Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7587
Gene name
LocationContig_985:282..4907
Strand+
Gene length (bp)4625
Transcript length (bp)3891
Coding sequence length (bp)3891
Protein length (aa) 1297

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09763 Sec3_C Exocyst complex component Sec3 2.4E-168 724 1286
PF15277 Sec3-PIP2_bind Exocyst complex component SEC3 N-terminal PIP2 binding PH 5.2E-29 181 276
PF03576 Peptidase_S58 Peptidase family S58 7.5E-09 16 57

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P33332|SEC3_YEAST Exocyst complex component SEC3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC3 PE=1 SV=1 118 356 7.0E-25
sp|P33332|SEC3_YEAST Exocyst complex component SEC3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC3 PE=1 SV=1 761 1218 3.0E-17
sp|Q9SX86|SEC3B_ARATH Exocyst complex component SEC3B OS=Arabidopsis thaliana GN=SEC3B PE=2 SV=1 730 1282 1.0E-16
sp|Q9SX85|SEC3A_ARATH Exocyst complex component SEC3A OS=Arabidopsis thaliana GN=SEC3A PE=1 SV=1 730 1282 4.0E-16
sp|Q9NV70|EXOC1_HUMAN Exocyst complex component 1 OS=Homo sapiens GN=EXOC1 PE=1 SV=4 750 1280 4.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P33332|SEC3_YEAST Exocyst complex component SEC3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC3 PE=1 SV=1 118 356 7.0E-25
sp|P33332|SEC3_YEAST Exocyst complex component SEC3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC3 PE=1 SV=1 761 1218 3.0E-17
sp|Q9SX86|SEC3B_ARATH Exocyst complex component SEC3B OS=Arabidopsis thaliana GN=SEC3B PE=2 SV=1 730 1282 1.0E-16
sp|Q9SX85|SEC3A_ARATH Exocyst complex component SEC3A OS=Arabidopsis thaliana GN=SEC3A PE=1 SV=1 730 1282 4.0E-16
sp|Q9NV70|EXOC1_HUMAN Exocyst complex component 1 OS=Homo sapiens GN=EXOC1 PE=1 SV=4 750 1280 4.0E-13
sp|Q8R3S6|EXOC1_MOUSE Exocyst complex component 1 OS=Mus musculus GN=Exoc1 PE=1 SV=4 750 1280 1.0E-11
sp|Q9VVG4|EXOC1_DROME Exocyst complex component 1 OS=Drosophila melanogaster GN=Sec3 PE=1 SV=2 750 1282 5.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0006887 exocytosis Yes
GO:0000145 exocyst Yes
GO:0051179 localization No
GO:0016192 vesicle-mediated transport No
GO:0099023 vesicle tethering complex No
GO:0140352 export from cell No
GO:0051234 establishment of localization No
GO:0009987 cellular process No
GO:0046903 secretion No
GO:0006810 transport No
GO:0005575 cellular_component No
GO:0008150 biological_process No
GO:0032940 secretion by cell No
GO:0032991 protein-containing complex No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3531
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7757
Ophiocordyceps australis map64 (Brazil) OphauB2|875
Ophiocordyceps camponoti-floridani Ophcf2|01379
Ophiocordyceps camponoti-rufipedis Ophun1|7587 (this protein)
Ophiocordyceps kimflemingae Ophio5|5494
Ophiocordyceps subramaniannii Hirsu2|6775

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7587
MPPVGRSDEDAPRARVTQMTDNDSMNGLFDAAADAVEESIYNALFMAETMTGFKGRTIEALDLDKAPSLCLSKDH
DFSLVARPRSAHHRTGATSASAGSSQAFLDGILQRYVPMDRVNGASAATSRAERFEDEKRRIIESCFNKREADGS
LIETYITHIRITEYSQHPSTPPPPEARTPDSEKPRVIIVAVRRSGRVRMHKSKENTSGTFSIGKTWNLDDLSQIE
SFTGPQVGLSYREWAGDTGFVVTLGKPYFWQAQTDKEKKFFIASLVKIFGKYTGGKTPELTGFDPKELDQVLGAG
RRPTAVSARSPGVESVASSVASPSGLAPTSSSGTPEPSRFQKASVTRPPNGTGSPALSSDSISSRDRVVAARRRG
QDAEASSFGSRRDDGSNAPRSRNGIIGPAGASTRYGESRESPEQLHDVHARPPSSQQEERPPPERRRPPMDPSRP
QDRDLVPPPLVSPVVSREFLPPPSKSKRRPSDGMDDGPVRSLGVPREHAAAAASYTNTSEVSPKPELIRGASAAS
GSPVTEAISPIEVSPAPDASHQDESRPGLGPMIKAKRSKGDIAGALWKAASAATAFRPRPGGAGDRLRQTQGKGV
GPDGITSVVPAPSRPVSRDPRSETPDTPKAADRDSNALKVDDLPSRRGSTQPSPKEEKKKEPKKQEQKKEEEVAR
SVVAGNDVKYLQSLGIDSSVLDGRSEEFAKWLDYFGWVPGQQMRTQTLDDIKPDIERELNRAQAGGWLARFEEED
ERVAAIKRGIDQAIAECDEMDNLLTLYAVELSTLSEDISYIEAQGQGLQVQTANQKLLRRELESLLETCAITHRD
LEALQIAPLDMTRGLEEVESALVTLFRAMVKMDPTLRGHEPAQATSGAKADGDSDQVLGLNSDYGNMRIVQEKKQ
MYMEESHQFMQRLVDFMSKQFDDVFSKTERCLEGATTKTGDASCYDAGRDLLWRYSPLMLYARDVEMEQWETLLL
VYQRKSHPLYMSQVQNMAAVLRRDARRPTGDEADLLFSSQADKNQEGGVATTARKLTVKRSQTLAKALRSPLEGR
ATPTGAGDKANREGGCLPYEVLSRALDDVLPLVEMEQNFIIDFFHATTLEQVDFPDAVAACSPSDRQGGDLRRHR
LMEPDRERARRVTRMMEEIFGFLEGELQRLMEWVVSQDPLQGVGVLAVLERKSQEMSQSNQEFVHNLLGKLHSLL
EQRFNKFVDEQIRAIEEIKVKVKKRRGVISFIRVFPAFSSAVENMMAGQGATVGLRRLVNLQYERLLKTMFDSLM
VIAREHPAAGGANAGDGDARA*
Coding >Ophun1|7587
ATGCCGCCCGTGGGAAGATCCGACGAAGACGCTCCCCGGGCTCGTGTCACGCAGATGACAGATAACGACTCCATG
AACGGTCTATTTGACGCCGCGGCTGACGCCGTCGAGGAATCCATCTATAACGCTCTCTTCATGGCCGAGACCATG
ACGGGGTTCAAGGGCAGGACCATCGAGGCGCTCGACCTGGACAAGGCCCCAAGCCTCTGCCTCAGTAAAGACCAC
GACTTCAGCCTTGTCGCTCGCCCTCGCAGCGCGCACCACAGGACCGGTGCCACCAGCGCCTCGGCCGGTTCGTCG
CAGGCGTTTCTTGATGGTATTCTCCAGCGCTACGTCCCGATGGACCGCGTCAACGGAGCATCGGCCGCCACATCG
CGGGCGGAGCGCTTCGAGGATGAAAAACGCCGAATCATCGAAAGCTGCTTCAACAAGAGGGAGGCCGACGGTTCG
CTCATCGAGACATACATCACCCACATTCGAATCACCGAATACTCCCAACATCCTTCGACGCCGCCGCCGCCAGAG
GCGCGAACCCCCGACTCAGAGAAGCCGCGGGTCATCATCGTGGCCGTCCGCAGATCGGGCCGCGTGCGAATGCAC
AAGTCCAAGGAAAACACCTCTGGCACCTTTTCCATAGGCAAGACATGGAACCTCGACGACCTCAGCCAGATCGAA
TCCTTCACCGGGCCCCAGGTCGGCCTCAGCTACCGCGAATGGGCTGGCGACACGGGCTTCGTTGTCACGTTGGGG
AAGCCCTACTTCTGGCAGGCTCAGACGGACAAGGAGAAGAAGTTCTTCATTGCTAGCCTCGTCAAGATCTTTGGG
AAATACACGGGCGGGAAAACTCCTGAGCTGACTGGGTTCGATCCGAAGGAGCTCGACCAGGTTCTGGGTGCCGGC
CGCCGCCCGACTGCCGTCTCGGCGCGGTCGCCGGGCGTCGAGTCGGTGGCTTCGTCGGTGGCATCGCCCTCAGGT
CTCGCTCCCACGTCTTCTTCAGGCACGCCGGAGCCGTCGCGTTTTCAGAAGGCGTCCGTCACTCGGCCTCCGAAC
GGGACTGGCTCCCCAGCCTTGAGCTCCGATTCCATCTCCTCGAGGGATCGAGTGGTTGCCGCTCGGCGCAGAGGC
CAGGATGCCGAGGCGAGCTCTTTCGGATCGAGACGCGATGACGGCAGCAACGCGCCCCGTTCTCGAAATGGCATC
ATCGGCCCTGCCGGCGCATCGACACGGTACGGCGAGTCGCGCGAATCCCCGGAGCAGCTTCACGATGTCCACGCC
CGTCCACCCTCGTCGCAACAGGAGGAGCGGCCGCCTCCGGAGAGGCGAAGACCACCCATGGATCCGTCTCGTCCC
CAGGACCGGGACCTAGTCCCGCCGCCACTGGTGAGCCCCGTCGTCTCGAGAGAATTCCTCCCGCCGCCCTCAAAG
AGCAAGAGGCGTCCATCCGATGGCATGGATGACGGCCCCGTTCGGTCTTTGGGCGTGCCAAGGGAACATGCAGCA
GCAGCAGCCTCGTATACTAACACATCGGAGGTGTCTCCCAAGCCAGAACTGATCCGCGGCGCCAGCGCAGCCTCG
GGCTCGCCCGTAACCGAGGCCATCTCGCCGATAGAGGTGTCGCCCGCCCCAGATGCCTCTCATCAAGACGAATCT
CGACCCGGACTCGGTCCCATGATCAAAGCCAAACGCTCCAAGGGCGACATCGCCGGCGCGCTGTGGAAAGCCGCC
TCGGCAGCGACTGCTTTCCGCCCACGGCCAGGCGGTGCGGGAGATCGCCTCCGTCAGACGCAGGGCAAGGGGGTC
GGTCCTGATGGCATCACGAGCGTCGTGCCGGCGCCCTCGCGACCTGTCTCCCGCGACCCGAGATCGGAAACGCCG
GATACGCCCAAGGCGGCCGATCGAGATTCTAACGCCCTCAAGGTCGATGACTTGCCCAGCCGAAGAGGAAGCACT
CAGCCGTCGCCAAAGGAGGAGAAGAAGAAGGAACCGAAGAAGCAGGAACAGAAGAAGGAGGAAGAAGTGGCGCGG
TCAGTCGTCGCAGGCAACGATGTCAAATACCTTCAGTCGCTCGGCATCGATTCGAGCGTCTTGGACGGCAGAAGC
GAGGAGTTTGCAAAGTGGCTGGATTATTTCGGCTGGGTACCTGGTCAACAGATGCGGACGCAAACCCTGGACGAC
ATCAAGCCAGACATTGAGCGGGAGCTCAACAGGGCACAGGCCGGCGGCTGGCTTGCCCGTTTCGAGGAGGAGGAT
GAGCGAGTGGCCGCCATCAAGCGCGGCATCGACCAAGCCATTGCAGAATGCGATGAGATGGATAACCTACTCACT
CTATACGCGGTCGAACTATCGACGCTTTCCGAAGATATATCGTACATTGAGGCCCAGGGGCAGGGCCTCCAGGTG
CAGACGGCTAACCAGAAACTGCTCCGGCGAGAGCTCGAATCTCTTCTCGAGACGTGCGCCATCACACACCGCGAT
CTCGAGGCGCTGCAGATTGCGCCGCTGGACATGACGCGCGGGCTGGAAGAGGTTGAGTCGGCTCTGGTGACGCTG
TTCAGAGCCATGGTAAAGATGGATCCGACGCTCAGGGGCCACGAGCCTGCTCAGGCGACGTCAGGGGCCAAGGCC
GACGGTGACTCAGACCAGGTCCTCGGACTCAACAGCGATTACGGCAACATGAGAATCGTGCAGGAGAAGAAGCAG
ATGTACATGGAAGAGAGCCACCAGTTCATGCAGCGGCTGGTCGACTTCATGAGCAAGCAGTTCGACGATGTCTTT
TCCAAGACGGAGCGTTGTCTGGAGGGCGCCACGACCAAGACGGGCGACGCGTCCTGCTACGACGCCGGCAGGGAC
TTGCTGTGGAGATATAGCCCGCTGATGCTCTACGCCCGGGACGTGGAAATGGAGCAGTGGGAGACGCTGCTGCTT
GTCTACCAGAGGAAGAGTCACCCGCTGTACATGAGCCAGGTTCAGAACATGGCGGCTGTACTGCGACGCGATGCG
CGGAGGCCGACGGGGGATGAGGCCGATCTCCTCTTCTCGTCGCAGGCGGACAAGAACCAGGAAGGCGGGGTGGCG
ACGACGGCACGCAAACTGACGGTCAAGAGGAGCCAGACGCTGGCCAAGGCGCTGCGGTCGCCTCTGGAAGGGCGG
GCGACGCCGACGGGGGCGGGCGACAAGGCGAACCGCGAGGGCGGCTGCCTCCCGTACGAGGTGCTCTCGAGGGCG
CTGGACGACGTGCTGCCGCTGGTCGAGATGGAGCAGAACTTCATCATCGACTTCTTCCACGCGACGACGCTGGAG
CAGGTCGACTTTCCCGACGCGGTGGCGGCCTGCTCGCCGAGCGACAGGCAGGGGGGGGATCTCCGGCGGCATCGT
CTTATGGAGCCGGACCGCGAGCGGGCGAGGAGGGTGACGCGCATGATGGAGGAGATATTCGGCTTTCTCGAGGGG
GAGCTGCAGAGGCTGATGGAGTGGGTGGTGTCTCAAGATCCGCTGCAAGGGGTTGGCGTGCTCGCCGTGCTGGAG
AGAAAGTCTCAGGAAATGAGCCAGTCGAACCAAGAGTTCGTCCACAATCTGCTTGGGAAACTTCACAGCCTGTTG
GAGCAGCGGTTTAACAAATTCGTTGACGAGCAAATCCGGGCCATCGAGGAGATCAAGGTCAAGGTCAAGAAGCGC
AGAGGAGTCATCTCCTTCATCCGCGTCTTCCCCGCCTTCTCATCGGCCGTCGAGAACATGATGGCCGGACAGGGG
GCGACGGTGGGTCTGCGACGACTGGTGAATTTGCAGTACGAGCGGTTGCTCAAGACCATGTTCGACTCGCTCATG
GTGATTGCGCGGGAGCATCCAGCCGCGGGAGGGGCCAACGCGGGAGACGGAGACGCGCGGGCTTGA
Transcript >Ophun1|7587
ATGCCGCCCGTGGGAAGATCCGACGAAGACGCTCCCCGGGCTCGTGTCACGCAGATGACAGATAACGACTCCATG
AACGGTCTATTTGACGCCGCGGCTGACGCCGTCGAGGAATCCATCTATAACGCTCTCTTCATGGCCGAGACCATG
ACGGGGTTCAAGGGCAGGACCATCGAGGCGCTCGACCTGGACAAGGCCCCAAGCCTCTGCCTCAGTAAAGACCAC
GACTTCAGCCTTGTCGCTCGCCCTCGCAGCGCGCACCACAGGACCGGTGCCACCAGCGCCTCGGCCGGTTCGTCG
CAGGCGTTTCTTGATGGTATTCTCCAGCGCTACGTCCCGATGGACCGCGTCAACGGAGCATCGGCCGCCACATCG
CGGGCGGAGCGCTTCGAGGATGAAAAACGCCGAATCATCGAAAGCTGCTTCAACAAGAGGGAGGCCGACGGTTCG
CTCATCGAGACATACATCACCCACATTCGAATCACCGAATACTCCCAACATCCTTCGACGCCGCCGCCGCCAGAG
GCGCGAACCCCCGACTCAGAGAAGCCGCGGGTCATCATCGTGGCCGTCCGCAGATCGGGCCGCGTGCGAATGCAC
AAGTCCAAGGAAAACACCTCTGGCACCTTTTCCATAGGCAAGACATGGAACCTCGACGACCTCAGCCAGATCGAA
TCCTTCACCGGGCCCCAGGTCGGCCTCAGCTACCGCGAATGGGCTGGCGACACGGGCTTCGTTGTCACGTTGGGG
AAGCCCTACTTCTGGCAGGCTCAGACGGACAAGGAGAAGAAGTTCTTCATTGCTAGCCTCGTCAAGATCTTTGGG
AAATACACGGGCGGGAAAACTCCTGAGCTGACTGGGTTCGATCCGAAGGAGCTCGACCAGGTTCTGGGTGCCGGC
CGCCGCCCGACTGCCGTCTCGGCGCGGTCGCCGGGCGTCGAGTCGGTGGCTTCGTCGGTGGCATCGCCCTCAGGT
CTCGCTCCCACGTCTTCTTCAGGCACGCCGGAGCCGTCGCGTTTTCAGAAGGCGTCCGTCACTCGGCCTCCGAAC
GGGACTGGCTCCCCAGCCTTGAGCTCCGATTCCATCTCCTCGAGGGATCGAGTGGTTGCCGCTCGGCGCAGAGGC
CAGGATGCCGAGGCGAGCTCTTTCGGATCGAGACGCGATGACGGCAGCAACGCGCCCCGTTCTCGAAATGGCATC
ATCGGCCCTGCCGGCGCATCGACACGGTACGGCGAGTCGCGCGAATCCCCGGAGCAGCTTCACGATGTCCACGCC
CGTCCACCCTCGTCGCAACAGGAGGAGCGGCCGCCTCCGGAGAGGCGAAGACCACCCATGGATCCGTCTCGTCCC
CAGGACCGGGACCTAGTCCCGCCGCCACTGGTGAGCCCCGTCGTCTCGAGAGAATTCCTCCCGCCGCCCTCAAAG
AGCAAGAGGCGTCCATCCGATGGCATGGATGACGGCCCCGTTCGGTCTTTGGGCGTGCCAAGGGAACATGCAGCA
GCAGCAGCCTCGTATACTAACACATCGGAGGTGTCTCCCAAGCCAGAACTGATCCGCGGCGCCAGCGCAGCCTCG
GGCTCGCCCGTAACCGAGGCCATCTCGCCGATAGAGGTGTCGCCCGCCCCAGATGCCTCTCATCAAGACGAATCT
CGACCCGGACTCGGTCCCATGATCAAAGCCAAACGCTCCAAGGGCGACATCGCCGGCGCGCTGTGGAAAGCCGCC
TCGGCAGCGACTGCTTTCCGCCCACGGCCAGGCGGTGCGGGAGATCGCCTCCGTCAGACGCAGGGCAAGGGGGTC
GGTCCTGATGGCATCACGAGCGTCGTGCCGGCGCCCTCGCGACCTGTCTCCCGCGACCCGAGATCGGAAACGCCG
GATACGCCCAAGGCGGCCGATCGAGATTCTAACGCCCTCAAGGTCGATGACTTGCCCAGCCGAAGAGGAAGCACT
CAGCCGTCGCCAAAGGAGGAGAAGAAGAAGGAACCGAAGAAGCAGGAACAGAAGAAGGAGGAAGAAGTGGCGCGG
TCAGTCGTCGCAGGCAACGATGTCAAATACCTTCAGTCGCTCGGCATCGATTCGAGCGTCTTGGACGGCAGAAGC
GAGGAGTTTGCAAAGTGGCTGGATTATTTCGGCTGGGTACCTGGTCAACAGATGCGGACGCAAACCCTGGACGAC
ATCAAGCCAGACATTGAGCGGGAGCTCAACAGGGCACAGGCCGGCGGCTGGCTTGCCCGTTTCGAGGAGGAGGAT
GAGCGAGTGGCCGCCATCAAGCGCGGCATCGACCAAGCCATTGCAGAATGCGATGAGATGGATAACCTACTCACT
CTATACGCGGTCGAACTATCGACGCTTTCCGAAGATATATCGTACATTGAGGCCCAGGGGCAGGGCCTCCAGGTG
CAGACGGCTAACCAGAAACTGCTCCGGCGAGAGCTCGAATCTCTTCTCGAGACGTGCGCCATCACACACCGCGAT
CTCGAGGCGCTGCAGATTGCGCCGCTGGACATGACGCGCGGGCTGGAAGAGGTTGAGTCGGCTCTGGTGACGCTG
TTCAGAGCCATGGTAAAGATGGATCCGACGCTCAGGGGCCACGAGCCTGCTCAGGCGACGTCAGGGGCCAAGGCC
GACGGTGACTCAGACCAGGTCCTCGGACTCAACAGCGATTACGGCAACATGAGAATCGTGCAGGAGAAGAAGCAG
ATGTACATGGAAGAGAGCCACCAGTTCATGCAGCGGCTGGTCGACTTCATGAGCAAGCAGTTCGACGATGTCTTT
TCCAAGACGGAGCGTTGTCTGGAGGGCGCCACGACCAAGACGGGCGACGCGTCCTGCTACGACGCCGGCAGGGAC
TTGCTGTGGAGATATAGCCCGCTGATGCTCTACGCCCGGGACGTGGAAATGGAGCAGTGGGAGACGCTGCTGCTT
GTCTACCAGAGGAAGAGTCACCCGCTGTACATGAGCCAGGTTCAGAACATGGCGGCTGTACTGCGACGCGATGCG
CGGAGGCCGACGGGGGATGAGGCCGATCTCCTCTTCTCGTCGCAGGCGGACAAGAACCAGGAAGGCGGGGTGGCG
ACGACGGCACGCAAACTGACGGTCAAGAGGAGCCAGACGCTGGCCAAGGCGCTGCGGTCGCCTCTGGAAGGGCGG
GCGACGCCGACGGGGGCGGGCGACAAGGCGAACCGCGAGGGCGGCTGCCTCCCGTACGAGGTGCTCTCGAGGGCG
CTGGACGACGTGCTGCCGCTGGTCGAGATGGAGCAGAACTTCATCATCGACTTCTTCCACGCGACGACGCTGGAG
CAGGTCGACTTTCCCGACGCGGTGGCGGCCTGCTCGCCGAGCGACAGGCAGGGGGGGGATCTCCGGCGGCATCGT
CTTATGGAGCCGGACCGCGAGCGGGCGAGGAGGGTGACGCGCATGATGGAGGAGATATTCGGCTTTCTCGAGGGG
GAGCTGCAGAGGCTGATGGAGTGGGTGGTGTCTCAAGATCCGCTGCAAGGGGTTGGCGTGCTCGCCGTGCTGGAG
AGAAAGTCTCAGGAAATGAGCCAGTCGAACCAAGAGTTCGTCCACAATCTGCTTGGGAAACTTCACAGCCTGTTG
GAGCAGCGGTTTAACAAATTCGTTGACGAGCAAATCCGGGCCATCGAGGAGATCAAGGTCAAGGTCAAGAAGCGC
AGAGGAGTCATCTCCTTCATCCGCGTCTTCCCCGCCTTCTCATCGGCCGTCGAGAACATGATGGCCGGACAGGGG
GCGACGGTGGGTCTGCGACGACTGGTGAATTTGCAGTACGAGCGGTTGCTCAAGACCATGTTCGACTCGCTCATG
GTGATTGCGCGGGAGCATCCAGCCGCGGGAGGGGCCAACGCGGGAGACGGAGACGCGCGGGCTTGA
Gene >Ophun1|7587
ATGCCGCCCGTGGGAAGATCCGACGAAGACGCTCCCCGGGCTCGTGTCACGCAGATGACAGATAACGACTCCATG
AACGGTCTATTTGACGCCGCGGCTGACGCCGTCGAGGAATCCATCTATAACGCTCTCTTCATGGCCGAGACCATG
ACGGGGTTCAAGGGCAGGACCATCGAGGCGCTCGACCTGGACAAGGTGAGGGAGATCATGGCCGGGCGTGATGGT
GCGGTCCGGTCGTTCTTGTAGCTGGCTTCTGGAGCGAAGTCGAGTTGCATCAAGGCTCTGTTGTGGGAGAGAAGA
AGATTGAGGAGAGAGACAAATGGACCAAACGAGTCGTTGCCCCGGAACAGCTTCCATCCGACGCCGACGACCAAT
GATGTAGCTCCTCGGTACTGCTGTTCTTGGCAGCTAGAATTGACCAAGATACTACCGTAGCAGAGGAAACCGGTG
TCGCTTGTTCGAGCTGCCACAAATACTATCCGCGGCTTATCCGCTTATTTGGGCCCACCTGCCGCTTACTTGAAC
ATGATGCGTGCGAGACACCTAGGTACTTACCTACCTAGGTACGAAGTACCCTATAGCAGAAATCCCCCTCTAGGC
CCCAAGCCTCTGCCTCAGTAAAGACCACGACTTCAGCCTTGTCGCTCGCCCTCGCAGCGCGCACCACAGGACCGG
TGCCACCAGCGCCTCGGCCGGTTCGTCGCAGGCGTTTCTTGATGGTATTCTCCAGCGCTACGTCCCGATGGACCG
CGTCAACGGAGCATCGGCCGCCACATCGCGGGCGGAGCGCTTCGAGGATGAAAAACGCCGAATCATCGAAAGCTG
CTTCAACAAGAGGGAGGCCGACGGTTCGCGTACGTCGCCCGCCTTCCCTCTTCACTAGCTGCTTTATAAGCACCT
CTCACGACTCTCTAATGCTGTCCTTGAGAGACCTCGTCCGAGGAAGAGGCTGACCAGTCCCGTCTTCCACGCAGT
CATCGAGACATACATCACCCACATTCGAATCACCGAATACTCCCAACATCCTTCGACGCCGCCGCCGCCAGAGGC
GCGAACCCCCGACTCAGAGAAGCCGCGGGTCATCATCGTGGCCGTCCGCAGATCGGGCCGCGTGCGAATGCACAA
GTCCAAGGAAAACACCTCTGGCACCTTTTCCATAGGCAAGACATGGAACCTCGACGACCTCAGCCAGATCGAATC
CTTCACCGGGCCCCAGGTCGGCCTCAGCTACCGCGAATGGGCTGGCGACACGGGCTTCGTTGTCACGTTGGGGAA
GCCCTACTTCTGGCAGGCTCAGACGGACAAGGAGAAGAAGTTCTTCATTGCTAGCCTCGTCAAGATCTTTGGGAA
ATACACGGGCGGGAAAACTCCTGAGCTGACTGGGTTCGATCCGAAGGAGCTCGACCAGGTTCTGGGTGCCGGCCG
CCGCCCGACTGCCGTCTCGGCGCGGTCGCCGGGCGTCGAGTCGGTGGCTTCGTCGGTGGCATCGCCCTCAGGTCT
CGCTCCCACGTCTTCTTCAGGCACGCCGGAGCCGTCGCGTTTTCAGAAGGCGTCCGTCACTCGGCCTCCGAACGG
GACTGGCTCCCCAGCCTTGAGCTCCGATTCCATCTCCTCGAGGGATCGAGTGGTTGCCGCTCGGCGCAGAGGCCA
GGATGCCGAGGCGAGCTCTTTCGGATCGAGACGCGATGACGGCAGCAACGCGCCCCGTTCTCGAAATGGCATCAT
CGGCCCTGCCGGCGCATCGACACGGTACGGCGAGTCGCGCGAATCCCCGGAGCAGCTTCACGATGTCCACGCCCG
TCCACCCTCGTCGCAACAGGAGGAGCGGCCGCCTCCGGAGAGGCGAAGACCACCCATGGATCCGTCTCGTCCCCA
GGACCGGGACCTAGTCCCGCCGCCACTGGTGAGCCCCGTCGTCTCGAGAGAATTCCTCCCGCCGCCCTCAAAGAG
CAAGAGGCGTCCATCCGATGGCATGGATGACGGCCCCGTTCGGTCTTTGGGCGTGCCAAGGGAACATGCAGCAGC
AGCAGCCTCGTATACTAACACATCGGAGGTGTCTCCCAAGCCAGAACTGATCCGCGGCGCCAGCGCAGCCTCGGG
CTCGCCCGTAACCGAGGCCATCTCGCCGATAGAGGTGTCGCCCGCCCCAGATGCCTCTCATCAAGACGAATCTCG
ACCCGGACTCGGTCCCATGATCAAAGCCAAACGCTCCAAGGGCGACATCGCCGGCGCGCTGTGGAAAGCCGCCTC
GGCAGCGACTGCTTTCCGCCCACGGCCAGGCGGTGCGGGAGATCGCCTCCGTCAGACGCAGGGCAAGGGGGTCGG
TCCTGATGGCATCACGAGCGTCGTGCCGGCGCCCTCGCGACCTGTCTCCCGCGACCCGAGATCGGAAACGCCGGA
TACGCCCAAGGCGGCCGATCGAGATTCTAACGCCCTCAAGGTCGATGACTTGCCCAGCCGAAGAGGAAGCACTCA
GCCGTCGCCAAAGGAGGAGAAGAAGAAGGAACCGAAGAAGCAGGAACAGAAGAAGGAGGAAGAAGTGGCGCGGTC
AGTCGTCGCAGGCAACGATGTCAAATACCTTCAGTCGCTCGGCATCGATTCGAGCGTCTTGGACGGCAGAAGCGA
GGAGTTTGCAAAGTGGCTGGATTATTTCGGCTGGGTACCTGGTCAACAGATGCGGACGCAAACCCTGGACGACAT
CAAGCCAGACATTGAGCGGGAGCTCAACAGGGCACAGGCCGGCGGCTGGCTTGCCCGTTTCGAGGAGGAGGATGA
GCGAGTGGCCGCCATCAAGCGCGGCATCGACCAAGCCATTGCAGAATGCGATGAGATGGATAACCTACTCACTCT
ATACGCGGTCGAACTATCGGTAAGTTGCGCGAGTGGCGAAGCCCAGGCGGGACGCTGGCTGACAGACGTCGCAGA
CGCTTTCCGAAGATATATCGTACATTGAGGCCCAGGGGCAGGGCCTCCAGGTGCAGACGGCTAACCAGAAACTGC
TCCGGCGAGAGCTCGAATCTCTTCTCGAGACGTGCGCCATCACACACCGCGATCTCGAGGCGCTGCAGATTGCGC
CGCTGGACATGACGCGCGGGCTGGAAGAGGTTGAGTCGGCTCTGGTGACGCTGTTCAGAGCCATGGTAAAGATGG
ATCCGACGCTCAGGGGCCACGAGCCTGCTCAGGCGACGTCAGGGGCCAAGGCCGACGGTGACTCAGACCAGGTCC
TCGGACTCAACAGCGATTACGGCAACATGAGAATCGTGCAGGAGAAGAAGCAGATGTACATGGAAGAGAGCCACC
AGTTCATGCAGCGGCTGGTCGACTTCATGAGCAAGCAGTTCGACGATGTCTTTTCCAAGACGGAGCGTTGTCTGG
AGGGCGCCACGACCAAGACGGGCGACGCGTCCTGCTACGACGCCGGCAGGGACTTGCTGTGGAGATATAGCCCGC
TGATGCTCTACGCCCGGGACGTGGAAATGGAGCAGTGGGAGACGCTGCTGCTTGTCTACCAGAGGAAGAGTCACC
CGCTGTACATGAGCCAGGTTCAGAACATGGCGGCTGTACTGCGACGCGATGCGCGGAGGCCGACGGGGGATGAGG
CCGATCTCCTCTTCTCGTCGCAGGCGGACAAGAACCAGGAAGGCGGGGTGGCGACGACGGCACGCAAACTGACGG
TCAAGAGGAGCCAGACGCTGGCCAAGGCGCTGCGGTCGCCTCTGGAAGGGCGGGCGACGCCGACGGGGGCGGGCG
ACAAGGCGAACCGCGAGGGCGGCTGCCTCCCGTACGAGGTGCTCTCGAGGGCGCTGGACGACGTGCTGCCGCTGG
TCGAGATGGAGCAGAACTTCATCATCGACTTCTTCCACGCGACGACGCTGGAGCAGGTCGACTTTCCCGACGCGG
TGGCGGCCTGCTCGCCGAGCGACAGGCAGGGGGGGGATCTCCGGCGGCATCGTCTTATGGAGCCGGACCGCGAGC
GGGCGAGGAGGGTGACGCGCATGATGGAGGAGATATTCGGCTTTCTCGAGGGGGAGCTGCAGAGGCTGATGGAGT
GGGTGGTGTCTCAAGATCCGCTGTAAGCACACAGTCCGCTCTGCTTCTTGTTACTTGTTGTTTCTTCCCTTCTTT
CTTTGCGAGAGCTGACGACGGGAGAACAGGCAAGGGGTTGGCGTGCTCGCCGTGCTGGAGAGAAAGTCTCAGGAA
ATGAGCCAGTCGAACCAAGAGTTCGTCCACAATCTGCTTGGGAAACTTCACAGCCTGTTGGAGCAGCGGTTTAAC
AAATTCGTTGACGAGCAAATCCGGGCCATCGAGGAGATCAAGGTCAAGGTCAAGAAGCGCAGAGGAGTCATCTCC
TTCATCCGCGTCTTCCCCGCCTTCTCATCGGCCGTCGAGAACATGATGGCCGGACAGGGGGCGACGGTGGGTCTG
CGACGACTGGTGAATTTGCAGTACGAGCGGTTGCTCAAGACCATGTTCGACTCGCTCATGGTGATTGCGCGGGAG
CATCCAGCCGCGGGAGGGGCCAACGCGGGTGGCGACGCCGAAGACAAGGAGGCGCTCAACTCTCACATCCTCATC
ATCGAGAACATGAACCACTTCATCGAGGAGACGGAGACGCGCGGGCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail