Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7590
Gene name
LocationContig_989:1674..4517
Strand+
Gene length (bp)2843
Transcript length (bp)2505
Coding sequence length (bp)2505
Protein length (aa) 835

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17846 XRN_M Xrn1 helical domain 5.8E-135 276 770
PF03159 XRN_N XRN 5'-3' exonuclease N-terminus 7.6E-27 1 103
PF03159 XRN_N XRN 5'-3' exonuclease N-terminus 4.1E-46 104 204

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q2GNZ6|XRN2_CHAGB 5'-3' exoribonuclease 2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=RAT1 PE=3 SV=3 1 788 0.0E+00
sp|Q9FQ03|XRN3_ARATH 5'-3' exoribonuclease 3 OS=Arabidopsis thaliana GN=XRN3 PE=2 SV=1 1 769 0.0E+00
sp|Q9VM71|XRN2_DROME 5'-3' exoribonuclease 2 homolog OS=Drosophila melanogaster GN=Rat1 PE=1 SV=2 1 765 0.0E+00
sp|Q60SG7|XRN2_CAEBR 5'-3' exoribonuclease 2 homolog OS=Caenorhabditis briggsae GN=xrn-2 PE=3 SV=2 1 675 0.0E+00
sp|Q9U299|XRN2_CAEEL 5'-3' exoribonuclease 2 homolog OS=Caenorhabditis elegans GN=xrn-2 PE=1 SV=2 1 769 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q2GNZ6|XRN2_CHAGB 5'-3' exoribonuclease 2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=RAT1 PE=3 SV=3 1 788 0.0E+00
sp|Q9FQ03|XRN3_ARATH 5'-3' exoribonuclease 3 OS=Arabidopsis thaliana GN=XRN3 PE=2 SV=1 1 769 0.0E+00
sp|Q9VM71|XRN2_DROME 5'-3' exoribonuclease 2 homolog OS=Drosophila melanogaster GN=Rat1 PE=1 SV=2 1 765 0.0E+00
sp|Q60SG7|XRN2_CAEBR 5'-3' exoribonuclease 2 homolog OS=Caenorhabditis briggsae GN=xrn-2 PE=3 SV=2 1 675 0.0E+00
sp|Q9U299|XRN2_CAEEL 5'-3' exoribonuclease 2 homolog OS=Caenorhabditis elegans GN=xrn-2 PE=1 SV=2 1 769 0.0E+00
sp|Q9DBR1|XRN2_MOUSE 5'-3' exoribonuclease 2 OS=Mus musculus GN=Xrn2 PE=1 SV=1 1 771 0.0E+00
sp|Q5R4L5|XRN2_PONAB 5'-3' exoribonuclease 2 OS=Pongo abelii GN=XRN2 PE=2 SV=1 1 771 0.0E+00
sp|Q9H0D6|XRN2_HUMAN 5'-3' exoribonuclease 2 OS=Homo sapiens GN=XRN2 PE=1 SV=1 1 771 0.0E+00
sp|Q5ZIP4|XRN2_CHICK 5'-3' exoribonuclease 2 OS=Gallus gallus GN=XRN2 PE=2 SV=1 1 771 0.0E+00
sp|Q6CKX0|XRN2_KLULA 5'-3' exoribonuclease 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RAT1 PE=3 SV=3 1 773 0.0E+00
sp|Q6BNU7|XRN2_DEBHA 5'-3' exoribonuclease 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RAT1 PE=3 SV=4 1 781 0.0E+00
sp|Q74ZA0|XRN2_ASHGO 5'-3' exoribonuclease 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RAT1 PE=3 SV=4 1 773 0.0E+00
sp|Q5AMG5|XRN2_CANAL 5'-3' exoribonuclease 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RAT1 PE=3 SV=3 1 769 0.0E+00
sp|P40848|XRN2_SCHPO 5'-3' exoribonuclease 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dhp1 PE=1 SV=1 1 797 0.0E+00
sp|Q4HWE2|XRN2_GIBZE 5'-3' exoribonuclease 2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=RAT1 PE=3 SV=3 1 810 0.0E+00
sp|Q8WZX5|XRN2_NEUCR 5'-3' exoribonuclease 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=exr-1 PE=3 SV=3 104 788 0.0E+00
sp|Q5BFH3|XRN2_EMENI 5'-3' exoribonuclease 2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rat1 PE=3 SV=3 1 788 0.0E+00
sp|Q2UCP5|XRN2_ASPOR 5'-3' exoribonuclease 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=rat1 PE=3 SV=3 1 788 0.0E+00
sp|Q8TFZ1|XRN2_ASPFU 5'-3' exoribonuclease 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rat1 PE=3 SV=4 1 788 0.0E+00
sp|Q9FQ02|XRN2_ARATH 5'-3' exoribonuclease 2 OS=Arabidopsis thaliana GN=XRN2 PE=2 SV=1 1 705 6.0E-172
sp|Q6C961|XRN2_YARLI 5'-3' exoribonuclease 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RAT1 PE=3 SV=3 105 776 3.0E-158
sp|P0CL88|XRN2_CRYNJ 5'-3' exoribonuclease 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=RAT1 PE=3 SV=1 1 479 7.0E-149
sp|P0CL89|XRN2_CRYNB 5'-3' exoribonuclease 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=RAT1 PE=3 SV=1 1 479 8.0E-149
sp|Q4P149|XRN2_USTMA 5'-3' exoribonuclease 2 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=RAT1 PE=3 SV=3 1 376 1.0E-140
sp|Q6FKN6|XRN2_CANGA 5'-3' exoribonuclease 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RAT1 PE=3 SV=3 1 384 1.0E-139
sp|Q02792|XRN2_YEAST 5'-3' exoribonuclease 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAT1 PE=1 SV=3 1 489 6.0E-138
sp|Q9FQ04|XRN4_ARATH 5'-3' exoribonuclease 4 OS=Arabidopsis thaliana GN=XRN4 PE=2 SV=1 1 378 1.0E-112
sp|P22147|XRN1_YEAST 5'-3' exoribonuclease 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=XRN1 PE=1 SV=1 1 666 2.0E-98
sp|Q4P149|XRN2_USTMA 5'-3' exoribonuclease 2 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=RAT1 PE=3 SV=3 490 774 3.0E-78
sp|Q8IZH2|XRN1_HUMAN 5'-3' exoribonuclease 1 OS=Homo sapiens GN=XRN1 PE=1 SV=1 1 347 7.0E-69
sp|P97789|XRN1_MOUSE 5'-3' exoribonuclease 1 OS=Mus musculus GN=Xrn1 PE=1 SV=1 1 347 2.0E-68
sp|Q02792|XRN2_YEAST 5'-3' exoribonuclease 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAT1 PE=1 SV=3 443 773 7.0E-68
sp|P40383|XRN1_SCHPO 5'-3' exoribonuclease 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=exo2 PE=1 SV=1 1 355 8.0E-67
sp|Q6FKN6|XRN2_CANGA 5'-3' exoribonuclease 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RAT1 PE=3 SV=3 492 817 2.0E-64
sp|P0CL88|XRN2_CRYNJ 5'-3' exoribonuclease 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=RAT1 PE=3 SV=1 490 769 2.0E-64
sp|P0CL89|XRN2_CRYNB 5'-3' exoribonuclease 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=RAT1 PE=3 SV=1 490 769 3.0E-64
sp|Q9FQ04|XRN4_ARATH 5'-3' exoribonuclease 4 OS=Arabidopsis thaliana GN=XRN4 PE=2 SV=1 475 771 4.0E-51
sp|Q8WZX5|XRN2_NEUCR 5'-3' exoribonuclease 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=exr-1 PE=3 SV=3 1 103 2.0E-50
sp|P97789|XRN1_MOUSE 5'-3' exoribonuclease 1 OS=Mus musculus GN=Xrn1 PE=1 SV=1 490 670 2.0E-38
sp|Q8IZH2|XRN1_HUMAN 5'-3' exoribonuclease 1 OS=Homo sapiens GN=XRN1 PE=1 SV=1 490 670 7.0E-38
sp|P40383|XRN1_SCHPO 5'-3' exoribonuclease 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=exo2 PE=1 SV=1 499 676 6.0E-35
sp|Q6C961|XRN2_YARLI 5'-3' exoribonuclease 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RAT1 PE=3 SV=3 1 103 3.0E-28
sp|Q197A1|EX0N_IIV3 Putative exonuclease 059L OS=Invertebrate iridescent virus 3 GN=IIV3-059L PE=3 SV=1 1 329 2.0E-20
sp|Q197A1|EX0N_IIV3 Putative exonuclease 059L OS=Invertebrate iridescent virus 3 GN=IIV3-059L PE=3 SV=1 520 665 9.0E-14
sp|Q9QSK5|EXON_IIV6 Putative exonuclease 012L OS=Invertebrate iridescent virus 6 GN=IIV6-012L PE=3 SV=1 275 357 2.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0004527 exonuclease activity Yes
GO:0003676 nucleic acid binding Yes
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0004518 nuclease activity No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0016788 hydrolase activity, acting on ester bonds No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5235
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6282
Ophiocordyceps australis map64 (Brazil) OphauB2|8174
Ophiocordyceps camponoti-floridani Ophcf2|01807
Ophiocordyceps camponoti-rufipedis Ophun1|7590 (this protein)
Ophiocordyceps kimflemingae Ophio5|525
Ophiocordyceps subramaniannii Hirsu2|4336

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7590
MGIPAAFRWLSNKYPKIISSVVEEQPVTLEDGTTIPVDTTSRNPNGEEFDNLYLDMNGIVHPCSHPEDRPAPKDE
EAMMLEVFRYTDRVVNMVRPRKLLMIAVAFDSNVITPGTPFMDTLAISLRYWCQYKLNTDPAWAKLKIIISDATI
PGEGEHKIMSFVRSQRGSTDYDPNTKHVIYGLDADLIMLGLATHEPHFRVLREDVFFQDRKPRACKLCGQQGHEA
RDCRGEPKEQKDGAEEKTGGESLKPFIWLHVSVLREYLAAELSVPGLPFRFDLERAIDDWVFMCCFVGNDFLPHL
PALEIREHGIDTLTKIWRDNLALMGGYVTQDGHINWERAQRILAELAKQEDSILKRRKEQEDRREANAKRRKLQN
QGPRTAANRADGSKARQNGHQDPTRGLQLHPIASYPREPPPAITHDMIVNRGQHDDANLANKSAASVLKSQLRGE
PSSSVLGKRNHSAVEGAGESAVDGQVARTTATSADDSPVDLVRLGEEGYADRYYQQKFNKDPSDVAFRHAVARAY
AEGLAWVLLYYFQGCPSWDWFYPYHYAPFAADFKDLAGIKFTFNKGYISKPFEQLMSVLPAASRHSLPEVFHELM
TSKDSDIIDFYPEEFEIDLNGKKMAWQGVALLPFIDMPRLLGAVQRLYPQLSPADALRNSTGRDVLLFADSHESL
YNEVSTRFYSKRQGASKFKVGAATSDGLIGKLEKRDDYVPHGMLRYPLERNAMPDLDYDRSMSVYYDMPASHLAH
KSMLLRGAQLPPPVLTRSDIEVIRGRATRHGRNYGGPPPDRVDAWRGQANRPPGRGQFPPRLANSRGEAPNFPPK
AYRGGGWTQ*
Coding >Ophun1|7590
ATGGGCATTCCGGCTGCCTTTCGATGGCTTTCGAACAAGTATCCGAAGATTATTTCCTCGGTGGTAGAGGAACAG
CCCGTGACTTTAGAGGATGGAACTACTATCCCCGTTGACACCACATCGCGCAATCCCAATGGTGAAGAATTCGAT
AATCTTTACCTCGACATGAACGGCATTGTTCATCCGTGCTCGCATCCAGAAGATAGGCCCGCCCCTAAAGATGAG
GAAGCCATGATGCTCGAAGTCTTTAGATACACTGATCGAGTGGTCAACATGGTTCGACCGCGCAAGCTACTAATG
ATTGCCGTTGCATTTGATTCTAATGTCATTACTCCTGGAACACCCTTCATGGACACTCTCGCTATTAGTTTGCGT
TACTGGTGCCAGTACAAGCTCAACACCGATCCCGCCTGGGCGAAGCTCAAGATCATAATCTCCGACGCCACTATT
CCGGGTGAGGGCGAACACAAGATCATGTCATTTGTCAGGTCGCAGCGCGGATCCACCGACTACGATCCAAATACT
AAACACGTTATCTACGGACTGGATGCTGATCTCATCATGCTTGGATTGGCGACGCATGAGCCTCATTTCAGGGTC
CTACGGGAAGATGTATTCTTTCAAGACAGAAAGCCGCGGGCGTGCAAGCTTTGCGGTCAGCAAGGTCACGAGGCT
CGTGACTGCCGCGGTGAGCCGAAGGAACAGAAGGACGGGGCCGAGGAGAAGACGGGCGGCGAGTCTCTCAAGCCA
TTTATTTGGCTGCACGTTTCGGTTTTGCGAGAATACTTGGCCGCGGAGCTTTCAGTCCCTGGTCTGCCTTTTCGT
TTCGATCTCGAGCGAGCCATTGACGACTGGGTCTTCATGTGTTGTTTTGTTGGAAACGACTTTCTTCCTCATTTA
CCGGCTTTGGAGATACGCGAGCATGGTATCGACACTTTGACAAAGATCTGGCGAGATAATCTGGCCTTGATGGGA
GGCTATGTGACCCAAGACGGTCACATCAACTGGGAGAGAGCGCAGCGGATACTGGCCGAGCTGGCGAAACAGGAA
GATTCGATCTTGAAACGCCGCAAAGAGCAGGAGGATCGTCGGGAAGCAAATGCGAAGCGAAGAAAATTGCAAAAC
CAAGGTCCGCGCACTGCAGCAAATCGAGCCGATGGATCAAAAGCCCGTCAAAATGGACACCAGGATCCGACTCGC
GGCCTGCAGCTTCATCCTATTGCATCATACCCTCGGGAACCTCCCCCGGCTATCACTCATGACATGATTGTCAAT
CGAGGTCAACATGATGACGCGAACCTGGCCAACAAGAGTGCGGCAAGTGTCCTGAAGTCGCAACTTCGCGGCGAG
CCATCGTCTTCTGTCCTTGGGAAGCGCAATCACTCGGCCGTCGAAGGCGCTGGTGAAAGTGCTGTGGATGGTCAG
GTGGCACGTACGACAGCCACCTCGGCAGACGACAGCCCAGTCGACCTCGTGAGGCTAGGTGAAGAGGGTTATGCA
GACCGCTATTACCAGCAAAAGTTCAACAAGGACCCCAGCGATGTGGCCTTTCGTCACGCAGTGGCTCGTGCCTAT
GCCGAGGGTCTGGCATGGGTTCTTTTGTACTATTTCCAAGGTTGCCCTTCTTGGGATTGGTTCTACCCTTATCAC
TACGCGCCATTCGCGGCCGATTTCAAGGATTTGGCCGGCATCAAGTTCACGTTCAATAAAGGTTACATTTCGAAG
CCCTTTGAACAACTCATGAGCGTTCTACCCGCCGCATCTCGCCATTCCCTTCCCGAGGTCTTTCATGAACTCATG
ACGAGCAAGGACAGCGACATCATCGATTTCTACCCAGAGGAATTCGAGATAGACTTGAACGGCAAAAAAATGGCT
TGGCAGGGTGTAGCGCTTTTGCCTTTCATCGACATGCCTCGCCTTCTCGGAGCTGTTCAGCGACTGTATCCGCAA
CTGAGCCCTGCGGACGCTCTTCGCAACAGCACGGGCCGAGATGTTCTACTGTTCGCCGATAGCCATGAGAGCTTG
TACAACGAGGTCTCAACCAGGTTTTATTCGAAACGCCAGGGCGCATCCAAGTTTAAAGTTGGCGCTGCCACCAGC
GACGGCCTCATCGGAAAGCTCGAGAAGCGAGATGACTACGTTCCCCATGGGATGTTGCGATATCCCCTAGAGAGG
AACGCCATGCCAGACTTGGACTATGATCGCTCAATGAGCGTTTACTATGACATGCCCGCATCACACCTGGCTCAT
AAATCCATGCTTTTGCGAGGCGCTCAGCTGCCCCCACCAGTCCTGACAAGAAGTGACATTGAGGTGATCAGGGGC
AGGGCTACCAGACATGGTCGGAACTATGGTGGACCTCCGCCAGATAGAGTCGATGCCTGGCGTGGACAAGCCAAC
AGACCTCCGGGCCGGGGACAATTTCCCCCTCGCTTGGCCAATTCCAGGGGCGAGGCACCAAACTTTCCTCCCAAG
GCGTACCGGGGTGGCGGTTGGACTCAGTAG
Transcript >Ophun1|7590
ATGGGCATTCCGGCTGCCTTTCGATGGCTTTCGAACAAGTATCCGAAGATTATTTCCTCGGTGGTAGAGGAACAG
CCCGTGACTTTAGAGGATGGAACTACTATCCCCGTTGACACCACATCGCGCAATCCCAATGGTGAAGAATTCGAT
AATCTTTACCTCGACATGAACGGCATTGTTCATCCGTGCTCGCATCCAGAAGATAGGCCCGCCCCTAAAGATGAG
GAAGCCATGATGCTCGAAGTCTTTAGATACACTGATCGAGTGGTCAACATGGTTCGACCGCGCAAGCTACTAATG
ATTGCCGTTGCATTTGATTCTAATGTCATTACTCCTGGAACACCCTTCATGGACACTCTCGCTATTAGTTTGCGT
TACTGGTGCCAGTACAAGCTCAACACCGATCCCGCCTGGGCGAAGCTCAAGATCATAATCTCCGACGCCACTATT
CCGGGTGAGGGCGAACACAAGATCATGTCATTTGTCAGGTCGCAGCGCGGATCCACCGACTACGATCCAAATACT
AAACACGTTATCTACGGACTGGATGCTGATCTCATCATGCTTGGATTGGCGACGCATGAGCCTCATTTCAGGGTC
CTACGGGAAGATGTATTCTTTCAAGACAGAAAGCCGCGGGCGTGCAAGCTTTGCGGTCAGCAAGGTCACGAGGCT
CGTGACTGCCGCGGTGAGCCGAAGGAACAGAAGGACGGGGCCGAGGAGAAGACGGGCGGCGAGTCTCTCAAGCCA
TTTATTTGGCTGCACGTTTCGGTTTTGCGAGAATACTTGGCCGCGGAGCTTTCAGTCCCTGGTCTGCCTTTTCGT
TTCGATCTCGAGCGAGCCATTGACGACTGGGTCTTCATGTGTTGTTTTGTTGGAAACGACTTTCTTCCTCATTTA
CCGGCTTTGGAGATACGCGAGCATGGTATCGACACTTTGACAAAGATCTGGCGAGATAATCTGGCCTTGATGGGA
GGCTATGTGACCCAAGACGGTCACATCAACTGGGAGAGAGCGCAGCGGATACTGGCCGAGCTGGCGAAACAGGAA
GATTCGATCTTGAAACGCCGCAAAGAGCAGGAGGATCGTCGGGAAGCAAATGCGAAGCGAAGAAAATTGCAAAAC
CAAGGTCCGCGCACTGCAGCAAATCGAGCCGATGGATCAAAAGCCCGTCAAAATGGACACCAGGATCCGACTCGC
GGCCTGCAGCTTCATCCTATTGCATCATACCCTCGGGAACCTCCCCCGGCTATCACTCATGACATGATTGTCAAT
CGAGGTCAACATGATGACGCGAACCTGGCCAACAAGAGTGCGGCAAGTGTCCTGAAGTCGCAACTTCGCGGCGAG
CCATCGTCTTCTGTCCTTGGGAAGCGCAATCACTCGGCCGTCGAAGGCGCTGGTGAAAGTGCTGTGGATGGTCAG
GTGGCACGTACGACAGCCACCTCGGCAGACGACAGCCCAGTCGACCTCGTGAGGCTAGGTGAAGAGGGTTATGCA
GACCGCTATTACCAGCAAAAGTTCAACAAGGACCCCAGCGATGTGGCCTTTCGTCACGCAGTGGCTCGTGCCTAT
GCCGAGGGTCTGGCATGGGTTCTTTTGTACTATTTCCAAGGTTGCCCTTCTTGGGATTGGTTCTACCCTTATCAC
TACGCGCCATTCGCGGCCGATTTCAAGGATTTGGCCGGCATCAAGTTCACGTTCAATAAAGGTTACATTTCGAAG
CCCTTTGAACAACTCATGAGCGTTCTACCCGCCGCATCTCGCCATTCCCTTCCCGAGGTCTTTCATGAACTCATG
ACGAGCAAGGACAGCGACATCATCGATTTCTACCCAGAGGAATTCGAGATAGACTTGAACGGCAAAAAAATGGCT
TGGCAGGGTGTAGCGCTTTTGCCTTTCATCGACATGCCTCGCCTTCTCGGAGCTGTTCAGCGACTGTATCCGCAA
CTGAGCCCTGCGGACGCTCTTCGCAACAGCACGGGCCGAGATGTTCTACTGTTCGCCGATAGCCATGAGAGCTTG
TACAACGAGGTCTCAACCAGGTTTTATTCGAAACGCCAGGGCGCATCCAAGTTTAAAGTTGGCGCTGCCACCAGC
GACGGCCTCATCGGAAAGCTCGAGAAGCGAGATGACTACGTTCCCCATGGGATGTTGCGATATCCCCTAGAGAGG
AACGCCATGCCAGACTTGGACTATGATCGCTCAATGAGCGTTTACTATGACATGCCCGCATCACACCTGGCTCAT
AAATCCATGCTTTTGCGAGGCGCTCAGCTGCCCCCACCAGTCCTGACAAGAAGTGACATTGAGGTGATCAGGGGC
AGGGCTACCAGACATGGTCGGAACTATGGTGGACCTCCGCCAGATAGAGTCGATGCCTGGCGTGGACAAGCCAAC
AGACCTCCGGGCCGGGGACAATTTCCCCCTCGCTTGGCCAATTCCAGGGGCGAGGCACCAAACTTTCCTCCCAAG
GCGTACCGGGGTGGCGGTTGGACTCAGTAG
Gene >Ophun1|7590
ATGGGCATTCCGGCTGCCTTTCGATGGCTTTCGAACAAGTATCCGAAGATTATTTCCTCGGTGGTAGAGGAACAG
CCCGTGACTTTAGAGGATGGAACTACTATCCCCGTTGACACCACATCGCGCAATCCCAATGGTGAAGAATTCGAT
AATCTTTACCTCGACATGAACGGCATTGTTCATCCGTGCTCGCATCCAGAAGATAGGCCCGCCCCTAAAGATGAG
GAAGCCATGATGCTCGAAGTCTTTAGATACACTGATCGAGTGGTCAACATGGTTCGACCGCGCAAGCTACTAATG
ATTGCCGTTGGTATGTGCCCCCGACCTTGTCTGAAGAAAAAGATTCAGGACTAATCAGTTCCTCTTAGATGGAGT
TGCGCCCCGTGCTAAGATGAACCAACAAAGATCGAGGCGATTTCGGTCGGCGCAGGAAGCCAAGCAGAAAGAAGA
GGAAAAAAAGGAGCTCCTGAAGACTCTTAGTAAAGATAACGACGCTTCGGGGGTTTCACAGAGCCCTGAAAGCAT
CGCGAAAGCATTTGATTCTAATGTCATTACTCCTGGAACACCCTTCATGGACACTCTCGCTATTAGTTTGCGTTA
CTGGTGCCAGTACAAGCTCAACACCGATCCCGCCTGGGCGAAGCTCAAGATCATAATCTCCGACGCCACTATTCC
GGGTGAGGGCGAACACAAGATCATGTCATTTGTCAGGTCGCAGCGCGGATCCACCGACTACGATCCAAATACTAA
ACACGTTATCTACGGACTGGATGCTGATCTCATCATGCTTGGATTGGCGACGCATGAGCCTCATTTCAGGGTCCT
ACGGGAAGATGTATTCTTTCAAGACAGAAAGCCGCGGGCGTGCAAGCTTTGCGGTCAGCAAGGTCACGAGGCTCG
TGACTGCCGCGGTGAGCCGAAGGAACAGAAGGACGGGGCCGAGGAGAAGACGGGCGGCGAGTCTCTCAAGCCATT
TATTTGGCTGCACGTTTCGGTTTTGCGAGAATACTTGGCCGCGGAGCTTTCAGTCCCTGGTCTGCCTTTTCGTTT
CGATCTCGAGCGAGCCATTGACGACTGGGTCTTCATGTGTTGTTTTGTTGGAAACGACTTTCTTCCTCATTTACC
GGCTTTGGAGATACGCGAGCATGGTATCGACACTTTGACAAAGATCTGGCGAGATAATCTGGCCTTGATGGGAGG
CTATGTGACCCAAGACGGTCACATCAACTGGGAGAGAGCGCAGCGGATACTGGCCGAGCTGGCGAAACAGGAAGA
TTCGATCTTGAAACGCCGCAAAGAGCAGGAGGATCGTCGGGAAGCAAATGCGAAGCGAAGAAAATTGCAAAACCA
AGGTCCGCGCACTGCAGCAAATCGAGCCGATGGATCAAAAGCCCGTCAAAATGGACACCAGGATCCGACTCGCGG
CCTGCAGCTTCATCCTATTGCATCATACCCTCGGGAACCTCCCCCGGCTATCACTCATGACATGATTGTCAATCG
AGGTCAACATGATGACGCGAACCTGGCCAACAAGAGTGCGGCAAGTGTCCTGAAGTCGCAACTTCGCGGCGAGCC
ATCGTCTTCTGTCCTTGGGAAGCGCAATCACTCGGCCGTCGAAGGCGCTGGTGAAAGTGCTGTGGATGGTCAGGT
GGCACGTACGACAGCCACCTCGGCAGACGACAGCCCAGTCGACCTCGTGAGGCTAGGTGAAGAGGGTTATGCAGA
CCGCTATTACCAGCAAAAGTTCAACAAGGACCCCAGCGATGTGGCCTTTCGTCACGCAGTGGCTCGTGCCTATGC
CGAGGGTCTGGCATGGGTTCTTTTGTACTATTTCCAAGGTTGCCCTTCTTGGGATTGGTTCTACCCTTATCACTA
CGCGCCATTCGCGGCCGATTTCAAGGATTTGGCCGGCATCAAGTTCACGTTCAATAAAGGTTACATTTCGAAGCC
CTTTGAACAACTCATGAGCGTTCTACCCGCCGCATCTCGCCATTCCCTTCCCGAGGTCTTTCATGAACTCATGAC
GAGCAAGGACAGCGACATCATCGATTTCTACCCAGAGGAATTCGAGATAGACTTGAACGGCAAAAAAATGGCTTG
GCAGGGTGTAGCGCTTTTGCCTTTCATCGACATGCCTCGCCTTCTCGGAGCTGTTCAGCGACTGTATCCGCAACT
GAGCCCTGCGGACGCTCTTCGCAACAGCACGGGCCGAGATGTTCTACTGTTCGCCGATAGCCATGAGAGCTTGTA
CAACGAGGTCTCAACCAGGTTTTATTCGAAACGCCAGGGCGCATCCAAGTTTAAAGTTGGCGCTGCCACCAGCGA
CGGCCTCATCGGAAAGCTCGAGAAGCGAGATGACTACGTTCCCCATGGGATGTTGCGATATCCCCTAGAGAGGAA
CGCCATGCCAGACTTGGACTATGATCGCTCAATGAGGTAAGTAATCTTCAGCGTCTTGTGGAATGATGCTGTGCT
GATTTTACATTACAGCGTTTACTATGACATGCCCGCATCACACCTGGCTCATAAATCCATGCTTTTGCGAGGCGC
TCAGCTGCCCCCACCAGTCCTGACAAGAAGTGACATTGAGGTGATCAGGGGCAGGGCTACCAGACATGGTCGGAA
CTATGGTGGACCTCCGCCAGATAGAGTCGATGCCTGGCGTGGACAAGGTAAGCCACGTCCGCGTGTCTGGGCAGA
TGCCACGCTTGGCCGCTAATAGTACCATAAAAGCCAACAGACCTCCGGGCCGGGGACAATTTCCCCCTCGCTTGG
CCAATTCCAGGGGCGAGGCACCAAACTTTCCTCCCAAGGCGTACCGGGGTGGCGGTTGGACTCAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail