Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7596
Gene name
LocationContig_99:10375..12969
Strand+
Gene length (bp)2594
Transcript length (bp)2307
Coding sequence length (bp)2307
Protein length (aa) 769

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03828 PAP_assoc Cid1 family poly A polymerase 2.1E-16 582 693

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13833|CID1_SCHPO Poly(A) RNA polymerase protein cid1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cid1 PE=1 SV=2 451 720 2.0E-46
sp|O64642|URT1_ARATH UTP:RNA uridylyltransferase 1 OS=Arabidopsis thaliana GN=URT1 PE=1 SV=2 452 718 1.0E-30
sp|Q6DFA8|GLD2B_XENLA Poly(A) RNA polymerase GLD2-B OS=Xenopus laevis GN=papd4-b PE=1 SV=1 453 647 8.0E-24
sp|Q641A1|GLD2A_XENLA Poly(A) RNA polymerase GLD2-A OS=Xenopus laevis GN=papd4-a PE=1 SV=1 453 639 2.0E-23
sp|Q0VFA3|GLD2_XENTR Poly(A) RNA polymerase GLD2 OS=Xenopus tropicalis GN=papd4 PE=2 SV=1 453 639 1.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13833|CID1_SCHPO Poly(A) RNA polymerase protein cid1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cid1 PE=1 SV=2 451 720 2.0E-46
sp|O64642|URT1_ARATH UTP:RNA uridylyltransferase 1 OS=Arabidopsis thaliana GN=URT1 PE=1 SV=2 452 718 1.0E-30
sp|Q6DFA8|GLD2B_XENLA Poly(A) RNA polymerase GLD2-B OS=Xenopus laevis GN=papd4-b PE=1 SV=1 453 647 8.0E-24
sp|Q641A1|GLD2A_XENLA Poly(A) RNA polymerase GLD2-A OS=Xenopus laevis GN=papd4-a PE=1 SV=1 453 639 2.0E-23
sp|Q0VFA3|GLD2_XENTR Poly(A) RNA polymerase GLD2 OS=Xenopus tropicalis GN=papd4 PE=2 SV=1 453 639 1.0E-22
sp|Q503I9|GLD2_DANRE Poly(A) RNA polymerase GLD2 OS=Danio rerio GN=papd4 PE=2 SV=1 453 645 6.0E-22
sp|Q91YI6|GLD2_MOUSE Poly(A) RNA polymerase GLD2 OS=Mus musculus GN=Papd4 PE=1 SV=1 454 639 1.0E-21
sp|Q5U315|GLD2_RAT Poly(A) RNA polymerase GLD2 OS=Rattus norvegicus GN=Papd4 PE=2 SV=1 454 639 2.0E-21
sp|Q6PIY7|GLD2_HUMAN Poly(A) RNA polymerase GLD2 OS=Homo sapiens GN=PAPD4 PE=1 SV=1 454 639 1.0E-20
sp|Q2HJ44|GLD2_BOVIN Poly(A) RNA polymerase GLD2 OS=Bos taurus GN=PAPD4 PE=2 SV=1 454 639 5.0E-20
sp|Q9VD44|GLD2A_DROME Poly(A) RNA polymerase gld-2 homolog A OS=Drosophila melanogaster GN=Gld2 PE=1 SV=3 454 658 7.0E-18
sp|O17087|GLD2_CAEEL Poly(A) RNA polymerase gld-2 OS=Caenorhabditis elegans GN=gld-2 PE=1 SV=2 454 621 2.0E-16
sp|Q5VYS8|TUT7_HUMAN Terminal uridylyltransferase 7 OS=Homo sapiens GN=ZCCHC6 PE=1 SV=1 453 639 2.0E-16
sp|Q9VYS4|GLD2B_DROME Poly(A) RNA polymerase gld-2 homolog B OS=Drosophila melanogaster GN=wisp PE=1 SV=1 445 619 1.0E-15
sp|Q9UT49|CID13_SCHPO Poly(A) RNA polymerase cid13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cid13 PE=1 SV=1 454 718 2.0E-15
sp|Q5BLK4|TUT7_MOUSE Terminal uridylyltransferase 7 OS=Mus musculus GN=Zcchc6 PE=1 SV=3 453 639 4.0E-15
sp|O13798|CID16_SCHPO Caffeine-induced protein 16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cid16 PE=4 SV=1 453 718 2.0E-13
sp|O74326|CID11_SCHPO Poly(A) RNA polymerase cid11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cid11 PE=3 SV=1 454 671 3.0E-12
sp|B2RX14|TUT4_MOUSE Terminal uridylyltransferase 4 OS=Mus musculus GN=Zcchc11 PE=1 SV=2 453 639 6.0E-12
sp|Q5TAX3|TUT4_HUMAN Terminal uridylyltransferase 4 OS=Homo sapiens GN=ZCCHC11 PE=1 SV=3 453 639 7.0E-12
sp|Q9NVV4|PAPD1_HUMAN Poly(A) RNA polymerase, mitochondrial OS=Homo sapiens GN=MTPAP PE=1 SV=1 447 596 1.0E-10
sp|Q9D0D3|PAPD1_MOUSE Poly(A) RNA polymerase, mitochondrial OS=Mus musculus GN=Mtpap PE=1 SV=1 447 596 4.0E-10
sp|D2HS90|STPAP_AILME Speckle targeted PIP5K1A-regulated poly(A) polymerase OS=Ailuropoda melanoleuca GN=TUT1 PE=3 SV=1 433 720 6.0E-09
sp|Q1JPD6|STPAP_BOVIN Speckle targeted PIP5K1A-regulated poly(A) polymerase OS=Bos taurus GN=TUT1 PE=2 SV=1 453 720 1.0E-08
sp|Q9H6E5|STPAP_HUMAN Speckle targeted PIP5K1A-regulated poly(A) polymerase OS=Homo sapiens GN=TUT1 PE=1 SV=2 433 591 1.0E-08
sp|Q4KMD7|STPAP_DANRE Speckle targeted PIP5K1A-regulated poly(A) polymerase OS=Danio rerio GN=tut1 PE=2 SV=1 446 720 7.0E-08
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5609
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7138
Ophiocordyceps australis map64 (Brazil) OphauB2|1125
Ophiocordyceps camponoti-floridani Ophcf2|05581
Ophiocordyceps camponoti-rufipedis Ophun1|7596 (this protein)
Ophiocordyceps kimflemingae Ophio5|2801
Ophiocordyceps subramaniannii Hirsu2|7593

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7596
MRIEDICRRVITLHEQQQQQTAAEFPPQSIQLKCFGSLVSGFATKTSDMDLGLLSPLSSPQPDAAESPIPRLLEQ
AFLDAGLGARLLGRARVPIIKLCQLPPEPLLQSLIAERRKWDISGKNAVNEMADEAQATHEELNDAEGFRLQQGP
ENSLSSYYALAKRALRRAEGRDATISNYREFTEPDWSILDGVCEAFVQADKTTSHRTLLGVYIQVEGERILQLWD
AWSARKALHNCQTQADQALATWNEIQQKTDFGADPVAYSRDLQLGLEKIKLVPSFQLLLLEQGPHEIPSQYHARA
KAILANLQRGSSGSSNATQKVVVDRYVSGVANGHMRAVLSRIVGSQTGQLDLEAVGLWHKGLHLSRQLEAALTKE
TLSESQASDVKEYISLLQSLPPQRIPTGPSDYKFVIPVLPEAMDLVLRIRELHDLVTVSTQPRDRYRDPFEFPST
GVGVQCDINFSAHLALQNTALLRCYSYTDVRVRPMVLFVKHWAKVRGINSGYRGTLSSYGYVLMVLHYLVNVANP
FVCPNLQQLAPPPHPDLTPAEIEATISCRGYNIRFWRDEPSIVHFATNNQLNRNGETLGHLLRGFFEYYAHNGMM
SSGTAKGFDWGRDVLSLRTPRGLLTKQEKRWTGAKTVLEHQGGSTVKQPSDVSRPAVSENQDRSGQPSKKGPEVK
EVRHRYLFAIEDPFEIDHNVARTVTHNGIVSIRDEFRRAWRIIRTAEGESTAEDLLRDVKDMQEDVDPFLKMMDD
IHGAPRTWMAMKHGEGRG*
Coding >Ophun1|7596
ATGCGTATCGAAGATATATGTCGCCGTGTCATCACTCTTCACGAACAACAGCAGCAACAGACAGCTGCCGAGTTT
CCACCACAATCCATCCAGCTTAAGTGCTTCGGCAGTCTGGTATCCGGTTTTGCCACCAAAACGTCCGACATGGAC
CTCGGCCTACTCTCGCCCCTGTCCTCTCCCCAGCCTGATGCAGCCGAATCGCCGATTCCGCGGTTGCTGGAGCAG
GCTTTCCTGGATGCTGGCCTGGGGGCACGGCTTCTCGGCCGCGCAAGGGTACCCATCATCAAGCTCTGCCAACTC
CCACCCGAGCCACTCCTCCAGTCACTCATCGCCGAGCGTCGAAAATGGGACATTAGCGGCAAGAACGCGGTCAAT
GAGATGGCAGACGAGGCCCAAGCAACGCATGAGGAACTCAACGACGCAGAAGGTTTCCGGCTTCAACAAGGGCCG
GAGAATAGTCTCTCGTCCTACTATGCACTGGCCAAGAGGGCTCTGCGAAGAGCAGAGGGGAGGGATGCGACCATC
TCAAACTACCGCGAGTTTACTGAACCAGATTGGTCAATCCTGGATGGTGTTTGCGAGGCATTCGTTCAGGCCGAT
AAGACTACCAGCCACCGGACACTCCTAGGTGTCTATATCCAGGTGGAGGGCGAACGAATCTTGCAGCTTTGGGAC
GCCTGGTCAGCCAGGAAGGCTCTGCATAACTGCCAGACACAGGCTGATCAGGCCTTGGCCACGTGGAACGAGATC
CAGCAGAAGACAGATTTCGGAGCCGATCCCGTTGCATACTCGCGCGATCTGCAGCTGGGTCTCGAGAAGATCAAG
CTTGTGCCGTCTTTTCAGCTACTTTTGCTGGAGCAGGGTCCGCATGAGATCCCCTCGCAGTATCACGCCAGGGCG
AAGGCTATCCTCGCAAACCTGCAGCGCGGCTCAAGCGGCTCATCAAACGCTACACAAAAAGTTGTTGTCGATCGT
TACGTCTCTGGCGTCGCAAACGGGCACATGCGAGCCGTGTTATCGAGAATCGTTGGCAGCCAGACCGGCCAACTT
GATCTCGAGGCTGTGGGCTTGTGGCATAAAGGCCTTCATTTATCTCGACAACTAGAAGCGGCTTTGACAAAGGAA
ACGCTAAGCGAAAGCCAGGCCTCCGACGTCAAGGAATACATCTCGCTGCTTCAATCGCTTCCTCCGCAAAGGATT
CCCACAGGGCCGAGTGATTACAAGTTTGTGATACCCGTGCTACCCGAGGCCATGGACTTGGTCTTGAGGATCAGA
GAGCTCCATGATCTCGTCACGGTGTCGACCCAGCCGCGCGACAGATATCGGGATCCGTTCGAGTTCCCATCGACG
GGGGTTGGCGTCCAGTGCGACATCAACTTCTCGGCCCATCTCGCTCTTCAGAACACTGCACTTTTGCGTTGCTAC
TCCTATACAGACGTGAGAGTGCGACCCATGGTCCTCTTCGTCAAGCACTGGGCCAAGGTTCGAGGCATCAACTCG
GGCTACCGTGGCACCCTCAGCAGTTACGGTTACGTATTGATGGTCTTGCACTACCTCGTCAACGTGGCCAATCCA
TTTGTGTGCCCCAACCTGCAGCAGCTCGCGCCGCCACCTCATCCAGACCTGACCCCGGCCGAGATCGAAGCCACG
ATTTCCTGCCGCGGCTACAACATCCGGTTCTGGCGCGACGAGCCCTCGATCGTGCACTTTGCAACCAACAACCAG
CTCAACCGGAACGGCGAGACGCTCGGACATTTGCTGCGCGGCTTCTTCGAGTATTACGCCCACAACGGCATGATG
AGCAGTGGAACGGCGAAGGGCTTCGACTGGGGAAGGGACGTGTTGAGCCTACGAACGCCACGCGGATTATTGACC
AAGCAGGAGAAGCGTTGGACTGGCGCCAAGACGGTCCTGGAACACCAGGGAGGTAGTACAGTCAAGCAGCCGTCG
GACGTCTCTCGACCCGCAGTCAGCGAAAACCAAGACAGGTCAGGCCAGCCTTCGAAGAAAGGGCCGGAGGTGAAA
GAGGTACGACATCGCTATCTCTTTGCCATCGAGGATCCATTCGAGATTGATCACAACGTGGCCCGGACCGTCACG
CACAATGGCATCGTCTCGATACGTGACGAGTTTCGTCGAGCATGGCGCATCATACGCACCGCAGAAGGCGAATCC
ACGGCCGAAGACCTTTTGCGGGATGTCAAGGATATGCAAGAAGATGTGGACCCGTTTCTGAAGATGATGGACGAC
ATTCACGGGGCGCCCCGAACTTGGATGGCGATGAAGCACGGCGAGGGAAGAGGTTGA
Transcript >Ophun1|7596
ATGCGTATCGAAGATATATGTCGCCGTGTCATCACTCTTCACGAACAACAGCAGCAACAGACAGCTGCCGAGTTT
CCACCACAATCCATCCAGCTTAAGTGCTTCGGCAGTCTGGTATCCGGTTTTGCCACCAAAACGTCCGACATGGAC
CTCGGCCTACTCTCGCCCCTGTCCTCTCCCCAGCCTGATGCAGCCGAATCGCCGATTCCGCGGTTGCTGGAGCAG
GCTTTCCTGGATGCTGGCCTGGGGGCACGGCTTCTCGGCCGCGCAAGGGTACCCATCATCAAGCTCTGCCAACTC
CCACCCGAGCCACTCCTCCAGTCACTCATCGCCGAGCGTCGAAAATGGGACATTAGCGGCAAGAACGCGGTCAAT
GAGATGGCAGACGAGGCCCAAGCAACGCATGAGGAACTCAACGACGCAGAAGGTTTCCGGCTTCAACAAGGGCCG
GAGAATAGTCTCTCGTCCTACTATGCACTGGCCAAGAGGGCTCTGCGAAGAGCAGAGGGGAGGGATGCGACCATC
TCAAACTACCGCGAGTTTACTGAACCAGATTGGTCAATCCTGGATGGTGTTTGCGAGGCATTCGTTCAGGCCGAT
AAGACTACCAGCCACCGGACACTCCTAGGTGTCTATATCCAGGTGGAGGGCGAACGAATCTTGCAGCTTTGGGAC
GCCTGGTCAGCCAGGAAGGCTCTGCATAACTGCCAGACACAGGCTGATCAGGCCTTGGCCACGTGGAACGAGATC
CAGCAGAAGACAGATTTCGGAGCCGATCCCGTTGCATACTCGCGCGATCTGCAGCTGGGTCTCGAGAAGATCAAG
CTTGTGCCGTCTTTTCAGCTACTTTTGCTGGAGCAGGGTCCGCATGAGATCCCCTCGCAGTATCACGCCAGGGCG
AAGGCTATCCTCGCAAACCTGCAGCGCGGCTCAAGCGGCTCATCAAACGCTACACAAAAAGTTGTTGTCGATCGT
TACGTCTCTGGCGTCGCAAACGGGCACATGCGAGCCGTGTTATCGAGAATCGTTGGCAGCCAGACCGGCCAACTT
GATCTCGAGGCTGTGGGCTTGTGGCATAAAGGCCTTCATTTATCTCGACAACTAGAAGCGGCTTTGACAAAGGAA
ACGCTAAGCGAAAGCCAGGCCTCCGACGTCAAGGAATACATCTCGCTGCTTCAATCGCTTCCTCCGCAAAGGATT
CCCACAGGGCCGAGTGATTACAAGTTTGTGATACCCGTGCTACCCGAGGCCATGGACTTGGTCTTGAGGATCAGA
GAGCTCCATGATCTCGTCACGGTGTCGACCCAGCCGCGCGACAGATATCGGGATCCGTTCGAGTTCCCATCGACG
GGGGTTGGCGTCCAGTGCGACATCAACTTCTCGGCCCATCTCGCTCTTCAGAACACTGCACTTTTGCGTTGCTAC
TCCTATACAGACGTGAGAGTGCGACCCATGGTCCTCTTCGTCAAGCACTGGGCCAAGGTTCGAGGCATCAACTCG
GGCTACCGTGGCACCCTCAGCAGTTACGGTTACGTATTGATGGTCTTGCACTACCTCGTCAACGTGGCCAATCCA
TTTGTGTGCCCCAACCTGCAGCAGCTCGCGCCGCCACCTCATCCAGACCTGACCCCGGCCGAGATCGAAGCCACG
ATTTCCTGCCGCGGCTACAACATCCGGTTCTGGCGCGACGAGCCCTCGATCGTGCACTTTGCAACCAACAACCAG
CTCAACCGGAACGGCGAGACGCTCGGACATTTGCTGCGCGGCTTCTTCGAGTATTACGCCCACAACGGCATGATG
AGCAGTGGAACGGCGAAGGGCTTCGACTGGGGAAGGGACGTGTTGAGCCTACGAACGCCACGCGGATTATTGACC
AAGCAGGAGAAGCGTTGGACTGGCGCCAAGACGGTCCTGGAACACCAGGGAGGTAGTACAGTCAAGCAGCCGTCG
GACGTCTCTCGACCCGCAGTCAGCGAAAACCAAGACAGGTCAGGCCAGCCTTCGAAGAAAGGGCCGGAGGTGAAA
GAGGTACGACATCGCTATCTCTTTGCCATCGAGGATCCATTCGAGATTGATCACAACGTGGCCCGGACCGTCACG
CACAATGGCATCGTCTCGATACGTGACGAGTTTCGTCGAGCATGGCGCATCATACGCACCGCAGAAGGCGAATCC
ACGGCCGAAGACCTTTTGCGGGATGTCAAGGATATGCAAGAAGATGTGGACCCGTTTCTGAAGATGATGGACGAC
ATTCACGGGGCGCCCCGAACTTGGATGGCGATGAAGCACGGCGAGGGAAGAGGTTGA
Gene >Ophun1|7596
ATGCGTATCGAAGATATATGTCGCCGTGTCATCACTCTTCACGAACAACAGCAGCAACAGACAGCTGCCGAGTTT
CCACCACAATCCATCCAGCTTAAGTGCTTCGGCAGTCTGGTATCCGGTTTTGCCACCAAAACGTCCGACATGGAC
CTCGGCCTACTCTCGCCCCTGTCCTCTCCCCAGCCTGATGCAGCCGAATCGCCGATTCCGCGGTTGCTGGAGCAG
GCTTTCCTGGATGCTGGCCTGGGGGCACGGCTTCTCGGCCGCGCAAGGGTACCCATCATCAAGCTCTGCCAACTC
CCACCCGAGCCACTCCTCCAGTCACTCATCGCCGAGCGTCGAAAATGGGACATTAGCGGCAAGAACGCGGTCAAT
GAGATGGCAGACGGTGAGCGCGAGGGAGAGACTGGATCACCAGACCATCCTGATGAGGAGGCTCCACGCCAAACA
ACACTCAGTTCATCGTCGCCTGGAAAGGTCCGAGCATCTAGCGGCGAAGATGCGGCCATTGGGCTCGCAGACGAC
TGTCGAGAGGGGGGTGCTGGATCACCAGACCACCCTGGTAATAAGCTCCACGTCAAGTTTCGAAACTCAGCTAAT
CGTCGCTTGTAGAGGCCCAAGCAACGCATGAGGAACTCAACGACGCAGAAGGTTTCCGGCTTCAACAAGGGCCGG
AGAATAGTCTCTCGTCCTACTATGCACTGGCCAAGAGGGCTCTGCGAAGAGCAGAGGGGAGGGATGCGACCATCT
CAAACTACCGCGAGTTTACTGAACCAGATTGGTCAATCCTGGATGGTGTTTGCGAGGCATTCGTTCAGGGTCTCT
TCGACTCTGTACTTCGAGAAAGGTTGACTCGATTTCCCTCGCTCTCTCATCGACCAGCCGATAAGACTACCAGCC
ACCGGACACTCCTAGGTGTCTATATCCAGGTGGAGGGCGAACGAATCTTGCAGCTTTGGGACGCCTGGTCAGCCA
GGAAGGCTCTGCATAACTGCCAGACACAGGCTGATCAGGCCTTGGCCACGTGGAACGAGATCCAGCAGAAGACAG
ATTTCGGAGCCGATCCCGTTGCATACTCGCGCGATCTGCAGCTGGGTCTCGAGAAGATCAAGCTTGTGCCGTCTT
TTCAGCTACTTTTGCTGGAGCAGGGTCCGCATGAGATCCCCTCGCAGTATCACGCCAGGGCGAAGGCTATCCTCG
CAAACCTGCAGCGCGGCTCAAGCGGCTCATCAAACGCTACACAAAAAGTTGTTGTCGATCGTTACGTCTCTGGCG
TCGCAAACGGGCACATGCGAGCCGTGTTATCGAGAATCGTTGGCAGCCAGACCGGCCAACTTGATCTCGAGGCTG
TGGGCTTGTGGCATAAAGGCCTTCATTTATCTCGACAACTAGAAGCGGCTTTGACAAAGGAAACGCTAAGCGAAA
GCCAGGCCTCCGACGTCAAGGAATACATCTCGCTGCTTCAATCGCTTCCTCCGCAAAGGATTCCCACAGGGCCGA
GTGATTACAAGTTTGTGATACCCGTGCTACCCGAGGCCATGGACTTGGTCTTGAGGATCAGAGAGCTCCATGATC
TCGTCACGGTGTCGACCCAGCCGCGCGACAGATATCGGGATCCGTTCGAGTTCCCATCGACGGGGGTTGGCGTCC
AGTGCGACATCAACTTCTCGGCCCATCTCGCTCTTCAGAACACTGCACTTTTGCGTTGCTACTCCTATACAGACG
TGAGAGTGCGACCCATGGTCCTCTTCGTCAAGCACTGGGCCAAGGTTCGAGGCATCAACTCGGGCTACCGTGGCA
CCCTCAGCAGTTACGGTTACGTATTGATGGTCTTGCACTACCTCGTCAACGTGGCCAATCCATTTGTGTGCCCCA
ACCTGCAGCAGCTCGCGCCGCCACCTCATCCAGACCTGACCCCGGCCGAGATCGAAGCCACGATTTCCTGCCGCG
GCTACAACATCCGGTTCTGGCGCGACGAGCCCTCGATCGTGCACTTTGCAACCAACAACCAGCTCAACCGGAACG
GCGAGACGCTCGGACATTTGCTGCGCGGCTTCTTCGAGTATTACGCCCACAACGGCATGATGAGCAGTGGAACGG
CGAAGGGCTTCGACTGGGGAAGGGACGTGTTGAGCCTACGAACGCCACGCGGATTATTGACCAAGCAGGAGAAGC
GTTGGACTGGCGCCAAGACGGTCCTGGAACACCAGGGAGGTAGTACAGTCAAGCAGCCGTCGGACGTCTCTCGAC
CCGCAGTCAGCGAAAACCAAGACAGGTCAGGCCAGCCTTCGAAGAAAGGGCCGGAGGTGAAAGAGGTACGACATC
GCTATCTCTTTGCCATCGAGGATCCATTCGAGATTGATCACAACGTGGCCCGGACCGTCACGCACAATGGCATCG
TCTCGATACGTGACGAGTTTCGTCGAGCATGGCGCATCATACGCACCGCAGAAGGCGAATCCACGGCCGAAGACC
TTTTGCGGGATGTCAAGGATATGCAAGAAGATGTGGACCCGTTTCTGAAGATGATGGACGACATTCACGGGGCGC
CCCGAACTTGGATGGCGATGAAGCACGGCGAGGGAAGAGGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail