Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7586
Gene name
LocationContig_984:2219..4350
Strand-
Gene length (bp)2131
Transcript length (bp)2079
Coding sequence length (bp)2079
Protein length (aa) 693

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00069 Pkinase Protein kinase domain 9.0E-29 62 362
PF07714 PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase 1.4E-17 63 276

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P27636|CDC15_YEAST Cell division control protein 15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC15 PE=1 SV=3 65 268 7.0E-15
sp|Q9SY89|Y1661_ARATH Putative G-type lectin S-receptor-like serine/threonine-protein kinase At1g61610 OS=Arabidopsis thaliana GN=At1g61610 PE=3 SV=1 45 351 1.0E-14
sp|A1A5Q6|SMK_RAT Sperm motility kinase OS=Rattus norvegicus GN=Smok PE=2 SV=1 63 276 8.0E-14
sp|A8X0C4|PAR4_CAEBR Serine/threonine-protein kinase par-4 OS=Caenorhabditis briggsae GN=par-4 PE=3 SV=2 21 279 2.0E-12
sp|O65468|CRK8_ARATH Cysteine-rich receptor-like protein kinase 8 OS=Arabidopsis thaliana GN=CRK8 PE=3 SV=2 66 352 4.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P27636|CDC15_YEAST Cell division control protein 15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC15 PE=1 SV=3 65 268 7.0E-15
sp|Q9SY89|Y1661_ARATH Putative G-type lectin S-receptor-like serine/threonine-protein kinase At1g61610 OS=Arabidopsis thaliana GN=At1g61610 PE=3 SV=1 45 351 1.0E-14
sp|A1A5Q6|SMK_RAT Sperm motility kinase OS=Rattus norvegicus GN=Smok PE=2 SV=1 63 276 8.0E-14
sp|A8X0C4|PAR4_CAEBR Serine/threonine-protein kinase par-4 OS=Caenorhabditis briggsae GN=par-4 PE=3 SV=2 21 279 2.0E-12
sp|O65468|CRK8_ARATH Cysteine-rich receptor-like protein kinase 8 OS=Arabidopsis thaliana GN=CRK8 PE=3 SV=2 66 352 4.0E-12
sp|O65479|CRK20_ARATH Putative cysteine-rich receptor-like protein kinase 20 OS=Arabidopsis thaliana GN=CRK20 PE=2 SV=2 63 351 9.0E-12
sp|Q9LJD8|M3KE1_ARATH MAP3K epsilon protein kinase 1 OS=Arabidopsis thaliana GN=M3KE1 PE=1 SV=1 53 278 1.0E-11
sp|Q9ZP16|CRK11_ARATH Cysteine-rich receptor-like protein kinase 11 OS=Arabidopsis thaliana GN=CRK11 PE=2 SV=2 58 352 1.0E-11
sp|Q9C5S9|CRK6_ARATH Cysteine-rich receptor-like protein kinase 6 OS=Arabidopsis thaliana GN=CRK6 PE=1 SV=1 66 352 2.0E-11
sp|A0A078CGE6|M3KE1_BRANA MAP3K epsilon protein kinase 1 OS=Brassica napus GN=M3KE1 PE=1 SV=1 53 278 4.0E-11
sp|Q8C0X8|SMKX_MOUSE Sperm motility kinase X OS=Mus musculus PE=2 SV=1 63 276 5.0E-11
sp|Q9SFB6|M3KE2_ARATH MAP3K epsilon protein kinase 2 OS=Arabidopsis thaliana GN=MAP3KE2 PE=2 SV=1 53 278 5.0E-11
sp|P9WI67|PKNJ_MYCTU Serine/threonine-protein kinase PknJ OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pknJ PE=1 SV=1 185 276 7.0E-11
sp|P9WI66|PKNJ_MYCTO Serine/threonine-protein kinase PknJ OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pknJ PE=1 SV=1 185 276 7.0E-11
sp|P65733|PKNJ_MYCBO Serine/threonine-protein kinase PknJ OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pknJ PE=3 SV=1 185 276 7.0E-11
sp|Q8GYA4|CRK10_ARATH Cysteine-rich receptor-like protein kinase 10 OS=Arabidopsis thaliana GN=CRK10 PE=1 SV=3 66 352 8.0E-11
sp|O04086|Y1105_ARATH Probable receptor-like protein kinase At1g11050 OS=Arabidopsis thaliana GN=At1g11050 PE=2 SV=1 44 274 9.0E-11
sp|O65483|CRK24_ARATH Cysteine-rich receptor-like protein kinase 24 OS=Arabidopsis thaliana GN=CRK24 PE=3 SV=2 59 351 1.0E-10
sp|P10741|MOS_CHICK Serine/threonine-protein kinase mos OS=Gallus gallus GN=MOS PE=3 SV=1 59 275 2.0E-10
sp|O61847|CDK2_CAEEL Cyclin-dependent kinase 2 OS=Caenorhabditis elegans GN=cdk-2 PE=1 SV=2 58 276 2.0E-10
sp|P00540|MOS_HUMAN Proto-oncogene serine/threonine-protein kinase mos OS=Homo sapiens GN=MOS PE=1 SV=1 63 276 2.0E-10
sp|O65476|CRK16_ARATH Putative cysteine-rich receptor-like protein kinase 16 OS=Arabidopsis thaliana GN=CRK16 PE=3 SV=2 27 351 2.0E-10
sp|Q9C9U2|CDKD1_ARATH Cyclin-dependent kinase D-1 OS=Arabidopsis thaliana GN=CDKD-1 PE=1 SV=1 54 271 3.0E-10
sp|O65482|CRK23_ARATH Putative cysteine-rich receptor-like protein kinase 23 OS=Arabidopsis thaliana GN=CRK23 PE=2 SV=1 63 351 3.0E-10
sp|Q8T2I8|SEPA_DICDI Serine/threonine-protein kinase sepA OS=Dictyostelium discoideum GN=sepA PE=2 SV=1 46 276 3.0E-10
sp|Q9LMT0|CDKD3_ARATH Cyclin-dependent kinase D-3 OS=Arabidopsis thaliana GN=CDKD-3 PE=1 SV=1 54 271 4.0E-10
sp|Q9GN62|PAR4_CAEEL Serine/threonine-protein kinase par-4 OS=Caenorhabditis elegans GN=par-4 PE=1 SV=2 66 279 6.0E-10
sp|P10650|MOS_CHLAE Proto-oncogene serine/threonine-protein kinase mos OS=Chlorocebus aethiops GN=MOS PE=3 SV=1 63 276 6.0E-10
sp|Q9SD62|Y3471_ARATH Putative receptor-like protein kinase At3g47110 OS=Arabidopsis thaliana GN=At3g47110 PE=3 SV=1 58 322 6.0E-10
sp|Q9W739|CDK1_RANDY Cyclin-dependent kinase 1 OS=Rana dybowskii GN=CDK1 PE=2 SV=1 61 276 8.0E-10
sp|Q39030|KPK2_ARATH Serine/threonine-protein kinase AtPK2/AtPK19 OS=Arabidopsis thaliana GN=ATPK2 PE=1 SV=2 63 276 1.0E-09
sp|Q90XV6|MOS_GYMCA Serine/threonine-protein kinase mos (Fragment) OS=Gymnogyps californianus GN=MOS PE=3 SV=1 59 254 1.0E-09
sp|Q9LSL5|LRK92_ARATH L-type lectin-domain containing receptor kinase IX.2 OS=Arabidopsis thaliana GN=LECRK92 PE=2 SV=1 48 276 1.0E-09
sp|A2QHV0|SEPH_ASPNC Cytokinesis protein sepH OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sepH PE=3 SV=1 64 274 1.0E-09
sp|Q97PA9|STKP2_STRPN Serine/threonine-protein kinase StkP OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=stkP PE=1 SV=1 185 276 1.0E-09
sp|Q8DNS0|STKP_STRR6 Serine/threonine-protein kinase StkP OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=stkP PE=1 SV=1 185 276 2.0E-09
sp|Q04J43|STKP_STRP2 Serine/threonine-protein kinase StkP OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=stkP PE=1 SV=1 185 276 2.0E-09
sp|Q8LF80|CKB21_ARATH Cyclin-dependent kinase B2-1 OS=Arabidopsis thaliana GN=CDKB2-1 PE=1 SV=2 178 276 2.0E-09
sp|Q8L4P8|CKB11_ORYSJ Cyclin-dependent kinase B1-1 OS=Oryza sativa subsp. japonica GN=CDKB1-1 PE=2 SV=1 59 271 2.0E-09
sp|Q01389|BCK1_YEAST Serine/threonine-protein kinase BCK1/SLK1/SSP31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BCK1 PE=1 SV=1 62 274 2.0E-09
sp|Q9LDQ3|CRK35_ARATH Putative cysteine-rich receptor-like protein kinase 35 OS=Arabidopsis thaliana GN=CRK35 PE=3 SV=3 59 289 2.0E-09
sp|Q3ULB5|PAK6_MOUSE Serine/threonine-protein kinase PAK 6 OS=Mus musculus GN=Pak6 PE=2 SV=1 66 338 3.0E-09
sp|Q9GRC0|MOS_PATPE Serine/threonine-protein kinase mos OS=Patiria pectinifera GN=mos PE=1 SV=1 189 276 3.0E-09
sp|Q97IC2|PKN2_CLOAB Probable serine/threonine-protein kinase CA_C1728 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=CA_C1728 PE=3 SV=1 189 276 3.0E-09
sp|Q94CU5|NEK5_ORYSJ Serine/threonine-protein kinase Nek5 OS=Oryza sativa subsp. japonica GN=NEK5 PE=3 SV=1 56 275 3.0E-09
sp|Q5E9Y0|CDK2_BOVIN Cyclin-dependent kinase 2 OS=Bos taurus GN=CDK2 PE=2 SV=1 59 276 3.0E-09
sp|Q38774|CDC2C_ANTMA Cell division control protein 2 homolog C OS=Antirrhinum majus GN=CDC2C PE=2 SV=1 160 271 3.0E-09
sp|Q9SIT1|TMK3_ARATH Receptor-like kinase TMK3 OS=Arabidopsis thaliana GN=TMK3 PE=2 SV=1 54 276 3.0E-09
sp|Q9S7I6|RPK2_ARATH LRR receptor-like serine/threonine-protein kinase RPK2 OS=Arabidopsis thaliana GN=RPK2 PE=2 SV=1 48 276 3.0E-09
sp|Q9ESG9|PMYT1_MOUSE Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase OS=Mus musculus GN=Pkmyt1 PE=2 SV=3 42 275 3.0E-09
sp|Q54R98|Y3301_DICDI Probable serine/threonine-protein kinase DDB_G0283301 OS=Dictyostelium discoideum GN=DDB_G0283301 PE=3 SV=1 175 280 4.0E-09
sp|C0LGG6|Y5189_ARATH Probable LRR receptor-like protein kinase At1g51890 OS=Arabidopsis thaliana GN=At1g51890 PE=2 SV=2 65 276 4.0E-09
sp|P48963|CDK2_MESAU Cyclin-dependent kinase 2 OS=Mesocricetus auratus GN=CDK2 PE=2 SV=1 59 276 5.0E-09
sp|Q2NL51|GSK3A_MOUSE Glycogen synthase kinase-3 alpha OS=Mus musculus GN=Gsk3a PE=1 SV=2 63 280 5.0E-09
sp|P9WI83|PKNA_MYCTU Serine/threonine-protein kinase PknA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pknA PE=1 SV=1 185 270 5.0E-09
sp|P9WI82|PKNA_MYCTO Serine/threonine-protein kinase PknA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pknA PE=3 SV=1 185 270 5.0E-09
sp|A5TY85|PKNA_MYCTA Serine/threonine-protein kinase PknA OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=pknA PE=1 SV=1 185 270 5.0E-09
sp|P65727|PKNA_MYCBO Serine/threonine-protein kinase PknA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pknA PE=3 SV=1 185 270 5.0E-09
sp|Q2MHE4|HT1_ARATH Serine/threonine-protein kinase HT1 OS=Arabidopsis thaliana GN=HT1 PE=1 SV=1 60 278 5.0E-09
sp|O55076|CDK2_CRIGR Cyclin-dependent kinase 2 OS=Cricetulus griseus GN=CDK2 PE=2 SV=1 59 276 6.0E-09
sp|Q8L7G3|CRK7_ARATH Cysteine-rich receptor-like protein kinase 7 OS=Arabidopsis thaliana GN=CRK7 PE=2 SV=1 60 352 7.0E-09
sp|P54743|PKNA_MYCLE Serine/threonine-protein kinase PknA OS=Mycobacterium leprae (strain TN) GN=pknA PE=3 SV=3 185 295 7.0E-09
sp|Q63699|CDK2_RAT Cyclin-dependent kinase 2 OS=Rattus norvegicus GN=Cdk2 PE=1 SV=1 59 276 8.0E-09
sp|Q5R8Z4|PAK6_PONAB Serine/threonine-protein kinase PAK 6 OS=Pongo abelii GN=PAK6 PE=2 SV=1 66 275 8.0E-09
sp|Q9NQU5|PAK6_HUMAN Serine/threonine-protein kinase PAK 6 OS=Homo sapiens GN=PAK6 PE=1 SV=1 66 275 9.0E-09
sp|P24941|CDK2_HUMAN Cyclin-dependent kinase 2 OS=Homo sapiens GN=CDK2 PE=1 SV=2 59 276 1.0E-08
sp|P35567|CDK1A_XENLA Cyclin-dependent kinase 1-A OS=Xenopus laevis GN=cdk1-a PE=1 SV=1 61 276 1.0E-08
sp|Q90XV8|MOS_CICNG Serine/threonine-protein kinase mos (Fragment) OS=Ciconia nigra GN=MOS PE=3 SV=1 59 254 1.0E-08
sp|Q8R9T6|PKN1_CALS4 Probable serine/threonine-protein kinase Sps1 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=sps1 PE=3 SV=1 177 276 1.0E-08
sp|P42818|KPK1_ARATH Serine/threonine-protein kinase AtPK1/AtPK6 OS=Arabidopsis thaliana GN=ATPK1 PE=1 SV=1 63 276 2.0E-08
sp|Q90XV7|MOS_VULGR Serine/threonine-protein kinase mos (Fragment) OS=Vultur gryphus GN=MOS PE=3 SV=1 59 254 2.0E-08
sp|Q6Z8C8|CDKF4_ORYSJ Cyclin-dependent kinase F-4 OS=Oryza sativa subsp. japonica GN=CDKF-4 PE=2 SV=1 59 277 2.0E-08
sp|A7MBB4|M3K13_BOVIN Mitogen-activated protein kinase kinase kinase 13 OS=Bos taurus GN=MAP3K13 PE=2 SV=1 60 325 2.0E-08
sp|Q90XV9|MOS_NYCNY Serine/threonine-protein kinase mos (Fragment) OS=Nycticorax nycticorax GN=MOS PE=3 SV=1 59 254 2.0E-08
sp|Q9SR87|LRK61_ARATH Probable L-type lectin-domain containing receptor kinase VI.1 OS=Arabidopsis thaliana GN=LECRK61 PE=2 SV=1 59 275 2.0E-08
sp|Q8KY50|STKP1_STRPN Serine/threonine-protein kinase StkP OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=stkP PE=1 SV=1 192 276 2.0E-08
sp|P97377|CDK2_MOUSE Cyclin-dependent kinase 2 OS=Mus musculus GN=Cdk2 PE=1 SV=2 59 277 2.0E-08
sp|Q1HKZ5|M3K13_MOUSE Mitogen-activated protein kinase kinase kinase 13 OS=Mus musculus GN=Map3k13 PE=1 SV=1 60 325 2.0E-08
sp|P32490|MKK1_YEAST MAP kinase kinase MKK1/SSP32 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MKK1 PE=1 SV=1 182 276 2.0E-08
sp|Q7T6Y2|YR831_MIMIV Putative serine/threonine-protein kinase/receptor R831 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R831 PE=3 SV=2 66 276 2.0E-08
sp|P0CD62|LIMKB_DICDI Probable LIM domain-containing serine/threonine-protein kinase DDB_G0286997 OS=Dictyostelium discoideum GN=DDB_G0286997 PE=3 SV=1 162 274 2.0E-08
sp|Q99640|PMYT1_HUMAN Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase OS=Homo sapiens GN=PKMYT1 PE=1 SV=1 42 275 2.0E-08
sp|Q9C9M7|CDKD2_ARATH Cyclin-dependent kinase D-2 OS=Arabidopsis thaliana GN=CDKD-2 PE=1 SV=1 65 271 3.0E-08
sp|O61122|SVKA_DICDI Serine/threonine-protein kinase svkA OS=Dictyostelium discoideum GN=svkA PE=1 SV=1 177 275 3.0E-08
sp|Q8RWW0|ALE2_ARATH Receptor-like serine/threonine-protein kinase ALE2 OS=Arabidopsis thaliana GN=ALE2 PE=1 SV=1 59 276 3.0E-08
sp|Q9UQ07|MOK_HUMAN MAPK/MAK/MRK overlapping kinase OS=Homo sapiens GN=MOK PE=2 SV=1 189 277 3.0E-08
sp|O14047|PPK11_SCHPO Serine/threonine-protein kinase ppk11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk11 PE=3 SV=1 63 276 3.0E-08
sp|Q9FXF2|RKF1_ARATH Probable LRR receptor-like serine/threonine-protein kinase RFK1 OS=Arabidopsis thaliana GN=RKF1 PE=1 SV=1 66 329 3.0E-08
sp|B2DD29|BRSK1_RAT Serine/threonine-protein kinase BRSK1 OS=Rattus norvegicus GN=Brsk1 PE=1 SV=1 189 374 3.0E-08
sp|Q76P07|Y7165_DICDI Probable serine/threonine-protein kinase DDB_G0277165 OS=Dictyostelium discoideum GN=DDB_G0277165 PE=3 SV=1 66 378 3.0E-08
sp|Q5RJI5|BRSK1_MOUSE Serine/threonine-protein kinase BRSK1 OS=Mus musculus GN=Brsk1 PE=1 SV=1 189 374 3.0E-08
sp|O43283|M3K13_HUMAN Mitogen-activated protein kinase kinase kinase 13 OS=Homo sapiens GN=MAP3K13 PE=1 SV=1 60 325 4.0E-08
sp|Q8TDC3|BRSK1_HUMAN Serine/threonine-protein kinase BRSK1 OS=Homo sapiens GN=BRSK1 PE=1 SV=2 189 374 4.0E-08
sp|P87347|MOS_APTAU Serine/threonine-protein kinase mos (Fragment) OS=Apteryx australis GN=MOS PE=3 SV=1 59 254 4.0E-08
sp|A7J1T2|M313A_XENLA Mitogen-activated protein kinase kinase kinase 13-A OS=Xenopus laevis GN=map3k13-a PE=2 SV=1 60 276 4.0E-08
sp|Q0J4I1|CKB21_ORYSJ Cyclin-dependent kinase B2-1 OS=Oryza sativa subsp. japonica GN=CDKB2-1 PE=1 SV=1 178 276 4.0E-08
sp|P15442|GCN2_YEAST Serine/threonine-protein kinase GCN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GCN2 PE=1 SV=3 185 274 4.0E-08
sp|Q05006|CDC22_MEDSA Cell division control protein 2 homolog 2 OS=Medicago sativa GN=CDC2B PE=2 SV=1 59 271 4.0E-08
sp|P25859|CKB11_ARATH Cyclin-dependent kinase B1-1 OS=Arabidopsis thaliana GN=CDKB1-1 PE=1 SV=2 160 271 4.0E-08
sp|Q54QI2|Y9877_DICDI Serine/threonine-protein kinase DDB_G0283821 OS=Dictyostelium discoideum GN=DDB_G0283821 PE=3 SV=1 64 276 5.0E-08
sp|Q54RZ7|Y1199_DICDI Probable serine/threonine-protein kinase DDB_G0282895 OS=Dictyostelium discoideum GN=DDB_G0282895 PE=3 SV=1 57 276 5.0E-08
sp|Q8LG64|CKB22_ARATH Cyclin-dependent kinase B2-2 OS=Arabidopsis thaliana GN=CDKB2-2 PE=1 SV=2 178 276 5.0E-08
sp|Q94C25|Y5005_ARATH Probable receptor-like protein kinase At5g20050 OS=Arabidopsis thaliana GN=At5g20050 PE=2 SV=1 189 274 5.0E-08
sp|Q9ZRF9|RPK1_ARATH Probable LRR receptor-like serine/threonine-protein kinase RPK1 OS=Arabidopsis thaliana GN=RPK1 PE=1 SV=1 189 276 5.0E-08
sp|Q5R8X7|M3K13_PONAB Mitogen-activated protein kinase kinase kinase 13 OS=Pongo abelii GN=MAP3K13 PE=2 SV=1 60 325 5.0E-08
sp|Q9WVS4|MOK_MOUSE MAPK/MAK/MRK overlapping kinase OS=Mus musculus GN=Mok PE=1 SV=1 189 277 6.0E-08
sp|Q9LK43|TMK4_ARATH Receptor-like kinase TMK4 OS=Arabidopsis thaliana GN=TMK4 PE=1 SV=1 54 315 6.0E-08
sp|O34507|PRKC_BACSU Serine/threonine-protein kinase PrkC OS=Bacillus subtilis (strain 168) GN=prkC PE=1 SV=1 176 276 6.0E-08
sp|P24100|CDKA1_ARATH Cyclin-dependent kinase A-1 OS=Arabidopsis thaliana GN=CDKA-1 PE=1 SV=1 59 271 7.0E-08
sp|Q04735|CDK16_MOUSE Cyclin-dependent kinase 16 OS=Mus musculus GN=Cdk16 PE=1 SV=1 181 276 7.0E-08
sp|Q00536|CDK16_HUMAN Cyclin-dependent kinase 16 OS=Homo sapiens GN=CDK16 PE=1 SV=1 181 276 7.0E-08
sp|P54665|CC2H2_TRYBB Cell division control protein 2 homolog 2 OS=Trypanosoma brucei brucei GN=CRK2 PE=3 SV=1 59 275 7.0E-08
sp|O74526|KJ45_SCHPO Probable serine/threonine-protein kinase C70.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC70.05c PE=1 SV=1 66 290 7.0E-08
sp|Q6AXJ9|CDKL1_DANRE Cyclin-dependent kinase-like 1 OS=Danio rerio GN=cdkl1 PE=2 SV=1 175 365 8.0E-08
sp|P23437|CDK2_XENLA Cyclin-dependent kinase 2 OS=Xenopus laevis GN=cdk2 PE=1 SV=3 179 276 8.0E-08
sp|Q9VXE5|PAKM_DROME Serine/threonine-protein kinase PAK mbt OS=Drosophila melanogaster GN=mbt PE=1 SV=2 59 327 9.0E-08
sp|P34556|CDK1_CAEEL Cyclin-dependent kinase 1 OS=Caenorhabditis elegans GN=cdk-1 PE=1 SV=1 169 276 1.0E-07
sp|Q54E34|Y6398_DICDI Probable protein kinase DDB_G0291842 OS=Dictyostelium discoideum GN=DDB_G0291842 PE=3 SV=1 189 276 1.0E-07
sp|P29618|CDKA1_ORYSJ Cyclin-dependent kinase A-1 OS=Oryza sativa subsp. japonica GN=CDKA-1 PE=1 SV=1 66 271 1.0E-07
sp|Q86HG9|Y9871_DICDI Probable serine/threonine-protein kinase DDB_G0271682 OS=Dictyostelium discoideum GN=DDB_G0271682 PE=3 SV=2 189 276 1.0E-07
sp|Q7U095|PKNH_MYCBO Serine/threonine-protein kinase PknH OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pknH PE=3 SV=1 175 271 1.0E-07
sp|Q61851|FGFR3_MOUSE Fibroblast growth factor receptor 3 OS=Mus musculus GN=Fgfr3 PE=1 SV=1 59 276 1.0E-07
sp|P9WI71|PKNH_MYCTU Serine/threonine-protein kinase PknH OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pknH PE=1 SV=1 175 271 1.0E-07
sp|Q00526|CDK3_HUMAN Cyclin-dependent kinase 3 OS=Homo sapiens GN=CDK3 PE=1 SV=1 60 276 1.0E-07
sp|P9WI70|PKNH_MYCTO Serine/threonine-protein kinase PknH OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pknH PE=3 SV=1 175 271 1.0E-07
sp|P06242|KIN28_YEAST Serine/threonine-protein kinase KIN28 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIN28 PE=1 SV=1 178 271 1.0E-07
sp|Q40353|MMK2_MEDSA Mitogen-activated protein kinase homolog MMK2 OS=Medicago sativa GN=MMK2 PE=2 SV=1 181 387 1.0E-07
sp|Q39023|MPK3_ARATH Mitogen-activated protein kinase 3 OS=Arabidopsis thaliana GN=MPK3 PE=1 SV=2 181 387 1.0E-07
sp|P29619|CDKA2_ORYSJ Cyclin-dependent kinase A-2 OS=Oryza sativa subsp. japonica GN=CDKA-2 PE=2 SV=1 181 271 1.0E-07
sp|P24033|CDK1B_XENLA Cyclin-dependent kinase 1-B OS=Xenopus laevis GN=cdk1-b PE=1 SV=2 61 276 2.0E-07
sp|Q8LPS5|SERK5_ARATH Somatic embryogenesis receptor kinase 5 OS=Arabidopsis thaliana GN=SERK5 PE=1 SV=2 59 379 2.0E-07
sp|F4JY37|RUK_ARATH Serine/threonine-protein kinase RUNKEL OS=Arabidopsis thaliana GN=RUK PE=1 SV=1 192 276 2.0E-07
sp|Q8XJL8|PKN2_CLOPE Probable serine/threonine-protein kinase CPE1738 OS=Clostridium perfringens (strain 13 / Type A) GN=CPE1738 PE=3 SV=1 175 276 2.0E-07
sp|Q2QAV0|TIO_ARATH Serine/threonine-protein kinase TIO OS=Arabidopsis thaliana GN=TIO PE=1 SV=1 63 271 2.0E-07
sp|Q12126|CRK1_SCHPO Serine/threonine-protein kinase crk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=crk1 PE=1 SV=1 182 271 2.0E-07
sp|Q9CEF5|PKNB_LACLA Probable serine/threonine-protein kinase PknB OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=pknB PE=3 SV=1 174 276 2.0E-07
sp|Q54VI1|FHKE_DICDI Probable serine/threonine-protein kinase fhkE OS=Dictyostelium discoideum GN=fhkE PE=3 SV=1 64 271 2.0E-07
sp|Q54L00|LIMKA_DICDI Probable LIM domain-containing serine/threonine-protein kinase DDB_G0287001 OS=Dictyostelium discoideum GN=DDB_G0287001 PE=3 SV=1 162 274 2.0E-07
sp|P9WI63|PKNL_MYCTU Serine/threonine-protein kinase PknL OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pknL PE=1 SV=1 182 276 2.0E-07
sp|P9WI62|PKNL_MYCTO Serine/threonine-protein kinase PknL OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pknL PE=3 SV=1 182 276 2.0E-07
sp|A0QNG1|PKNB_MYCS2 Serine/threonine-protein kinase PknB OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=pknB PE=1 SV=1 185 276 2.0E-07
sp|Q7TYY6|PKNL_MYCBO Serine/threonine-protein kinase PknL OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pknL PE=3 SV=1 182 276 2.0E-07
sp|P54739|PKAA_STRCO Serine/threonine-protein kinase PkaA OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=pkaA PE=3 SV=1 176 276 2.0E-07
sp|P43450|CDK2_CARAU Cyclin-dependent kinase 2 OS=Carassius auratus GN=cdk2 PE=2 SV=1 179 276 3.0E-07
sp|Q9P286|PAK7_HUMAN Serine/threonine-protein kinase PAK 7 OS=Homo sapiens GN=PAK7 PE=1 SV=1 60 274 3.0E-07
sp|Q38772|CDC2A_ANTMA Cell division control protein 2 homolog A OS=Antirrhinum majus GN=CDC2A PE=2 SV=2 172 271 3.0E-07
sp|P24923|CDC21_MEDSA Cell division control protein 2 homolog 1 (Fragment) OS=Medicago sativa GN=CDC2A PE=2 SV=1 66 276 3.0E-07
sp|Q9S2C0|PKSC_STRCO Serine/threonine-protein kinase PksC OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=pksC PE=3 SV=1 58 276 3.0E-07
sp|Q8BTW9|PAK4_MOUSE Serine/threonine-protein kinase PAK 4 OS=Mus musculus GN=Pak4 PE=1 SV=1 182 275 4.0E-07
sp|Q6ERS0|CIPKR_ORYSJ Putative CBL-interacting protein kinase 27 OS=Oryza sativa subsp. japonica GN=CIPK27 PE=3 SV=1 56 290 4.0E-07
sp|Q7T6Y1|YR436_MIMIV Putative serine/threonine-protein kinase R436 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R436 PE=3 SV=2 166 269 4.0E-07
sp|O64556|Y2923_ARATH Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g19230 OS=Arabidopsis thaliana GN=At2g19230 PE=3 SV=3 65 276 4.0E-07
sp|Q54XJ4|Y8901_DICDI Probable serine/threonine-protein kinase DDB_G0278901 OS=Dictyostelium discoideum GN=DDB_G0278901 PE=3 SV=1 178 276 4.0E-07
sp|P41279|M3K8_HUMAN Mitogen-activated protein kinase kinase kinase 8 OS=Homo sapiens GN=MAP3K8 PE=1 SV=2 189 276 4.0E-07
sp|Q38773|CDC2B_ANTMA Cell division control protein 2 homolog B (Fragment) OS=Antirrhinum majus GN=CDC2B PE=2 SV=1 179 271 5.0E-07
sp|Q63562|M3K8_RAT Mitogen-activated protein kinase kinase kinase 8 OS=Rattus norvegicus GN=Map3k8 PE=1 SV=1 189 276 5.0E-07
sp|Q00537|CDK17_HUMAN Cyclin-dependent kinase 17 OS=Homo sapiens GN=CDK17 PE=1 SV=2 185 276 5.0E-07
sp|Q8K0D0|CDK17_MOUSE Cyclin-dependent kinase 17 OS=Mus musculus GN=Cdk17 PE=1 SV=2 185 276 5.0E-07
sp|O35831|CDK17_RAT Cyclin-dependent kinase 17 OS=Rattus norvegicus GN=Cdk17 PE=1 SV=1 185 276 5.0E-07
sp|P23572|CDK1_DROME Cyclin-dependent kinase 1 OS=Drosophila melanogaster GN=Cdk1 PE=1 SV=1 138 276 5.0E-07
sp|P34112|CDK1_DICDI Cyclin-dependent kinase 1 OS=Dictyostelium discoideum GN=cdk1 PE=2 SV=1 181 361 5.0E-07
sp|P27446|FYN_XIPHE Tyrosine-protein kinase Fyn OS=Xiphophorus helleri GN=fyn PE=2 SV=3 66 276 5.0E-07
sp|Q84UI5|MPK1_ORYSJ Mitogen-activated protein kinase 1 OS=Oryza sativa subsp. japonica GN=MPK1 PE=1 SV=1 185 387 5.0E-07
sp|P54741|AFSK_STRCO Serine/threonine-protein kinase AfsK OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=afsK PE=1 SV=2 185 276 5.0E-07
sp|Q8G4G1|PKNA2_BIFLO Probable serine/threonine-protein kinase pknA2 OS=Bifidobacterium longum (strain NCC 2705) GN=pknA2 PE=3 SV=1 192 270 5.0E-07
sp|Q63686|CDK16_RAT Cyclin-dependent kinase 16 OS=Rattus norvegicus GN=Cdk16 PE=1 SV=1 181 276 6.0E-07
sp|Q93ZS4|NIK3_ARATH Protein NSP-INTERACTING KINASE 3 OS=Arabidopsis thaliana GN=NIK3 PE=1 SV=1 190 352 6.0E-07
sp|B1H3E1|NLK2_XENTR Serine/threonine-protein kinase NLK2 OS=Xenopus tropicalis GN=nlk.2 PE=2 SV=1 180 271 6.0E-07
sp|P93101|CDC2_OXYRB Cell division control protein 2 homolog OS=Oxybasis rubra GN=CDC2 PE=2 SV=1 59 271 6.0E-07
sp|Q7XIW5|CIPKT_ORYSJ CBL-interacting protein kinase 29 OS=Oryza sativa subsp. japonica GN=CIPK29 PE=2 SV=1 192 289 6.0E-07
sp|Q8QGV6|NLK2_XENLA Serine/threonine-protein kinase NLK2 OS=Xenopus laevis GN=nlk.2 PE=1 SV=1 180 271 6.0E-07
sp|Q39025|MPK5_ARATH Mitogen-activated protein kinase 5 OS=Arabidopsis thaliana GN=MPK5 PE=2 SV=2 180 276 6.0E-07
sp|O96013|PAK4_HUMAN Serine/threonine-protein kinase PAK 4 OS=Homo sapiens GN=PAK4 PE=1 SV=1 60 275 6.0E-07
sp|Q00532|CDKL1_HUMAN Cyclin-dependent kinase-like 1 OS=Homo sapiens GN=CDKL1 PE=1 SV=5 191 362 7.0E-07
sp|Q2V419|CKB12_ARATH Cyclin-dependent kinase B1-2 OS=Arabidopsis thaliana GN=CDKB1-2 PE=1 SV=2 160 271 7.0E-07
sp|O23304|BLUS1_ARATH Serine/threonine-protein kinase BLUS1 OS=Arabidopsis thaliana GN=BLUS1 PE=1 SV=1 66 275 7.0E-07
sp|Q9XA16|PKNX_STRCO Probable serine/threonine-protein kinase SCO3848 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO3848 PE=3 SV=1 189 277 7.0E-07
sp|Q498D6|FGFR4_RAT Fibroblast growth factor receptor 4 OS=Rattus norvegicus GN=Fgfr4 PE=1 SV=1 171 277 8.0E-07
sp|Q26671|CDC2H_THEAN Cell division control protein 2 homolog OS=Theileria annulata GN=CRK2 PE=2 SV=1 184 361 8.0E-07
sp|Q38775|CDC2D_ANTMA Cell division control protein 2 homolog D OS=Antirrhinum majus GN=CDC2D PE=2 SV=1 182 276 8.0E-07
sp|P22607|FGFR3_HUMAN Fibroblast growth factor receptor 3 OS=Homo sapiens GN=FGFR3 PE=1 SV=1 59 277 8.0E-07
sp|Q9SKG5|SERK4_ARATH Somatic embryogenesis receptor kinase 4 OS=Arabidopsis thaliana GN=SERK4 PE=1 SV=2 59 379 9.0E-07
sp|P54742|AFSK_STRGR Serine/threonine-protein kinase AfsK OS=Streptomyces griseus GN=afsK PE=3 SV=1 185 276 9.0E-07
sp|Q9FJ54|CIPKK_ARATH CBL-interacting serine/threonine-protein kinase 20 OS=Arabidopsis thaliana GN=CIPK20 PE=1 SV=1 181 375 9.0E-07
sp|E1BMN8|NLK_BOVIN Serine/threonine-protein kinase NLK OS=Bos taurus GN=NLK PE=3 SV=2 180 271 1.0E-06
sp|D3ZSZ3|NLK_RAT Serine/threonine-protein kinase NLK OS=Rattus norvegicus GN=Nlk PE=3 SV=1 180 271 1.0E-06
sp|O54949|NLK_MOUSE Serine/threonine-protein kinase NLK OS=Mus musculus GN=Nlk PE=1 SV=2 180 271 1.0E-06
sp|E2QWQ2|NLK_CANLF Serine/threonine-protein kinase NLK OS=Canis lupus familiaris GN=NLK PE=3 SV=1 180 271 1.0E-06
sp|Q9UBE8|NLK_HUMAN Serine/threonine-protein kinase NLK OS=Homo sapiens GN=NLK PE=1 SV=2 180 271 1.0E-06
sp|Q11179|YPC2_CAEEL Putative serine/threonine-protein kinase C05D10.2 OS=Caenorhabditis elegans GN=C05D10.2 PE=3 SV=2 185 280 1.0E-06
sp|Q9XZD6|CDC2H_PLAVI Cell division control protein 2 homolog OS=Plasmodium vivax GN=CRK2 PE=3 SV=1 63 271 1.0E-06
sp|Q5SN53|MPK8_ORYSJ Mitogen-activated protein kinase 8 OS=Oryza sativa subsp. japonica GN=MPK8 PE=2 SV=2 185 432 1.0E-06
sp|P22455|FGFR4_HUMAN Fibroblast growth factor receptor 4 OS=Homo sapiens GN=FGFR4 PE=1 SV=2 171 277 1.0E-06
sp|Q69Q47|CIPKO_ORYSJ CBL-interacting protein kinase 24 OS=Oryza sativa subsp. japonica GN=CIPK24 PE=1 SV=1 192 271 1.0E-06
sp|Q5ZCI1|MPK10_ORYSJ Mitogen-activated protein kinase 10 OS=Oryza sativa subsp. japonica GN=MPK10 PE=2 SV=2 181 316 1.0E-06
sp|Q84SN3|CDKF3_ORYSJ Cyclin-dependent kinase F-3 OS=Oryza sativa subsp. japonica GN=CDKF-3 PE=2 SV=1 189 277 2.0E-06
sp|P54737|PKN5_MYXXA Serine/threonine-protein kinase pkn5 OS=Myxococcus xanthus GN=pkn5 PE=2 SV=1 189 276 2.0E-06
sp|D4A280|PAK7_RAT Serine/threonine-protein kinase PAK 7 OS=Rattus norvegicus GN=Pak7 PE=1 SV=1 182 274 2.0E-06
sp|A8XA58|CDK1_CAEBR Cyclin-dependent kinase 1 OS=Caenorhabditis briggsae GN=cdk-1 PE=3 SV=1 189 276 2.0E-06
sp|Q8C015|PAK7_MOUSE Serine/threonine-protein kinase PAK 7 OS=Mus musculus GN=Pak7 PE=1 SV=1 182 274 2.0E-06
sp|O44514|PMK3_CAEEL Mitogen-activated protein kinase pmk-3 OS=Caenorhabditis elegans GN=pmk-3 PE=1 SV=2 182 270 2.0E-06
sp|Q9Y884|SKH1_SCHPO MAP kinase kinase skh1/pek1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=skh1 PE=3 SV=1 189 275 2.0E-06
sp|P00546|CDK1_YEAST Cyclin-dependent kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC28 PE=1 SV=1 172 271 2.0E-06
sp|Q8G6P9|PKNB_BIFLO Probable serine/threonine-protein kinase PknB OS=Bifidobacterium longum (strain NCC 2705) GN=pknB PE=3 SV=1 185 276 2.0E-06
sp|Q9SUL7|CIPK4_ARATH CBL-interacting serine/threonine-protein kinase 4 OS=Arabidopsis thaliana GN=CIPK4 PE=1 SV=1 189 289 2.0E-06
sp|P54744|PKNB_MYCLE Serine/threonine-protein kinase PknB OS=Mycobacterium leprae (strain TN) GN=pknB PE=3 SV=3 191 276 2.0E-06
sp|P48609|CDK5_DROME Cyclin-dependent kinase 5 homolog OS=Drosophila melanogaster GN=Cdk5 PE=1 SV=2 59 275 2.0E-06
sp|Q6L5D4|MPK9_ORYSJ Mitogen-activated protein kinase 9 OS=Oryza sativa subsp. japonica GN=MPK9 PE=3 SV=2 181 316 2.0E-06
sp|P13863|CDK1_CHICK Cyclin-dependent kinase 1 OS=Gallus gallus GN=CDK1 PE=1 SV=1 135 276 2.0E-06
sp|Q39026|MPK6_ARATH Mitogen-activated protein kinase 6 OS=Arabidopsis thaliana GN=MPK6 PE=1 SV=1 185 274 3.0E-06
sp|Q9SJG9|MPK20_ARATH Mitogen-activated protein kinase 20 OS=Arabidopsis thaliana GN=MPK20 PE=1 SV=2 181 316 3.0E-06
sp|Q9P289|STK26_HUMAN Serine/threonine-protein kinase 26 OS=Homo sapiens GN=STK26 PE=1 SV=2 60 275 3.0E-06
sp|Q99JT2|STK26_MOUSE Serine/threonine-protein kinase 26 OS=Mus musculus GN=Stk26 PE=1 SV=1 60 275 3.0E-06
sp|P54119|CDK1_AJECA Cyclin-dependent kinase 1 OS=Ajellomyces capsulatus GN=CDC2 PE=3 SV=1 185 276 3.0E-06
sp|O00506|STK25_HUMAN Serine/threonine-protein kinase 25 OS=Homo sapiens GN=STK25 PE=1 SV=1 60 275 3.0E-06
sp|Q9LMM5|MPK11_ARATH Mitogen-activated protein kinase 11 OS=Arabidopsis thaliana GN=MPK11 PE=1 SV=1 181 387 4.0E-06
sp|O96821|CDC2H_PLAKH Cell division control protein 2 homolog OS=Plasmodium knowlesi (strain H) GN=CRK2 PE=3 SV=1 63 271 4.0E-06
sp|Q60EY8|CIPKK_ORYSJ CBL-interacting protein kinase 20 OS=Oryza sativa subsp. japonica GN=CIPK20 PE=2 SV=1 66 290 4.0E-06
sp|Q9Z2W1|STK25_MOUSE Serine/threonine-protein kinase 25 OS=Mus musculus GN=Stk25 PE=1 SV=2 60 275 4.0E-06
sp|Q75KK8|MPK14_ORYSJ Mitogen-activated protein kinase 14 OS=Oryza sativa subsp. japonica GN=MPK14 PE=2 SV=1 50 361 5.0E-06
sp|P97756|KKCC1_RAT Calcium/calmodulin-dependent protein kinase kinase 1 OS=Rattus norvegicus GN=Camkk1 PE=1 SV=1 97 280 5.0E-06
sp|Q27032|CDC2H_THEPA Cell division control protein 2 homolog OS=Theileria parva GN=CRK2 PE=3 SV=1 184 271 5.0E-06
sp|Q8VBY2|KKCC1_MOUSE Calcium/calmodulin-dependent protein kinase kinase 1 OS=Mus musculus GN=Camkk1 PE=1 SV=1 97 280 5.0E-06
sp|A3B529|CIPKS_ORYSJ CBL-interacting protein kinase 28 OS=Oryza sativa subsp. japonica GN=CIPK28 PE=2 SV=2 192 278 5.0E-06
sp|P92937|CIPKF_ARATH CBL-interacting serine/threonine-protein kinase 15 OS=Arabidopsis thaliana GN=CIPK15 PE=1 SV=2 189 272 5.0E-06
sp|O80902|CIPKM_ARATH CBL-interacting serine/threonine-protein kinase 22 OS=Arabidopsis thaliana GN=CIPK22 PE=2 SV=1 192 272 5.0E-06
sp|P07949|RET_HUMAN Proto-oncogene tyrosine-protein kinase receptor Ret OS=Homo sapiens GN=RET PE=1 SV=3 66 277 6.0E-06
sp|Q81WH6|PRKC_BACAN Serine/threonine-protein kinase PrkC OS=Bacillus anthracis GN=prkC PE=1 SV=1 185 276 6.0E-06
sp|Q3SWY6|STK25_BOVIN Serine/threonine-protein kinase 25 OS=Bos taurus GN=STK25 PE=2 SV=1 60 275 6.0E-06
sp|Q67C40|MPK7_ORYSJ Mitogen-activated protein kinase 7 OS=Oryza sativa subsp. japonica GN=MPK7 PE=2 SV=1 185 432 6.0E-06
sp|Q8GYQ5|MPK12_ARATH Mitogen-activated protein kinase 12 OS=Arabidopsis thaliana GN=MPK12 PE=1 SV=1 185 387 7.0E-06
sp|P49695|PKWA_THECU Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1 167 276 7.0E-06
sp|G3V9H8|RET_RAT Proto-oncogene tyrosine-protein kinase receptor Ret OS=Rattus norvegicus GN=Ret PE=1 SV=1 66 277 9.0E-06
sp|P35546|RET_MOUSE Proto-oncogene tyrosine-protein kinase receptor Ret OS=Mus musculus GN=Ret PE=1 SV=2 66 277 9.0E-06
sp|Q9Z2P5|RIPK3_RAT Receptor-interacting serine/threonine-protein kinase 3 OS=Rattus norvegicus GN=Ripk3 PE=1 SV=3 60 291 9.0E-06
sp|Q6MAN0|PKND_PARUW Serine/threonine-protein kinase PknD OS=Protochlamydia amoebophila (strain UWE25) GN=pknD PE=3 SV=1 177 277 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004672 protein kinase activity Yes
GO:0006468 protein phosphorylation Yes
GO:0008152 metabolic process No
GO:0019538 protein metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0043170 macromolecule metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0032559 adenyl ribonucleotide binding No
GO:0016740 transferase activity No
GO:0016301 kinase activity No
GO:0006796 phosphate-containing compound metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0009987 cellular process No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:1901363 heterocyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:0044237 cellular metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0000166 nucleotide binding No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0006793 phosphorus metabolic process No
GO:0016310 phosphorylation No
GO:0036211 protein modification process No
GO:0043167 ion binding No
GO:0043412 macromolecule modification No
GO:0017076 purine nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7586
MGDGRHGWTTVGHGIPSLCCEAEQELREREAIAAWACDDHWPGIDKPPRDFDAKRFDGRLSKLDVLGHGAFGCVD
KVVYDAVALARKRIVRPRRRTIDDLRQEGITMAKLDHRHVVKLVAAYAPRPFELCLLIWPAAVCSLTVLLDDVEA
LRVGDGDAEDTAGRLASLRLGPDDRQGPLDFLAALLGCVARALAYCHAQGVRHLDIKPHNILLKPDRVYLADFGI
SRDVSGQDHTTTDELPGTEKWRAPELYGGNGSSMQLSDMYSLGLVFLNIATVLYGARLADFDDALRYSTRLSLQD
RLRVREDKIARHLDRLTAQALVTPRFICTYDGQETVRPRPVVGLIAHMVTSDPRGRLSAEKVDEKLSILGGIHQI
YHAGCCQRPLAWVEDRWDRKLTALTSLKDKNEHQLRRIRELEGKDETYEARIDNARRAHEQDVARLQALLRDAEA
RCQRLELDKATRRSLQQAHSRPAVPGPRRDGPAATGSSAKPRLAPPPCRPSQQRKRTESPESWTARADDRPAAAH
DNTPVHQRRRHPSSPLVGYRLRSRGSGSKLPLPVTPGRGDATAVLSFEQSMTDSSMTSSVFSRRSVETAPTPADG
SPRMQRAPTDEQQPQGRPKQWTELPPRQRDRRAMAGRPMLSMASAAASASPRNSLTSQDDASDDSTARPVIPSLQ
PAKSWADVAKLEEAQRR*
Coding >Ophun1|7586
ATGGGCGACGGGCGCCACGGCTGGACCACGGTTGGTCACGGAATTCCCAGCCTGTGCTGTGAGGCCGAGCAGGAG
CTCCGTGAGCGTGAGGCCATTGCCGCCTGGGCCTGCGACGACCATTGGCCCGGCATAGACAAGCCGCCGCGCGAC
TTCGACGCCAAGCGCTTCGATGGCCGCCTCAGCAAGCTCGACGTCCTCGGACACGGTGCCTTTGGCTGCGTCGAC
AAGGTCGTCTACGATGCCGTGGCCCTCGCCCGCAAGCGCATCGTACGCCCCCGTCGCCGTACCATCGACGACTTG
CGTCAGGAGGGCATCACCATGGCCAAGCTCGATCATCGCCACGTCGTCAAGCTCGTGGCCGCCTACGCGCCTCGC
CCCTTTGAGCTTTGCCTGCTCATCTGGCCCGCCGCCGTGTGCAGCCTGACGGTTCTCCTCGATGACGTCGAAGCC
CTCCGTGTCGGCGATGGCGATGCCGAGGACACGGCCGGCCGCCTCGCCTCCCTGCGCCTCGGCCCCGACGACCGA
CAGGGGCCCCTCGACTTTCTCGCCGCTCTGCTCGGCTGCGTCGCCCGTGCCTTGGCCTACTGTCACGCACAGGGC
GTCCGTCATCTCGACATCAAGCCTCACAACATCCTCCTCAAGCCCGATCGCGTCTACCTCGCCGACTTTGGCATC
TCGCGCGACGTCAGCGGCCAGGACCACACCACTACCGACGAGCTCCCCGGCACCGAGAAGTGGCGCGCCCCGGAG
CTTTACGGTGGCAATGGTTCGAGCATGCAGCTTTCGGACATGTACTCGCTGGGCCTCGTCTTCCTCAACATCGCC
ACCGTCTTGTACGGCGCCCGTCTGGCGGACTTTGACGACGCTCTCCGCTACTCGACTCGCCTCTCTCTCCAGGAT
CGCCTGAGGGTCCGCGAGGATAAGATAGCGCGCCATCTCGACCGTCTCACCGCCCAGGCCCTCGTCACCCCGCGC
TTCATCTGCACCTACGACGGCCAGGAGACGGTGCGGCCGCGCCCAGTCGTTGGCCTCATCGCCCACATGGTCACC
TCGGACCCTCGCGGCCGGCTGTCGGCCGAAAAGGTGGACGAGAAGCTGTCGATACTGGGCGGCATCCACCAAATC
TACCACGCCGGCTGCTGCCAGCGGCCGCTCGCCTGGGTCGAGGACAGGTGGGACCGGAAGCTGACGGCCCTGACC
AGCCTAAAGGACAAGAACGAGCATCAGCTCAGAAGGATCAGGGAGCTCGAGGGCAAGGACGAGACGTACGAGGCG
CGCATCGACAACGCCCGTAGAGCCCACGAGCAAGACGTGGCCAGGCTGCAGGCTCTACTGCGTGACGCCGAGGCC
AGGTGCCAGAGACTGGAGCTGGACAAGGCGACGCGTAGGAGTTTGCAACAGGCGCATTCCCGACCCGCCGTGCCC
GGCCCGAGGCGCGACGGCCCTGCTGCTACCGGCTCCTCTGCCAAGCCACGGCTGGCGCCGCCGCCGTGTCGACCG
AGCCAGCAGCGGAAACGGACCGAAAGCCCCGAGTCGTGGACGGCACGCGCCGACGACAGGCCGGCAGCGGCACAT
GACAATACTCCGGTCCATCAACGACGGCGTCATCCGTCTTCTCCTCTGGTCGGATACCGGCTGCGCTCTCGCGGC
TCCGGCTCGAAGCTGCCTCTTCCGGTGACGCCCGGTCGCGGAGACGCCACGGCCGTCCTGAGCTTCGAACAGAGC
ATGACGGACAGCAGCATGACGTCTTCCGTCTTCTCTCGCCGCAGCGTCGAGACTGCGCCGACGCCGGCCGACGGC
AGTCCGCGGATGCAACGGGCACCGACGGACGAGCAGCAACCACAAGGGCGGCCAAAGCAGTGGACCGAGCTGCCG
CCCCGACAGCGCGACAGGCGAGCCATGGCGGGCAGGCCCATGCTCTCCATGGCGTCGGCGGCGGCATCGGCATCG
CCCCGGAACTCGCTGACGTCGCAGGATGACGCCTCGGACGATTCGACGGCGCGGCCAGTCATTCCCTCGCTGCAG
CCGGCCAAGAGCTGGGCCGATGTGGCAAAGCTGGAGGAGGCTCAGCGGCGGTGA
Transcript >Ophun1|7586
ATGGGCGACGGGCGCCACGGCTGGACCACGGTTGGTCACGGAATTCCCAGCCTGTGCTGTGAGGCCGAGCAGGAG
CTCCGTGAGCGTGAGGCCATTGCCGCCTGGGCCTGCGACGACCATTGGCCCGGCATAGACAAGCCGCCGCGCGAC
TTCGACGCCAAGCGCTTCGATGGCCGCCTCAGCAAGCTCGACGTCCTCGGACACGGTGCCTTTGGCTGCGTCGAC
AAGGTCGTCTACGATGCCGTGGCCCTCGCCCGCAAGCGCATCGTACGCCCCCGTCGCCGTACCATCGACGACTTG
CGTCAGGAGGGCATCACCATGGCCAAGCTCGATCATCGCCACGTCGTCAAGCTCGTGGCCGCCTACGCGCCTCGC
CCCTTTGAGCTTTGCCTGCTCATCTGGCCCGCCGCCGTGTGCAGCCTGACGGTTCTCCTCGATGACGTCGAAGCC
CTCCGTGTCGGCGATGGCGATGCCGAGGACACGGCCGGCCGCCTCGCCTCCCTGCGCCTCGGCCCCGACGACCGA
CAGGGGCCCCTCGACTTTCTCGCCGCTCTGCTCGGCTGCGTCGCCCGTGCCTTGGCCTACTGTCACGCACAGGGC
GTCCGTCATCTCGACATCAAGCCTCACAACATCCTCCTCAAGCCCGATCGCGTCTACCTCGCCGACTTTGGCATC
TCGCGCGACGTCAGCGGCCAGGACCACACCACTACCGACGAGCTCCCCGGCACCGAGAAGTGGCGCGCCCCGGAG
CTTTACGGTGGCAATGGTTCGAGCATGCAGCTTTCGGACATGTACTCGCTGGGCCTCGTCTTCCTCAACATCGCC
ACCGTCTTGTACGGCGCCCGTCTGGCGGACTTTGACGACGCTCTCCGCTACTCGACTCGCCTCTCTCTCCAGGAT
CGCCTGAGGGTCCGCGAGGATAAGATAGCGCGCCATCTCGACCGTCTCACCGCCCAGGCCCTCGTCACCCCGCGC
TTCATCTGCACCTACGACGGCCAGGAGACGGTGCGGCCGCGCCCAGTCGTTGGCCTCATCGCCCACATGGTCACC
TCGGACCCTCGCGGCCGGCTGTCGGCCGAAAAGGTGGACGAGAAGCTGTCGATACTGGGCGGCATCCACCAAATC
TACCACGCCGGCTGCTGCCAGCGGCCGCTCGCCTGGGTCGAGGACAGGTGGGACCGGAAGCTGACGGCCCTGACC
AGCCTAAAGGACAAGAACGAGCATCAGCTCAGAAGGATCAGGGAGCTCGAGGGCAAGGACGAGACGTACGAGGCG
CGCATCGACAACGCCCGTAGAGCCCACGAGCAAGACGTGGCCAGGCTGCAGGCTCTACTGCGTGACGCCGAGGCC
AGGTGCCAGAGACTGGAGCTGGACAAGGCGACGCGTAGGAGTTTGCAACAGGCGCATTCCCGACCCGCCGTGCCC
GGCCCGAGGCGCGACGGCCCTGCTGCTACCGGCTCCTCTGCCAAGCCACGGCTGGCGCCGCCGCCGTGTCGACCG
AGCCAGCAGCGGAAACGGACCGAAAGCCCCGAGTCGTGGACGGCACGCGCCGACGACAGGCCGGCAGCGGCACAT
GACAATACTCCGGTCCATCAACGACGGCGTCATCCGTCTTCTCCTCTGGTCGGATACCGGCTGCGCTCTCGCGGC
TCCGGCTCGAAGCTGCCTCTTCCGGTGACGCCCGGTCGCGGAGACGCCACGGCCGTCCTGAGCTTCGAACAGAGC
ATGACGGACAGCAGCATGACGTCTTCCGTCTTCTCTCGCCGCAGCGTCGAGACTGCGCCGACGCCGGCCGACGGC
AGTCCGCGGATGCAACGGGCACCGACGGACGAGCAGCAACCACAAGGGCGGCCAAAGCAGTGGACCGAGCTGCCG
CCCCGACAGCGCGACAGGCGAGCCATGGCGGGCAGGCCCATGCTCTCCATGGCGTCGGCGGCGGCATCGGCATCG
CCCCGGAACTCGCTGACGTCGCAGGATGACGCCTCGGACGATTCGACGGCGCGGCCAGTCATTCCCTCGCTGCAG
CCGGCCAAGAGCTGGGCCGATGTGGCAAAGCTGGAGGAGGCTCAGCGGCGGTGA
Gene >Ophun1|7586
ATGGGCGACGGGCGCCACGGCTGGACCACGGTTGGTCACGGAATTCCCAGCCTGTGCTGTGAGGCCGAGCAGGAG
CTCCGTGAGCGTGAGGCCATTGCCGCCTGGGCCTGCGACGACCATTGGCCCGGCATGTGAGGAGGCACGTCCAAC
TCTTGGGACGTCCGAGTCTGACGCTGTCGATAGAGACAAGCCGCCGCGCGACTTCGACGCCAAGCGCTTCGATGG
CCGCCTCAGCAAGCTCGACGTCCTCGGACACGGTGCCTTTGGCTGCGTCGACAAGGTCGTCTACGATGCCGTGGC
CCTCGCCCGCAAGCGCATCGTACGCCCCCGTCGCCGTACCATCGACGACTTGCGTCAGGAGGGCATCACCATGGC
CAAGCTCGATCATCGCCACGTCGTCAAGCTCGTGGCCGCCTACGCGCCTCGCCCCTTTGAGCTTTGCCTGCTCAT
CTGGCCCGCCGCCGTGTGCAGCCTGACGGTTCTCCTCGATGACGTCGAAGCCCTCCGTGTCGGCGATGGCGATGC
CGAGGACACGGCCGGCCGCCTCGCCTCCCTGCGCCTCGGCCCCGACGACCGACAGGGGCCCCTCGACTTTCTCGC
CGCTCTGCTCGGCTGCGTCGCCCGTGCCTTGGCCTACTGTCACGCACAGGGCGTCCGTCATCTCGACATCAAGCC
TCACAACATCCTCCTCAAGCCCGATCGCGTCTACCTCGCCGACTTTGGCATCTCGCGCGACGTCAGCGGCCAGGA
CCACACCACTACCGACGAGCTCCCCGGCACCGAGAAGTGGCGCGCCCCGGAGCTTTACGGTGGCAATGGTTCGAG
CATGCAGCTTTCGGACATGTACTCGCTGGGCCTCGTCTTCCTCAACATCGCCACCGTCTTGTACGGCGCCCGTCT
GGCGGACTTTGACGACGCTCTCCGCTACTCGACTCGCCTCTCTCTCCAGGATCGCCTGAGGGTCCGCGAGGATAA
GATAGCGCGCCATCTCGACCGTCTCACCGCCCAGGCCCTCGTCACCCCGCGCTTCATCTGCACCTACGACGGCCA
GGAGACGGTGCGGCCGCGCCCAGTCGTTGGCCTCATCGCCCACATGGTCACCTCGGACCCTCGCGGCCGGCTGTC
GGCCGAAAAGGTGGACGAGAAGCTGTCGATACTGGGCGGCATCCACCAAATCTACCACGCCGGCTGCTGCCAGCG
GCCGCTCGCCTGGGTCGAGGACAGGTGGGACCGGAAGCTGACGGCCCTGACCAGCCTAAAGGACAAGAACGAGCA
TCAGCTCAGAAGGATCAGGGAGCTCGAGGGCAAGGACGAGACGTACGAGGCGCGCATCGACAACGCCCGTAGAGC
CCACGAGCAAGACGTGGCCAGGCTGCAGGCTCTACTGCGTGACGCCGAGGCCAGGTGCCAGAGACTGGAGCTGGA
CAAGGCGACGCGTAGGAGTTTGCAACAGGCGCATTCCCGACCCGCCGTGCCCGGCCCGAGGCGCGACGGCCCTGC
TGCTACCGGCTCCTCTGCCAAGCCACGGCTGGCGCCGCCGCCGTGTCGACCGAGCCAGCAGCGGAAACGGACCGA
AAGCCCCGAGTCGTGGACGGCACGCGCCGACGACAGGCCGGCAGCGGCACATGACAATACTCCGGTCCATCAACG
ACGGCGTCATCCGTCTTCTCCTCTGGTCGGATACCGGCTGCGCTCTCGCGGCTCCGGCTCGAAGCTGCCTCTTCC
GGTGACGCCCGGTCGCGGAGACGCCACGGCCGTCCTGAGCTTCGAACAGAGCATGACGGACAGCAGCATGACGTC
TTCCGTCTTCTCTCGCCGCAGCGTCGAGACTGCGCCGACGCCGGCCGACGGCAGTCCGCGGATGCAACGGGCACC
GACGGACGAGCAGCAACCACAAGGGCGGCCAAAGCAGTGGACCGAGCTGCCGCCCCGACAGCGCGACAGGCGAGC
CATGGCGGGCAGGCCCATGCTCTCCATGGCGTCGGCGGCGGCATCGGCATCGCCCCGGAACTCGCTGACGTCGCA
GGATGACGCCTCGGACGATTCGACGGCGCGGCCAGTCATTCCCTCGCTGCAGCCGGCCAAGAGCTGGGCCGATGT
GGCAAAGCTGGAGGAGGCTCAGCGGCGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail