTAGRREQLREIGNDAGLELSWRE*
Coding >Ophun1|7602
ATGGCCATCCTCAACCAATCCCACGACATCCTTTTCTGCATCCTCGACCTCCTCCCTCCCCCCTCCCTCAACTCC
ACAAGCAAGCTCACCAAGCCCATCCGCTCCGTAACCGAAGCCCGTCTCTACAACTCCGTCACGGCCGCCTGGGCA
CCAGCATCCGTCCCGCCCCCGACAGCCCTCCTTCTCCGCACCCTCCTGGAACGGCCAGACTTGTCCCGTTGCGTC
CGCCACCTGCGTCTGGTCGGAGATGGCTTCGGCCATGAGGTCCGCGTGTGTGAGCCGCCGTCTTTCACCCTTGAT
TCGGCTTCCTTGGCTCGGGCTTCGGCCTTGATCTCCGCCATGGGCGTGTCATTTGCCGATATGTGGATCAGCGAG
CTGCAGTCTGGATCCATCGATGCCATCGTGGCAACTCTACTGGTGACGATGCCCAACTTGGAAACCCTCTATCTC
GATCCCAACTTTACGGTGAGGAGTCGCGTCTTAGGAAGCCTCTTTCAAAGCACCCTGGTCGAAACACCAGACAAT
CGTCATCACCACCAGCTTCCCTCGTTCCGAAACCTCCGCAACGTCACCTTTTCTCGTAGATTCAACGAGCACCTC
CAGCTCTATATAAACAACTCAGCCGATCTGCTTCCCCTGTTTTACCTCCCCAACCTCCAACACCTCTCCATCTCG
CTCGACAATCCCCTCTGCTTCGACTGGCCCGCCGAAGCACCCAAGGCTCCATCTCTCAAGTCACTCGAGGTATCT
AGGCTGCGGGAGGCGGCGCTCGCTTCCCTACTCGCTCCCCTCAGCCAACTTCAGCACCTGCGCTGGAATTGCTTC
TACCAGCCGGATTTAGACGAAGGCATCAGCACAAACGTCATTCAGCTTGATCTCATGATAAAGGCCTTCCACCAA
GTCCGCCATACGCTCACCGACCTGACCGTCACGGCAGAAACACGCCGCTCCATCATGGCCTTTTACGAGCCTCCT
CCCGTTCAAATCAGGGGGTCGCTCGACGGTTTGCTTCATCTTGGCGCCCTGAGACGTCTTTCTATGCCGTGGGTT
TTCCTCATGGGTTTCTCCGAGTCCTCGACGTGTCTACGGCTTCCGCTCCCTTCCAGTCTAGAGGAGCTGGTGTTG
ACGGACGACCTGGCGGATAAAGGGCAGTGGCAGTGGTATGACGACTCGATAGTCTCCGCCATCAAGTCCCAACTC
GAGTGCTGGGATCGACCGACGGACTCGAGTCTACGGCGTATCGTCCTGCCTATCCCGCTGCAAGGCGGTCAGATG
ACAGCCGGGAGGAGAGAACAGCTACGGGAGATTGGCAACGATGCTGGGCTGGAACTGTCATGGAGGGAATAG
Transcript >Ophun1|7602
ATGGCCATCCTCAACCAATCCCACGACATCCTTTTCTGCATCCTCGACCTCCTCCCTCCCCCCTCCCTCAACTCC
ACAAGCAAGCTCACCAAGCCCATCCGCTCCGTAACCGAAGCCCGTCTCTACAACTCCGTCACGGCCGCCTGGGCA
CCAGCATCCGTCCCGCCCCCGACAGCCCTCCTTCTCCGCACCCTCCTGGAACGGCCAGACTTGTCCCGTTGCGTC
CGCCACCTGCGTCTGGTCGGAGATGGCTTCGGCCATGAGGTCCGCGTGTGTGAGCCGCCGTCTTTCACCCTTGAT
TCGGCTTCCTTGGCTCGGGCTTCGGCCTTGATCTCCGCCATGGGCGTGTCATTTGCCGATATGTGGATCAGCGAG
CTGCAGTCTGGATCCATCGATGCCATCGTGGCAACTCTACTGGTGACGATGCCCAACTTGGAAACCCTCTATCTC
GATCCCAACTTTACGGTGAGGAGTCGCGTCTTAGGAAGCCTCTTTCAAAGCACCCTGGTCGAAACACCAGACAAT
CGTCATCACCACCAGCTTCCCTCGTTCCGAAACCTCCGCAACGTCACCTTTTCTCGTAGATTCAACGAGCACCTC
CAGCTCTATATAAACAACTCAGCCGATCTGCTTCCCCTGTTTTACCTCCCCAACCTCCAACACCTCTCCATCTCG
CTCGACAATCCCCTCTGCTTCGACTGGCCCGCCGAAGCACCCAAGGCTCCATCTCTCAAGTCACTCGAGGTATCT
AGGCTGCGGGAGGCGGCGCTCGCTTCCCTACTCGCTCCCCTCAGCCAACTTCAGCACCTGCGCTGGAATTGCTTC
TACCAGCCGGATTTAGACGAAGGCATCAGCACAAACGTCATTCAGCTTGATCTCATGATAAAGGCCTTCCACCAA
GTCCGCCATACGCTCACCGACCTGACCGTCACGGCAGAAACACGCCGCTCCATCATGGCCTTTTACGAGCCTCCT
CCCGTTCAAATCAGGGGGTCGCTCGACGGTTTGCTTCATCTTGGCGCCCTGAGACGTCTTTCTATGCCGTGGGTT
TTCCTCATGGGTTTCTCCGAGTCCTCGACGTGTCTACGGCTTCCGCTCCCTTCCAGTCTAGAGGAGCTGGTGTTG
ACGGACGACCTGGCGGATAAAGGGCAGTGGCAGTGGTATGACGACTCGATAGTCTCCGCCATCAAGTCCCAACTC
GAGTGCTGGGATCGACCGACGGACTCGAGTCTACGGCGTATCGTCCTGCCTATCCCGCTGCAAGGCGGTCAGATG
ACAGCCGGGAGGAGAGAACAGCTACGGGAGATTGGCAACGATGCTGGGCTGGAACTGTCATGGAGGGAATAG
Gene >Ophun1|7602
ATGGCCATCCTCAACCAATCCCACGACATCCTTTTCTGCATCCTCGACCTCCTCCCTCCCCCCTCCCTCAACTCC
ACAAGCAAGCTCACCAAGCCCATCCGCTCCGTAACCGAAGCCCGTCTCTACAACTCCGTCACGGCCGCCTGGGCA
CCAGCATCCGTCCCGCCCCCGACAGCCCTCCTTCTCCGCACCCTCCTGGAACGGCCAGACTTGTCCCGTTGCGTC
CGCCACCTGCGTCTGGTCGGAGATGGCTTCGGCCATGAGGTCCGCGTGTGTGAGCCGCCGTCTTTCACCCTTGAT
TCGGCTTCCTTGGCTCGGGCTTCGGCCTTGATCTCCGCCATGGGCGTGTCATTTGCCGATATGTGGATCAGCGAG
CTGCAGTCTGGATCCATCGATGCCATCGTGGCAACTCTACTGGTGACGATGCCCAACTTGGAAACCCTCTATCTC
GATCCCAACTTTACGGTGAGGAGTCGCGTCTTAGGAAGCCTCTTTCAAAGCACCCTGGTCGAAACACCAGACAAT
CGTCATCACCACCAGCTTCCCTCGTTCCGAAACCTCCGCAACGTCACCTTTTCTCGTAGATTCAACGAGCACCTC
CAGCTCTATATAAACAACTCAGCCGATCTGCTTCCCCTGTTTTACCTCCCCAACCTCCAACACCTCTCCATCTCG
CTCGACAATCCCCTCTGCTTCGACTGGCCCGCCGAAGCACCCAAGGCTCCATCTCTCAAGTCACTCGAGGTATCT
AGGCTGCGGGAGGCGGCGCTCGCTTCCCTACTCGCTCCCCTCAGCCAACTTCAGCACCTGCGCTGGAATTGCTTC
TACCAGCCGGATTTAGACGAAGGCATCAGCACAAACGTCATTCAGCTTGATCTCATGATAAAGGCCTTCCACCAA
GTCCGCCATACGCTCACCGACCTGACCGTCACGGCAGAAACACGCCGCTCCATCATGGCCTTTTACGAGCCTCCT
CCCGTTCAAATCAGGGGGTCGCTCGACGGTTTGCTTCATCTTGGCGCCCTGAGACGTCTTTCTATGCCGTGGGTT
TTCCTCATGGGTTTCTCCGAGTCCTCGACGTGTCTACGGCTTCCGCTCCCTTCCAGTCTAGAGGAGCTGGTGTTG
ACGGACGACCTGGCGGATAAAGGGCAGTGGCAGTGGTATGACGACTCGATAGTCTCCGCCATCAAGTCCCAACTC
GAGTGCTGGGATCGACCGACGGACTCGAGTCTACGGCGTATCGTCCTGCCTATCCCGCTGCAAGGCGGTCAGATG
ACAGCCGGGAGGAGAGAACAGCTACGGGAGATTGGCAACGATGCTGGGCTGGAACTGTCATGGAGGGAATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail