Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|76
Gene name
LocationContig_10:39606..45772
Strand+
Gene length (bp)6166
Transcript length (bp)5874
Coding sequence length (bp)5874
Protein length (aa) 1958

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12110 Nup96 Nuclear protein 96 6.9E-93 1489 1786
PF04096 Nucleoporin2 Nucleoporin autopeptidase 2.9E-47 897 1041
PF13634 Nucleoporin_FG Nucleoporin FG repeat region 1.2E+01 43 138
PF13634 Nucleoporin_FG Nucleoporin FG repeat region 4.5E+01 112 186
PF13634 Nucleoporin_FG Nucleoporin FG repeat region 1.6E-01 256 338
PF13634 Nucleoporin_FG Nucleoporin FG repeat region 1.2E-04 312 406
PF13634 Nucleoporin_FG Nucleoporin FG repeat region 3.6E-09 403 490
PF13634 Nucleoporin_FG Nucleoporin FG repeat region 2.2E-11 473 561
PF13634 Nucleoporin_FG Nucleoporin FG repeat region 1.9E-06 550 626

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|G0SAK3|NU145_CHATD Nucleoporin NUP145 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=NUP145 PE=1 SV=1 30 1910 0.0E+00
sp|Q9UTK4|NU189_SCHPO Nucleoporin nup189 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nup189 PE=1 SV=1 1389 1886 5.0E-62
sp|P52948|NUP98_HUMAN Nuclear pore complex protein Nup98-Nup96 OS=Homo sapiens GN=NUP98 PE=1 SV=4 1489 1953 2.0E-43
sp|P49793|NUP98_RAT Nuclear pore complex protein Nup98-Nup96 OS=Rattus norvegicus GN=Nup98 PE=1 SV=2 1489 1915 2.0E-40
sp|Q6PFD9|NUP98_MOUSE Nuclear pore complex protein Nup98-Nup96 OS=Mus musculus GN=Nup98 PE=1 SV=2 1489 1915 1.0E-38
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|G0SAK3|NU145_CHATD Nucleoporin NUP145 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=NUP145 PE=1 SV=1 30 1910 0.0E+00
sp|Q9UTK4|NU189_SCHPO Nucleoporin nup189 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nup189 PE=1 SV=1 1389 1886 5.0E-62
sp|P52948|NUP98_HUMAN Nuclear pore complex protein Nup98-Nup96 OS=Homo sapiens GN=NUP98 PE=1 SV=4 1489 1953 2.0E-43
sp|P49793|NUP98_RAT Nuclear pore complex protein Nup98-Nup96 OS=Rattus norvegicus GN=Nup98 PE=1 SV=2 1489 1915 2.0E-40
sp|Q6PFD9|NUP98_MOUSE Nuclear pore complex protein Nup98-Nup96 OS=Mus musculus GN=Nup98 PE=1 SV=2 1489 1915 1.0E-38
sp|Q9UTK4|NU189_SCHPO Nucleoporin nup189 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nup189 PE=1 SV=1 42 560 2.0E-34
sp|Q02630|NU116_YEAST Nucleoporin NUP116/NSP116 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUP116 PE=1 SV=2 97 654 3.0E-31
sp|Q9UTK4|NU189_SCHPO Nucleoporin nup189 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nup189 PE=1 SV=1 899 1050 4.0E-31
sp|Q54EQ8|NUP98_DICDI Nuclear pore complex protein Nup98-Nup96 OS=Dictyostelium discoideum GN=nup98 PE=3 SV=1 1424 1925 1.0E-30
sp|P52948|NUP98_HUMAN Nuclear pore complex protein Nup98-Nup96 OS=Homo sapiens GN=NUP98 PE=1 SV=4 20 534 5.0E-25
sp|P49793|NUP98_RAT Nuclear pore complex protein Nup98-Nup96 OS=Rattus norvegicus GN=Nup98 PE=1 SV=2 20 534 6.0E-25
sp|Q6PFD9|NUP98_MOUSE Nuclear pore complex protein Nup98-Nup96 OS=Mus musculus GN=Nup98 PE=1 SV=2 35 534 5.0E-24
sp|Q02630|NU116_YEAST Nucleoporin NUP116/NSP116 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUP116 PE=1 SV=2 855 1035 9.0E-22
sp|P52948|NUP98_HUMAN Nuclear pore complex protein Nup98-Nup96 OS=Homo sapiens GN=NUP98 PE=1 SV=4 70 562 3.0E-21
sp|P49687|NU145_YEAST Nucleoporin NUP145 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUP145 PE=1 SV=1 899 1063 9.0E-20
sp|G5EEH9|NUP98_CAEEL Nuclear pore complex protein Nup98-Nup96 OS=Caenorhabditis elegans GN=npp-10 PE=2 SV=1 79 496 2.0E-19
sp|Q02629|NU100_YEAST Nucleoporin NUP100/NSP100 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUP100 PE=1 SV=1 899 1035 3.0E-19
sp|P49687|NU145_YEAST Nucleoporin NUP145 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUP145 PE=1 SV=1 1435 1935 2.0E-18
sp|Q02629|NU100_YEAST Nucleoporin NUP100/NSP100 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUP100 PE=1 SV=1 265 684 6.0E-18
sp|G5EEH9|NUP98_CAEEL Nuclear pore complex protein Nup98-Nup96 OS=Caenorhabditis elegans GN=npp-10 PE=2 SV=1 886 1046 1.0E-17
sp|G5EEH9|NUP98_CAEEL Nuclear pore complex protein Nup98-Nup96 OS=Caenorhabditis elegans GN=npp-10 PE=2 SV=1 1500 1885 2.0E-16
sp|Q6PFD9|NUP98_MOUSE Nuclear pore complex protein Nup98-Nup96 OS=Mus musculus GN=Nup98 PE=1 SV=2 763 1083 5.0E-16
sp|Q54EQ8|NUP98_DICDI Nuclear pore complex protein Nup98-Nup96 OS=Dictyostelium discoideum GN=nup98 PE=3 SV=1 891 1053 5.0E-16
sp|P49793|NUP98_RAT Nuclear pore complex protein Nup98-Nup96 OS=Rattus norvegicus GN=Nup98 PE=1 SV=2 899 1083 8.0E-16
sp|P49793|NUP98_RAT Nuclear pore complex protein Nup98-Nup96 OS=Rattus norvegicus GN=Nup98 PE=1 SV=2 293 601 1.0E-15
sp|P52948|NUP98_HUMAN Nuclear pore complex protein Nup98-Nup96 OS=Homo sapiens GN=NUP98 PE=1 SV=4 899 1078 2.0E-15
sp|Q8LLD0|NUP96_ARATH Nuclear pore complex protein NUP96 OS=Arabidopsis thaliana GN=NUP96 PE=1 SV=1 1364 1861 2.0E-15
sp|P52948|NUP98_HUMAN Nuclear pore complex protein Nup98-Nup96 OS=Homo sapiens GN=NUP98 PE=1 SV=4 293 601 3.0E-15
sp|Q6PFD9|NUP98_MOUSE Nuclear pore complex protein Nup98-Nup96 OS=Mus musculus GN=Nup98 PE=1 SV=2 293 601 1.0E-14
sp|G5EEH9|NUP98_CAEEL Nuclear pore complex protein Nup98-Nup96 OS=Caenorhabditis elegans GN=npp-10 PE=2 SV=1 323 622 2.0E-13
sp|F4ID16|NU98B_ARATH Nuclear pore complex protein NUP98B OS=Arabidopsis thaliana GN=NUP98B PE=1 SV=1 898 1046 3.0E-13
sp|Q8RY25|NU98A_ARATH Nuclear pore complex protein NUP98A OS=Arabidopsis thaliana GN=NUP98A PE=1 SV=1 841 1054 8.0E-13
sp|Q02629|NU100_YEAST Nucleoporin NUP100/NSP100 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUP100 PE=1 SV=1 296 630 1.0E-12
sp|G5EEH9|NUP98_CAEEL Nuclear pore complex protein Nup98-Nup96 OS=Caenorhabditis elegans GN=npp-10 PE=2 SV=1 403 632 5.0E-12
sp|G5EEH9|NUP98_CAEEL Nuclear pore complex protein Nup98-Nup96 OS=Caenorhabditis elegans GN=npp-10 PE=2 SV=1 269 661 1.0E-11
sp|G0S4X2|NUP49_CHATD Nucleoporin NUP49 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=NUP49 PE=1 SV=1 313 515 1.0E-11
sp|Q02199|NUP49_YEAST Nucleoporin NUP49/NSP49 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUP49 PE=1 SV=1 279 527 1.0E-11
sp|Q54EQ8|NUP98_DICDI Nuclear pore complex protein Nup98-Nup96 OS=Dictyostelium discoideum GN=nup98 PE=3 SV=1 48 434 2.0E-11
sp|Q54EQ8|NUP98_DICDI Nuclear pore complex protein Nup98-Nup96 OS=Dictyostelium discoideum GN=nup98 PE=3 SV=1 258 605 4.0E-11
sp|G0S4X2|NUP49_CHATD Nucleoporin NUP49 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=NUP49 PE=1 SV=1 460 604 7.0E-10
sp|P49687|NU145_YEAST Nucleoporin NUP145 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUP145 PE=1 SV=1 375 638 1.0E-09
sp|P49687|NU145_YEAST Nucleoporin NUP145 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUP145 PE=1 SV=1 250 430 3.0E-09
sp|P48837|NUP57_YEAST Nucleoporin NUP57 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUP57 PE=1 SV=1 366 617 5.0E-09
sp|Q8LLD0|NUP96_ARATH Nuclear pore complex protein NUP96 OS=Arabidopsis thaliana GN=NUP96 PE=1 SV=1 918 1058 1.0E-08
sp|P52948|NUP98_HUMAN Nuclear pore complex protein Nup98-Nup96 OS=Homo sapiens GN=NUP98 PE=1 SV=4 240 689 4.0E-08
sp|Q09793|NUP45_SCHPO Nucleoporin nup45 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nup45 PE=1 SV=2 335 570 4.0E-07
sp|Q09793|NUP45_SCHPO Nucleoporin nup45 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nup45 PE=1 SV=2 248 474 2.0E-06
sp|Q80U93|NU214_MOUSE Nuclear pore complex protein Nup214 OS=Mus musculus GN=Nup214 PE=1 SV=2 24 169 2.0E-06
sp|G0SBQ3|NSP1_CHATD Nucleoporin NSP1 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=NSP1 PE=1 SV=1 360 600 2.0E-06
sp|Q9W1X4|NU214_DROME Nuclear pore complex protein Nup214 OS=Drosophila melanogaster GN=Nup214 PE=1 SV=2 58 173 4.0E-06
sp|Q02629|NU100_YEAST Nucleoporin NUP100/NSP100 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUP100 PE=1 SV=1 6 566 5.0E-06
sp|Q80U93|NU214_MOUSE Nuclear pore complex protein Nup214 OS=Mus musculus GN=Nup214 PE=1 SV=2 4 176 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005643 nuclear pore Yes
GO:0017056 structural constituent of nuclear pore Yes
GO:0006913 nucleocytoplasmic transport Yes
GO:0032991 protein-containing complex No
GO:0051179 localization No
GO:0008150 biological_process No
GO:0140513 nuclear protein-containing complex No
GO:0005198 structural molecule activity No
GO:0006810 transport No
GO:0005575 cellular_component No
GO:0009987 cellular process No
GO:0051641 cellular localization No
GO:0046907 intracellular transport No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0051649 establishment of localization in cell No
GO:0051169 nuclear transport No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1843
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1650
Ophiocordyceps australis map64 (Brazil) OphauB2|7039
Ophiocordyceps camponoti-floridani Ophcf2|01154
Ophiocordyceps camponoti-rufipedis Ophun1|76 (this protein)
Ophiocordyceps kimflemingae Ophio5|3081
Ophiocordyceps subramaniannii Hirsu2|1848

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|76
MSFGNSGFGGFGSNTNQATSGFGSGFGSNNNNSGTGFGSNAGGGFGQSANTGGGVFGNAAQSGFGSPSGGFGSNA
GGGFGSKPAFGSSNTAGGGGLFGASNANNTASNSGFGGFGSTNNANSSPFGGGGNTSGGGLFGNSANKTGFGAAA
NTGSSLFGAPNTSSGGGFGGSGFGAASNPAAAVGDPPGTGATPFTAFVEKEPNSTNQSNSFQNILFQDPYRKWSA
EELRLADYVQGRRHGNASGAGAFGVNSGFGGGFGSNNNQTTSAFGSASNAGGGLFGAGNASANNNAGGFGQAASG
AFGANSGNASGGLFGNSNKPSGGLFGNPTTQQSSGLFGSATGGGFGTNNNNNNNSAFGGNANAAGGLFGSNNQAN
KPQGTGFSFGNANANNTTSAFGGGNAGGAFGTANSGNSGLFGASNNQQSSGGLFGNAQQQQQQPNTNSPFGSGFG
AQNQSQNPQSLFGNAQQKPASGGLFGAANAATTPTNSLFGNVNNQQQGTSAFGTNNAAATGGLFGAPKPTATTSL
FGAPNANQANSSGTGLFGALGSNNQAQATTGSSLFGAANNTQQKPGGLFGTTNQASGSSLFGGTNNQVQGSSLFG
NGANQQQTQSSGFGGSLLGGTQQVGNAPQGLTANLNDVSAYGSPSLFAGLSGNEVSNPGPLATPLNSSSKPRRSS
ILPMYKLAPSTASRFATPQKRGFGFSYSSFGTPAASPAGSISSTPGGLGRSLLGPGGSGTLSKSMSTNNLRRSFT
AEDSILAPGAFSSSSNGHWYGSTGSKKLVINRDIRSDLFSTPQRDKQSADGAASARKLSKRVSFDTSNVEDENGT
PPRNALPAPEGTPSSQTEDSTPRQNRSLPAANGHKTPEMEHVKGNELAVVHEEDHTATPESQDTPSRDGAPGQYW
MNPAKEGLFNMNRMQRQRIVGFSVGRENVGHITFKLPVDISGINIDDICGTIVVLEPRSATVYPNQAKKPPVGRG
LNVPATIQLEQSWPRGGRQRRSSGDFKRFSRHVERLREIPDTTFESFDENTGTWVFSVEHFTTYGLNDDSDYESD
EDDGEDPIMTAPTARSRVVSESSVNPASGDESFSSSHSRDLPGAFDRPVEALDGNDAAKPSFFGNSSADLTSNNV
QLSLEEYDTNMDDGYDVSEDEDVARSSVGHHRAAEQEDFSPEADQEPKRATPGGILRARMRAMKDSIGPVRLEVP
DGDDWMSMLMKTVSPAKRDRQQLREQNESPSKRRCVGDPVGFDEDDEIFARSLIMDRSPSKAGQASAAMTQIALD
KGQGFATSIDLMNSLFDKSRFAKTPVASTPKKGLPEWPYERQDKSSVVGEAEQAYHNASRPTWGPGEALVVTRSL
ETAQSFRNGSNILAFQPSGIQTELQDVRLAKFSIMSSQKLLLAQQELTEIGLIDGVPMATLRTASLRNLFHHQDV
QSAANLHEKHVWELSSILFDRLGPSDASDGNEGSTRKTMLSKFWTDLVEQASTTSLGLASCSEERAMACVAGHRI
LDACKYLVEGKNFHLGTLLPLIGTSDEVKQEMREQLKAWHDSKMLSEFSDSIRAIYELLGGNACVCEGMKAVPIE
DRMESFVIAKKFGLDWRQSFGLRLWYAINERDDAAAAVKMFEEDLSQDKEEPPRPWFIDEGLLPQWNDAHAEDRQ
DLLWGLLRLYADEEVDLEAVLRPENSQLSPFNMRLCWQLGVALMSTGKVSFGKNGAEKADAATVAYATQLTTAGE
WLDAVFVLLHLSDAKARAKAIQEHLCRHAGLIGTESEVNFTKLVDKYRVPATWIWEAKALYMRSVEHDASGEVHC
LLRAGSFAEAHRVLVQQVAPRAIIERDYAALSALVDQMKEKRDSISGWALGGQVYSNFLGLMQHRERGESVAPAL
LEKIMGGLRAMSEVVGDAEIERYAAVSDMADETAREILKLSKKKQDTELRSRILGLPLTQDRLLAYSMDMAYSVD
MGFAVRA*
Coding >Ophun1|76
ATGTCGTTTGGGAACAGCGGCTTCGGGGGCTTCGGCTCAAACACCAACCAGGCGACGAGCGGCTTCGGGAGTGGC
TTCGGCTCAAACAACAATAACTCCGGTACGGGCTTCGGATCCAACGCTGGCGGCGGTTTTGGCCAGAGCGCGAAC
ACGGGAGGCGGCGTGTTTGGCAACGCCGCTCAATCTGGCTTTGGCTCTCCTTCAGGAGGCTTCGGCTCCAACGCC
GGTGGCGGCTTCGGAAGCAAGCCTGCTTTTGGCTCCAGCAACACTGCTGGCGGCGGCGGCTTGTTTGGAGCTTCC
AACGCCAATAACACCGCCAGCAACTCGGGCTTCGGCGGCTTTGGCAGTACCAACAATGCCAACTCGTCTCCCTTT
GGCGGCGGAGGAAACACATCTGGAGGGGGCCTCTTCGGGAACAGCGCCAACAAGACAGGCTTTGGTGCCGCAGCC
AATACCGGCTCGTCGCTCTTTGGCGCTCCCAATACCAGCTCCGGCGGAGGCTTTGGCGGCAGCGGATTTGGCGCT
GCGAGCAACCCCGCGGCTGCAGTTGGTGATCCTCCCGGCACGGGTGCGACTCCATTTACCGCCTTTGTCGAAAAG
GAGCCCAACAGTACCAACCAGTCGAATTCGTTCCAGAATATTCTCTTCCAGGATCCCTACAGGAAATGGTCTGCC
GAGGAGCTGCGACTGGCTGACTACGTCCAAGGACGGCGCCATGGCAATGCGAGCGGAGCGGGCGCGTTCGGCGTG
AATTCTGGCTTTGGGGGCGGCTTTGGCTCCAACAACAACCAGACGACGAGTGCATTTGGCTCGGCTTCAAACGCT
GGCGGCGGACTCTTTGGGGCCGGCAACGCCAGCGCCAACAACAATGCCGGTGGCTTCGGACAGGCTGCATCTGGA
GCTTTCGGTGCCAACAGTGGCAACGCCTCGGGCGGCCTGTTCGGCAATAGCAACAAGCCCAGTGGCGGCCTTTTT
GGGAATCCCACGACTCAGCAGAGCAGTGGCCTCTTCGGCTCGGCAACTGGAGGAGGGTTCGGCACGAACAACAAC
AACAACAACAACAGCGCCTTTGGTGGCAACGCCAATGCTGCAGGCGGACTCTTTGGGTCCAACAACCAGGCCAAC
AAGCCCCAAGGGACCGGCTTCAGCTTTGGAAACGCCAACGCCAATAACACCACGTCTGCGTTTGGCGGCGGCAAT
GCGGGAGGCGCTTTCGGCACGGCAAACTCTGGAAACTCCGGCCTCTTTGGGGCCTCCAACAATCAGCAGTCCAGC
GGCGGACTCTTTGGCAATGCCCAGCAGCAGCAACAGCAGCCGAATACCAATTCTCCCTTCGGTTCCGGTTTCGGC
GCACAGAACCAGAGCCAAAACCCGCAGAGTCTCTTTGGGAATGCCCAGCAGAAACCGGCATCGGGTGGCCTCTTC
GGCGCGGCCAATGCAGCCACCACTCCGACAAACAGTCTCTTCGGCAATGTCAACAATCAACAGCAAGGCACGAGT
GCCTTCGGTACGAACAACGCAGCGGCGACTGGCGGTCTTTTCGGTGCCCCTAAGCCCACCGCCACGACCAGTCTC
TTTGGCGCACCCAATGCGAACCAGGCCAACTCTTCCGGCACTGGATTGTTTGGGGCTTTGGGATCCAACAATCAG
GCTCAAGCGACGACTGGAAGCTCGCTGTTTGGAGCGGCGAACAACACGCAGCAGAAACCCGGCGGCCTGTTCGGT
ACGACCAACCAAGCGTCAGGCTCGAGTCTTTTCGGAGGAACAAACAACCAGGTCCAGGGCAGCTCGCTGTTTGGC
AACGGTGCAAACCAGCAGCAGACGCAGTCCTCGGGCTTCGGCGGCTCCTTGCTCGGAGGCACCCAGCAAGTGGGC
AACGCGCCCCAGGGGCTCACAGCAAACCTCAACGACGTCTCGGCCTACGGCAGCCCCTCGCTGTTTGCCGGCCTG
AGCGGCAACGAGGTCTCCAACCCCGGTCCTCTCGCCACGCCTCTAAATAGCAGCTCGAAGCCACGCCGGAGCTCT
ATCCTTCCCATGTACAAGCTGGCCCCGTCGACCGCCTCGCGATTTGCCACCCCTCAGAAGCGGGGGTTTGGTTTT
TCGTACAGCTCGTTCGGAACGCCGGCAGCGAGTCCTGCTGGCAGCATCTCCAGCACGCCAGGCGGTCTCGGCCGA
AGCCTGCTCGGCCCCGGAGGGAGTGGGACGCTTTCTAAGAGCATGTCGACCAACAACCTTCGCCGCAGCTTCACA
GCGGAAGACAGTATCCTCGCGCCGGGTGCTTTCTCGTCTAGCTCTAACGGTCATTGGTATGGGAGCACCGGATCG
AAGAAGCTCGTCATCAACAGGGACATCAGGAGCGATCTTTTTTCCACCCCCCAGCGAGACAAGCAGTCTGCGGAC
GGAGCCGCCAGCGCCCGCAAACTCTCGAAGCGTGTCAGCTTCGATACCAGCAACGTCGAAGACGAGAATGGGACG
CCGCCGCGCAACGCGCTTCCCGCTCCTGAGGGCACGCCAAGCTCTCAGACGGAGGACTCGACTCCTCGCCAGAAC
AGGAGCTTGCCTGCTGCCAACGGCCACAAAACTCCGGAGATGGAGCATGTCAAGGGCAACGAGCTGGCGGTCGTG
CACGAGGAGGACCACACCGCCACTCCGGAGTCGCAGGACACGCCCAGCCGCGATGGAGCCCCCGGACAGTACTGG
ATGAATCCGGCCAAGGAAGGGTTGTTCAACATGAACAGGATGCAGCGGCAAAGGATCGTTGGCTTCTCTGTCGGC
CGTGAAAACGTCGGTCACATCACGTTCAAGTTGCCCGTGGACATAAGCGGCATCAACATCGACGACATCTGCGGC
ACCATCGTCGTGCTCGAGCCTCGATCCGCGACTGTGTACCCTAACCAAGCCAAGAAGCCGCCTGTCGGCCGGGGA
CTCAATGTGCCAGCCACGATCCAGCTGGAACAGTCCTGGCCGCGTGGAGGCCGTCAGAGGCGCTCGTCGGGCGAT
TTCAAGCGATTCAGCAGACATGTGGAGCGACTTCGCGAGATTCCCGACACTACTTTTGAGAGTTTCGACGAGAAC
ACCGGCACATGGGTCTTTTCCGTGGAACACTTTACGACTTATGGTTTAAATGATGATTCGGATTATGAGTCGGAC
GAGGATGATGGAGAAGATCCAATCATGACAGCACCCACGGCTCGCTCTCGCGTTGTGTCTGAATCTTCGGTCAAT
CCGGCCTCGGGAGACGAGTCGTTCAGCTCCTCTCACAGCAGGGACCTCCCGGGTGCTTTCGATCGACCGGTGGAA
GCTCTCGACGGAAACGACGCCGCGAAGCCGTCTTTTTTTGGGAATAGCTCCGCGGATCTGACGTCCAACAACGTG
CAATTGTCTCTGGAAGAGTACGACACCAACATGGACGACGGATATGACGTGTCCGAGGATGAAGACGTGGCGAGA
TCTTCTGTCGGACACCATCGCGCCGCGGAGCAGGAAGACTTCTCGCCGGAAGCCGACCAGGAGCCCAAGAGGGCA
ACGCCCGGCGGCATCCTCAGAGCCAGGATGCGGGCCATGAAAGACTCCATCGGTCCAGTGCGGCTCGAGGTTCCT
GATGGCGACGACTGGATGAGCATGCTCATGAAGACGGTCAGTCCCGCCAAGCGAGACCGGCAGCAGCTCCGAGAG
CAAAACGAGAGCCCTTCCAAGCGTCGATGCGTGGGTGACCCCGTCGGCTTCGATGAAGATGACGAAATTTTTGCA
AGGTCCTTGATCATGGATCGAAGCCCCAGCAAGGCGGGCCAGGCGTCAGCTGCGATGACTCAAATTGCATTGGAT
AAGGGCCAGGGATTCGCCACCAGCATCGACTTGATGAATTCTTTGTTCGACAAGTCGAGGTTCGCAAAGACTCCG
GTCGCTTCGACGCCGAAAAAGGGGCTTCCAGAGTGGCCCTATGAGCGCCAAGACAAGAGTTCGGTCGTTGGCGAA
GCTGAGCAAGCGTATCACAACGCGTCGCGTCCAACTTGGGGTCCTGGGGAAGCATTGGTGGTGACGCGGTCGTTG
GAAACTGCGCAATCGTTTCGCAACGGCTCTAACATTCTAGCTTTCCAGCCTTCGGGCATCCAAACGGAGCTGCAA
GATGTCAGGCTTGCCAAGTTCTCCATCATGTCGTCGCAGAAGCTTCTGCTTGCCCAGCAAGAGTTGACTGAGATT
GGCCTCATCGACGGCGTTCCCATGGCTACGCTTCGTACGGCGAGCCTGCGGAACCTCTTTCACCATCAGGACGTG
CAGAGCGCTGCCAACTTGCACGAGAAGCATGTCTGGGAGCTCTCAAGCATCCTCTTTGATCGACTGGGCCCTTCG
GACGCGTCCGACGGAAACGAAGGTTCTACAAGAAAGACGATGTTGTCCAAGTTCTGGACCGACCTGGTGGAGCAG
GCGTCGACGACCAGCCTCGGCCTCGCAAGTTGCAGCGAAGAAAGGGCCATGGCGTGCGTGGCAGGACATCGGATC
TTGGACGCCTGCAAGTACCTTGTGGAAGGCAAAAACTTTCACCTCGGCACCCTCTTGCCGCTGATCGGCACCAGC
GACGAGGTCAAACAGGAGATGAGAGAGCAACTCAAGGCGTGGCACGACTCCAAGATGCTGTCCGAGTTCTCGGAC
TCGATTCGGGCCATTTACGAGCTCCTGGGAGGCAACGCCTGTGTCTGCGAAGGCATGAAGGCCGTCCCGATCGAG
GACCGGATGGAATCGTTTGTCATTGCGAAGAAGTTTGGACTTGACTGGCGGCAGTCGTTTGGTTTAAGGTTGTGG
TACGCCATCAACGAGCGCGACGATGCGGCTGCTGCAGTAAAGATGTTTGAGGAGGACTTGAGCCAGGACAAGGAG
GAACCACCACGACCGTGGTTCATCGACGAGGGTCTCTTGCCGCAATGGAACGACGCACACGCTGAAGATCGCCAG
GATCTTCTGTGGGGGCTGCTGCGTCTGTACGCGGACGAGGAGGTCGACCTGGAGGCCGTGCTTCGACCGGAGAAC
TCGCAATTGTCTCCCTTCAACATGCGGCTCTGTTGGCAGCTGGGCGTGGCCTTGATGTCGACCGGCAAGGTGTCA
TTCGGCAAAAATGGAGCGGAGAAGGCGGACGCGGCGACGGTGGCGTACGCGACGCAGCTGACGACAGCCGGCGAG
TGGCTTGATGCCGTCTTTGTTTTGTTGCACCTGAGCGACGCAAAGGCTCGAGCCAAGGCGATACAGGAGCATCTC
TGTCGACACGCAGGCCTGATTGGAACCGAGTCCGAGGTCAACTTTACGAAACTGGTCGACAAGTATCGCGTCCCT
GCGACGTGGATTTGGGAGGCGAAGGCCTTGTATATGCGCAGCGTGGAGCACGACGCGTCGGGCGAGGTGCACTGT
CTGCTGCGAGCCGGTTCGTTTGCAGAGGCCCATCGGGTGCTGGTCCAGCAAGTGGCGCCGCGGGCCATTATCGAG
CGCGATTACGCCGCTCTGTCGGCCCTGGTGGATCAGATGAAGGAGAAGCGGGACTCGATTTCCGGATGGGCGTTG
GGCGGGCAGGTCTACAGCAACTTCCTCGGCCTGATGCAGCATCGCGAAAGGGGCGAGAGCGTCGCGCCGGCGCTT
CTGGAGAAGATCATGGGTGGCCTTAGGGCGATGAGCGAGGTCGTGGGCGATGCCGAGATTGAGCGGTATGCGGCC
GTGTCGGACATGGCAGACGAGACGGCGCGGGAGATATTGAAACTGAGCAAGAAGAAGCAGGACACAGAGCTTCGG
TCTCGGATTCTGGGCCTCCCTCTGACGCAGGATCGGCTGCTTGCCTACTCGATGGACATGGCCTATTCGGTAGAC
ATGGGCTTTGCTGTCCGTGCCTAG
Transcript >Ophun1|76
ATGTCGTTTGGGAACAGCGGCTTCGGGGGCTTCGGCTCAAACACCAACCAGGCGACGAGCGGCTTCGGGAGTGGC
TTCGGCTCAAACAACAATAACTCCGGTACGGGCTTCGGATCCAACGCTGGCGGCGGTTTTGGCCAGAGCGCGAAC
ACGGGAGGCGGCGTGTTTGGCAACGCCGCTCAATCTGGCTTTGGCTCTCCTTCAGGAGGCTTCGGCTCCAACGCC
GGTGGCGGCTTCGGAAGCAAGCCTGCTTTTGGCTCCAGCAACACTGCTGGCGGCGGCGGCTTGTTTGGAGCTTCC
AACGCCAATAACACCGCCAGCAACTCGGGCTTCGGCGGCTTTGGCAGTACCAACAATGCCAACTCGTCTCCCTTT
GGCGGCGGAGGAAACACATCTGGAGGGGGCCTCTTCGGGAACAGCGCCAACAAGACAGGCTTTGGTGCCGCAGCC
AATACCGGCTCGTCGCTCTTTGGCGCTCCCAATACCAGCTCCGGCGGAGGCTTTGGCGGCAGCGGATTTGGCGCT
GCGAGCAACCCCGCGGCTGCAGTTGGTGATCCTCCCGGCACGGGTGCGACTCCATTTACCGCCTTTGTCGAAAAG
GAGCCCAACAGTACCAACCAGTCGAATTCGTTCCAGAATATTCTCTTCCAGGATCCCTACAGGAAATGGTCTGCC
GAGGAGCTGCGACTGGCTGACTACGTCCAAGGACGGCGCCATGGCAATGCGAGCGGAGCGGGCGCGTTCGGCGTG
AATTCTGGCTTTGGGGGCGGCTTTGGCTCCAACAACAACCAGACGACGAGTGCATTTGGCTCGGCTTCAAACGCT
GGCGGCGGACTCTTTGGGGCCGGCAACGCCAGCGCCAACAACAATGCCGGTGGCTTCGGACAGGCTGCATCTGGA
GCTTTCGGTGCCAACAGTGGCAACGCCTCGGGCGGCCTGTTCGGCAATAGCAACAAGCCCAGTGGCGGCCTTTTT
GGGAATCCCACGACTCAGCAGAGCAGTGGCCTCTTCGGCTCGGCAACTGGAGGAGGGTTCGGCACGAACAACAAC
AACAACAACAACAGCGCCTTTGGTGGCAACGCCAATGCTGCAGGCGGACTCTTTGGGTCCAACAACCAGGCCAAC
AAGCCCCAAGGGACCGGCTTCAGCTTTGGAAACGCCAACGCCAATAACACCACGTCTGCGTTTGGCGGCGGCAAT
GCGGGAGGCGCTTTCGGCACGGCAAACTCTGGAAACTCCGGCCTCTTTGGGGCCTCCAACAATCAGCAGTCCAGC
GGCGGACTCTTTGGCAATGCCCAGCAGCAGCAACAGCAGCCGAATACCAATTCTCCCTTCGGTTCCGGTTTCGGC
GCACAGAACCAGAGCCAAAACCCGCAGAGTCTCTTTGGGAATGCCCAGCAGAAACCGGCATCGGGTGGCCTCTTC
GGCGCGGCCAATGCAGCCACCACTCCGACAAACAGTCTCTTCGGCAATGTCAACAATCAACAGCAAGGCACGAGT
GCCTTCGGTACGAACAACGCAGCGGCGACTGGCGGTCTTTTCGGTGCCCCTAAGCCCACCGCCACGACCAGTCTC
TTTGGCGCACCCAATGCGAACCAGGCCAACTCTTCCGGCACTGGATTGTTTGGGGCTTTGGGATCCAACAATCAG
GCTCAAGCGACGACTGGAAGCTCGCTGTTTGGAGCGGCGAACAACACGCAGCAGAAACCCGGCGGCCTGTTCGGT
ACGACCAACCAAGCGTCAGGCTCGAGTCTTTTCGGAGGAACAAACAACCAGGTCCAGGGCAGCTCGCTGTTTGGC
AACGGTGCAAACCAGCAGCAGACGCAGTCCTCGGGCTTCGGCGGCTCCTTGCTCGGAGGCACCCAGCAAGTGGGC
AACGCGCCCCAGGGGCTCACAGCAAACCTCAACGACGTCTCGGCCTACGGCAGCCCCTCGCTGTTTGCCGGCCTG
AGCGGCAACGAGGTCTCCAACCCCGGTCCTCTCGCCACGCCTCTAAATAGCAGCTCGAAGCCACGCCGGAGCTCT
ATCCTTCCCATGTACAAGCTGGCCCCGTCGACCGCCTCGCGATTTGCCACCCCTCAGAAGCGGGGGTTTGGTTTT
TCGTACAGCTCGTTCGGAACGCCGGCAGCGAGTCCTGCTGGCAGCATCTCCAGCACGCCAGGCGGTCTCGGCCGA
AGCCTGCTCGGCCCCGGAGGGAGTGGGACGCTTTCTAAGAGCATGTCGACCAACAACCTTCGCCGCAGCTTCACA
GCGGAAGACAGTATCCTCGCGCCGGGTGCTTTCTCGTCTAGCTCTAACGGTCATTGGTATGGGAGCACCGGATCG
AAGAAGCTCGTCATCAACAGGGACATCAGGAGCGATCTTTTTTCCACCCCCCAGCGAGACAAGCAGTCTGCGGAC
GGAGCCGCCAGCGCCCGCAAACTCTCGAAGCGTGTCAGCTTCGATACCAGCAACGTCGAAGACGAGAATGGGACG
CCGCCGCGCAACGCGCTTCCCGCTCCTGAGGGCACGCCAAGCTCTCAGACGGAGGACTCGACTCCTCGCCAGAAC
AGGAGCTTGCCTGCTGCCAACGGCCACAAAACTCCGGAGATGGAGCATGTCAAGGGCAACGAGCTGGCGGTCGTG
CACGAGGAGGACCACACCGCCACTCCGGAGTCGCAGGACACGCCCAGCCGCGATGGAGCCCCCGGACAGTACTGG
ATGAATCCGGCCAAGGAAGGGTTGTTCAACATGAACAGGATGCAGCGGCAAAGGATCGTTGGCTTCTCTGTCGGC
CGTGAAAACGTCGGTCACATCACGTTCAAGTTGCCCGTGGACATAAGCGGCATCAACATCGACGACATCTGCGGC
ACCATCGTCGTGCTCGAGCCTCGATCCGCGACTGTGTACCCTAACCAAGCCAAGAAGCCGCCTGTCGGCCGGGGA
CTCAATGTGCCAGCCACGATCCAGCTGGAACAGTCCTGGCCGCGTGGAGGCCGTCAGAGGCGCTCGTCGGGCGAT
TTCAAGCGATTCAGCAGACATGTGGAGCGACTTCGCGAGATTCCCGACACTACTTTTGAGAGTTTCGACGAGAAC
ACCGGCACATGGGTCTTTTCCGTGGAACACTTTACGACTTATGGTTTAAATGATGATTCGGATTATGAGTCGGAC
GAGGATGATGGAGAAGATCCAATCATGACAGCACCCACGGCTCGCTCTCGCGTTGTGTCTGAATCTTCGGTCAAT
CCGGCCTCGGGAGACGAGTCGTTCAGCTCCTCTCACAGCAGGGACCTCCCGGGTGCTTTCGATCGACCGGTGGAA
GCTCTCGACGGAAACGACGCCGCGAAGCCGTCTTTTTTTGGGAATAGCTCCGCGGATCTGACGTCCAACAACGTG
CAATTGTCTCTGGAAGAGTACGACACCAACATGGACGACGGATATGACGTGTCCGAGGATGAAGACGTGGCGAGA
TCTTCTGTCGGACACCATCGCGCCGCGGAGCAGGAAGACTTCTCGCCGGAAGCCGACCAGGAGCCCAAGAGGGCA
ACGCCCGGCGGCATCCTCAGAGCCAGGATGCGGGCCATGAAAGACTCCATCGGTCCAGTGCGGCTCGAGGTTCCT
GATGGCGACGACTGGATGAGCATGCTCATGAAGACGGTCAGTCCCGCCAAGCGAGACCGGCAGCAGCTCCGAGAG
CAAAACGAGAGCCCTTCCAAGCGTCGATGCGTGGGTGACCCCGTCGGCTTCGATGAAGATGACGAAATTTTTGCA
AGGTCCTTGATCATGGATCGAAGCCCCAGCAAGGCGGGCCAGGCGTCAGCTGCGATGACTCAAATTGCATTGGAT
AAGGGCCAGGGATTCGCCACCAGCATCGACTTGATGAATTCTTTGTTCGACAAGTCGAGGTTCGCAAAGACTCCG
GTCGCTTCGACGCCGAAAAAGGGGCTTCCAGAGTGGCCCTATGAGCGCCAAGACAAGAGTTCGGTCGTTGGCGAA
GCTGAGCAAGCGTATCACAACGCGTCGCGTCCAACTTGGGGTCCTGGGGAAGCATTGGTGGTGACGCGGTCGTTG
GAAACTGCGCAATCGTTTCGCAACGGCTCTAACATTCTAGCTTTCCAGCCTTCGGGCATCCAAACGGAGCTGCAA
GATGTCAGGCTTGCCAAGTTCTCCATCATGTCGTCGCAGAAGCTTCTGCTTGCCCAGCAAGAGTTGACTGAGATT
GGCCTCATCGACGGCGTTCCCATGGCTACGCTTCGTACGGCGAGCCTGCGGAACCTCTTTCACCATCAGGACGTG
CAGAGCGCTGCCAACTTGCACGAGAAGCATGTCTGGGAGCTCTCAAGCATCCTCTTTGATCGACTGGGCCCTTCG
GACGCGTCCGACGGAAACGAAGGTTCTACAAGAAAGACGATGTTGTCCAAGTTCTGGACCGACCTGGTGGAGCAG
GCGTCGACGACCAGCCTCGGCCTCGCAAGTTGCAGCGAAGAAAGGGCCATGGCGTGCGTGGCAGGACATCGGATC
TTGGACGCCTGCAAGTACCTTGTGGAAGGCAAAAACTTTCACCTCGGCACCCTCTTGCCGCTGATCGGCACCAGC
GACGAGGTCAAACAGGAGATGAGAGAGCAACTCAAGGCGTGGCACGACTCCAAGATGCTGTCCGAGTTCTCGGAC
TCGATTCGGGCCATTTACGAGCTCCTGGGAGGCAACGCCTGTGTCTGCGAAGGCATGAAGGCCGTCCCGATCGAG
GACCGGATGGAATCGTTTGTCATTGCGAAGAAGTTTGGACTTGACTGGCGGCAGTCGTTTGGTTTAAGGTTGTGG
TACGCCATCAACGAGCGCGACGATGCGGCTGCTGCAGTAAAGATGTTTGAGGAGGACTTGAGCCAGGACAAGGAG
GAACCACCACGACCGTGGTTCATCGACGAGGGTCTCTTGCCGCAATGGAACGACGCACACGCTGAAGATCGCCAG
GATCTTCTGTGGGGGCTGCTGCGTCTGTACGCGGACGAGGAGGTCGACCTGGAGGCCGTGCTTCGACCGGAGAAC
TCGCAATTGTCTCCCTTCAACATGCGGCTCTGTTGGCAGCTGGGCGTGGCCTTGATGTCGACCGGCAAGGTGTCA
TTCGGCAAAAATGGAGCGGAGAAGGCGGACGCGGCGACGGTGGCGTACGCGACGCAGCTGACGACAGCCGGCGAG
TGGCTTGATGCCGTCTTTGTTTTGTTGCACCTGAGCGACGCAAAGGCTCGAGCCAAGGCGATACAGGAGCATCTC
TGTCGACACGCAGGCCTGATTGGAACCGAGTCCGAGGTCAACTTTACGAAACTGGTCGACAAGTATCGCGTCCCT
GCGACGTGGATTTGGGAGGCGAAGGCCTTGTATATGCGCAGCGTGGAGCACGACGCGTCGGGCGAGGTGCACTGT
CTGCTGCGAGCCGGTTCGTTTGCAGAGGCCCATCGGGTGCTGGTCCAGCAAGTGGCGCCGCGGGCCATTATCGAG
CGCGATTACGCCGCTCTGTCGGCCCTGGTGGATCAGATGAAGGAGAAGCGGGACTCGATTTCCGGATGGGCGTTG
GGCGGGCAGGTCTACAGCAACTTCCTCGGCCTGATGCAGCATCGCGAAAGGGGCGAGAGCGTCGCGCCGGCGCTT
CTGGAGAAGATCATGGGTGGCCTTAGGGCGATGAGCGAGGTCGTGGGCGATGCCGAGATTGAGCGGTATGCGGCC
GTGTCGGACATGGCAGACGAGACGGCGCGGGAGATATTGAAACTGAGCAAGAAGAAGCAGGACACAGAGCTTCGG
TCTCGGATTCTGGGCCTCCCTCTGACGCAGGATCGGCTGCTTGCCTACTCGATGGACATGGCCTATTCGGTAGAC
ATGGGCTTTGCTGTCCGTGCCTAG
Gene >Ophun1|76
ATGTCGTTTGGGAACAGCGGCTTCGGGGGCTTCGGCTCAAACACCAACCAGGCGACGAGCGGCTTCGGGAGTGGC
TTCGGCTCAAACAACAATAACTCCGGTACGGGTACGGTTCCCCGGGCTCAAATCACCCTCCCTATTCTGACACCG
ACTCTTTCAGGCTTCGGATCCAACGCTGGCGGCGGTTTTGGCCAGAGCGCGAACACGGGAGGCGGCGTGTTTGGC
AACGCCGCTCAATCTGGCTTTGGCTCTCCTTCAGGTAAGGCTTCTCGTCCTTCGTCTCCCTGCTTTATCACCGCC
TGCATTTGCAAATCGCTAACCCCTTTCCCTCAGGAGGCTTCGGCTCCAACGCCGGTGGCGGCTTCGGAAGCAAGC
CTGCTTTTGGCTCCAGCAACACTGCTGGCGGCGGCGGCTTGTTTGGAGCTTCCAACGCCAATAACACCGCCAGCA
ACTCGGGCTTCGGCGGCTTTGGCAGTACCAACAATGCCAACTCGTCTCCCTTTGGCGGCGGAGGAAACACATCTG
GAGGGGGCCTCTTCGGGAACAGCGCCAACAAGACAGGCTTTGGTGCCGCAGCCAATACCGGCTCGTCGCTCTTTG
GCGCTCCCAATACCAGCTCCGGCGGAGGCTTTGGCGGCAGCGGATTTGGCGCTGCGAGCAACCCCGCGGCTGCAG
TTGGTGATCCTCCCGGCACGGGTGCGACTCCATTTACCGCCTTTGTCGAAAAGGAGCCCAACAGTACCAACCAGT
CGAATTCGTTCCAGAATATTCTCTTCCAGGATCCCTACAGGAAATGGTCTGCCGAGGAGCTGCGACTGGCTGACT
ACGTCCAAGGACGGCGCCATGGCAATGCGAGCGGAGCGGGCGCGTTCGGCGTGAATTCTGGCTTTGGGGGCGGCT
TTGGCTCCAACAACAACCAGACGACGAGTGCATTTGGCTCGGCTTCAAACGCTGGCGGCGGACTCTTTGGGGCCG
GCAACGCCAGCGCCAACAACAATGCCGGTGGCTTCGGACAGGCTGCATCTGGAGCTTTCGGTGCCAACAGTGGCA
ACGCCTCGGGCGGCCTGTTCGGCAATAGCAACAAGCCCAGTGGCGGCCTTTTTGGGAATCCCACGACTCAGCAGA
GCAGTGGCCTCTTCGGCTCGGCAACTGGAGGAGGGTTCGGCACGAACAACAACAACAACAACAACAGCGCCTTTG
GTGGCAACGCCAATGCTGCAGGCGGACTCTTTGGGTCCAACAACCAGGCCAACAAGCCCCAAGGGACCGGCTTCA
GCTTTGGAAACGCCAACGCCAATAACACCACGTCTGCGTTTGGCGGCGGCAATGCGGGAGGCGCTTTCGGCACGG
CAAACTCTGGAAACTCCGGCCTCTTTGGGGCCTCCAACAATCAGCAGTCCAGCGGCGGACTCTTTGGCAATGCCC
AGCAGCAGCAACAGCAGCCGAATACCAATTCTCCCTTCGGTTCCGGTTTCGGCGCACAGAACCAGAGCCAAAACC
CGCAGAGTCTCTTTGGGAATGCCCAGCAGAAACCGGCATCGGGTGGCCTCTTCGGCGCGGCCAATGCAGCCACCA
CTCCGACAAACAGTCTCTTCGGCAATGTCAACAATCAACAGCAAGGCACGAGTGCCTTCGGTACGAACAACGCAG
CGGCGACTGGCGGTCTTTTCGGTGCCCCTAAGCCCACCGCCACGACCAGTCTCTTTGGCGCACCCAATGCGAACC
AGGCCAACTCTTCCGGCACTGGATTGTTTGGGGCTTTGGGATCCAACAATCAGGCTCAAGCGACGACTGGAAGCT
CGCTGTTTGGAGCGGCGAACAACACGCAGCAGAAACCCGGCGGCCTGTTCGGTACGACCAACCAAGCGTCAGGCT
CGAGTCTTTTCGGAGGAACAAACAACCAGGTCCAGGGCAGCTCGCTGTTTGGCAACGGTGCAAACCAGCAGCAGA
CGCAGTCCTCGGGCTTCGGCGGCTCCTTGCTCGGAGGCACCCAGCAAGTGGGCAACGCGCCCCAGGGGCTCACAG
CAAACCTCAACGACGTCTCGGCCTACGGCAGCCCCTCGCTGTTTGCCGGCCTGAGCGGCAACGAGGTCTCCAACC
CCGGTCCTCTCGCCACGCCTCTAAATAGCAGCTCGAAGCCACGCCGGAGCTCTATCCTTCCCATGTACAAGCTGG
CCCCGTCGACCGCCTCGCGATTTGCCACCCCTCAGAAGCGGGGGTTTGGTTTTTCGTACAGCTCGTTCGGAACGC
CGGCAGCGAGTCCTGCTGGCAGCATCTCCAGCACGCCAGGCGGTCTCGGCCGAAGCCTGCTCGGCCCCGGAGGGA
GTGGGACGCTTTCTAAGAGCATGTCGACCAACAACCTTCGCCGCAGCTTCACAGCGGAAGACAGTATCCTCGCGC
CGGGTGCTTTCTCGTCTAGCTCTAACGGTCATTGGTATGGGAGCACCGGATCGAAGAAGCTCGTCATCAACAGGG
ACATCAGGAGCGATCTTTTTTCCACCCCCCAGCGAGACAAGCAGTCTGCGGACGGAGCCGCCAGCGCCCGCAAAC
TCTCGAAGCGTGTCAGCTTCGATACCAGCAACGTCGAAGACGAGAATGGGACGCCGCCGCGCAACGCGCTTCCCG
CTCCTGAGGGCACGCCAAGCTCTCAGACGGAGGACTCGACTCCTCGCCAGAACAGGAGCTTGCCTGCTGCCAACG
GCCACAAAACTCCGGAGATGGAGCATGTCAAGGGCAACGAGCTGGCGGTCGTGCACGAGGAGGACCACACCGCCA
CTCCGGAGTCGCAGGACACGCCCAGCCGCGATGGAGCCCCCGGACAGTACTGGATGAATCCGGCCAAGGAAGGGT
TGTTCAACATGAACAGGATGCAGCGGCAAAGGATCGTTGGCTTCTCTGTCGGCCGTGAAAACGTCGGTCACATCA
CGTTCAAGTTGCCCGTGGACATAAGCGGCATCAACATCGACGACATCTGCGGCACCATCGTCGTGCTCGAGCCTC
GATCCGCGACTGTGTACCCTAACCAAGCCAAGAAGCCGCCTGTCGGCCGGGGACTCAATGTGCCAGCCACGATCC
AGCTGGAACAGTCCTGGCCGCGTGGAGGCCGTCAGAGGCGCTCGTCGGGCGATTTCAAGCGATTCAGCAGACATG
TGGAGCGACTTCGCGAGATTCCCGACACTACTTTTGAGAGTTTCGACGAGAACACCGGCACATGGGTCTTTTCCG
TGGAACACTTTACGACTTATGGTTTAAATGATGATTCGGATTATGAGTCGGACGAGGATGATGGAGAAGATCCAA
TCATGACAGCACCCACGGCTCGCTCTCGCGTTGTGTCTGAATCTTCGGTCAATCCGGCCTCGGGAGACGAGTCGT
TCAGCTCCTCTCACAGCAGGGACCTCCCGGGTGCTTTCGATCGACCGGTGGAAGCTCTCGACGGAAACGACGCCG
CGAAGCCGTCTTTTTTTGGGAATAGCTCCGCGGATCTGACGTCCAACAACGTGCAATTGTCTCTGGAAGAGTACG
ACACCAACATGGACGACGGATATGACGTGTCCGAGGATGAAGACGTGGCGAGATCTTCTGTCGGACACCATCGCG
CCGCGGAGCAGGAAGACTTCTCGCCGGAAGCCGACCAGGAGCCCAAGAGGGCAACGCCCGGCGGCATCCTCAGAG
CCAGGATGCGGGCCATGAAAGACTCCATCGGTCCAGTGCGGCTCGAGGTTCCTGATGGCGACGACTGGATGAGCA
TGCTCATGAAGACGGTCAGTCCCGCCAAGCGAGACCGGCAGCAGCTCCGAGAGCAAAACGAGAGCCCTTCCAAGC
GTCGATGCGTGGGTGACCCCGTCGGCTTCGATGAAGATGACGAAATTTTTGCAAGGTCCTTGATCATGGATCGAA
GCCCCAGCAAGGCGGGCCAGGCGTCAGCTGCGATGACTCAAATTGCATTGGATAAGGGCCAGGGATTCGCCACCA
GCATCGACTTGATGAATTCTTTGTTCGACAAGTCGAGGTTCGCAAAGACTCCGGTCGCTTCGACGCCGAAAAAGG
GGCTTCCAGAGGTAAATCGATCAGTTGGCGGCAAAGGACGCGGACTGGCTGCTGACATGGTCTCTCAGTGGCCCT
ATGAGCGCCAAGACAAGAGTTCGGTCGTTGGCGAAGCTGAGCAAGCGTATCACAACGCGTCGCGTCCAACTTGGG
GTCCTGGGGAAGCATTGGTGGTGACGCGGTCGTTGGAAACTGCGCAATCGTTTCGCAACGGCTCTAACATTCTAG
CTTTCCAGCCTTCGGGCATCCAAACGGAGCTGCAAGATGTCAGGCTTGCCAAGTTCTCCATCATGGTATGGCAGC
CCCAGAAGTCGTTCTGCCATTCATTTGCTAACGTTTTTCTCAGTCGTCGCAGAAGCTTCTGCTTGCCCAGCAAGA
GTTGACTGAGATTGGCCTCATCGACGGCGTTCCCATGGCTACGCTTCGTACGGCGAGCCTGCGGAACCTCTTTCA
CCATCAGGACGTGCAGAGCGCTGCCAACTTGCACGAGAAGCATGTCTGGGAGCTCTCAAGCATCCTCTTTGATCG
ACTGGGCCCTTCGGACGCGTCCGACGGAAACGAAGGTTCTACAAGAAAGACGATGTTGTCCAAGTTCTGGACCGA
CCTGGTGGAGCAGGCGTCGACGACCAGCCTCGGCCTCGCAAGTTGCAGCGAAGAAAGGGCCATGGCGTGCGTGGC
AGGACATCGGATCTTGGACGCCTGCAAGTACCTTGTGGAAGGCAAAAACTTTCACCTCGGCACCCTCTTGCCGCT
GATCGGCACCAGCGACGAGGTCAAACAGGAGATGAGAGAGCAACTCAAGGCGTGGCACGACTCCAAGATGCTGTC
CGAGTTCTCGGACTCGATTCGGGCCATTTACGAGCTCCTGGGAGGCAACGCCTGTGTCTGCGAAGGCATGAAGGC
CGTCCCGATCGAGGACCGGATGGAATCGTTTGTCATTGCGAAGAAGTTTGGACTTGACTGGCGGCAGTCGTTTGG
TTTAAGGTTGTGGTACGCCATCAACGAGCGCGACGATGCGGCTGCTGCAGTAAAGATGTTTGAGGAGGACTTGAG
CCAGGACAAGGAGGAACCACCACGACCGTGGTTCATCGACGAGGGTCTCTTGCCGCAATGGAACGACGCACACGC
TGAAGATCGCCAGGATCTTCTGTGGGGGCTGCTGCGTCTGTACGCGGACGAGGAGGTCGACCTGGAGGCCGTGCT
TCGACCGGAGAACTCGCAATTGTCTCCCTTCAACATGCGGCTCTGTTGGCAGCTGGGCGTGGCCTTGATGTCGAC
CGGCAAGGTGTCATTCGGCAAAAATGGAGCGGAGAAGGCGGACGCGGCGACGGTGGCGTACGCGACGCAGCTGAC
GACAGCCGGCGAGTGGCTTGATGCCGTCTTTGTTTTGTTGCACCTGAGCGACGCAAAGGCTCGAGCCAAGGCGAT
ACAGGAGCATCTCTGTCGACACGCAGGCCTGATTGGAACCGAGTCCGAGGTCAACTTTACGAAACTGGTCGACAA
GTATCGCGTCCCTGCGACGTGGATTTGGGAGGCGAAGGCCTTGTATATGCGCAGCGTGGAGCACGACGCGTCGGG
CGAGGTGCACTGTCTGCTGCGAGCCGGTTCGTTTGCAGAGGCCCATCGGGTGCTGGTCCAGCAAGTGGCGCCGCG
GGCCATTATCGAGCGCGATTACGCCGCTCTGTCGGCCCTGGTGGATCAGATGAAGGAGAAGCGGGACTCGATTTC
CGGATGGGCGTTGGGCGGGCAGGTCTACAGCAACTTCCTCGGCCTGATGCAGCATCGCGAAAGGGGCGAGAGCGT
CGCGCCGGCGCTTCTGGAGAAGATCATGGGTGGCCTTAGGGCGATGAGCGAGGTCGTGGGCGATGCCGAGATTGA
GCGGTATGCGGCCGTGTCGGACATGGCAGACGAGACGGCGCGGGAGATATTGAAACTGAGCAAGAAGAAGCAGGT
AAGCAGTTTGCGGCGTCTTGGTTACCGGTCTGGGCTGACATACGAGTTGCAGGACACAGAGCTTCGGTCTCGGAT
TCTGGGCCTCCCTCTGACGCAGGATCGGCTGCTTGCCTACTCGATGGACATGGCCTATTCGGTAGACATGGGCTT
TGCTGTCCGTGCCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail