Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7577
Gene name
LocationContig_980:82..1165
Strand-
Gene length (bp)1083
Transcript length (bp)903
Coding sequence length (bp)903
Protein length (aa) 301

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05182 Fip1 Fip1 motif 6.2E-19 170 212

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IF44|FIP1_GIBZE Pre-mRNA polyadenylation factor FIP1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=FIP1 PE=3 SV=2 8 291 2.0E-77
sp|Q7SAX8|FIP1_NEUCR Pre-mRNA polyadenylation factor fip-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=fip-1 PE=3 SV=1 62 233 6.0E-37
sp|Q4WM95|FIP1_ASPFU Pre-mRNA polyadenylation factor fip1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=fip1 PE=3 SV=1 97 284 2.0E-32
sp|Q5BAJ7|FIP1_EMENI Pre-mRNA polyadenylation factor fip1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=fip1 PE=3 SV=2 148 284 4.0E-26
sp|Q6BGR9|FIP1_DEBHA Pre-mRNA polyadenylation factor FIP1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=FIP1 PE=3 SV=2 129 241 2.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IF44|FIP1_GIBZE Pre-mRNA polyadenylation factor FIP1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=FIP1 PE=3 SV=2 8 291 2.0E-77
sp|Q7SAX8|FIP1_NEUCR Pre-mRNA polyadenylation factor fip-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=fip-1 PE=3 SV=1 62 233 6.0E-37
sp|Q4WM95|FIP1_ASPFU Pre-mRNA polyadenylation factor fip1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=fip1 PE=3 SV=1 97 284 2.0E-32
sp|Q5BAJ7|FIP1_EMENI Pre-mRNA polyadenylation factor fip1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=fip1 PE=3 SV=2 148 284 4.0E-26
sp|Q6BGR9|FIP1_DEBHA Pre-mRNA polyadenylation factor FIP1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=FIP1 PE=3 SV=2 129 241 2.0E-17
sp|Q09801|FIP1X_SCHPO Pre-mRNA polyadenylation factor fip1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC22G7.10 PE=3 SV=1 51 223 5.0E-16
sp|Q5AGC1|FIP1_CANAL Pre-mRNA polyadenylation factor FIP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=FIP1 PE=3 SV=1 146 254 4.0E-15
sp|Q6C784|FIP1_YARLI Pre-mRNA polyadenylation factor FIP1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=FIP1 PE=3 SV=1 152 215 6.0E-15
sp|Q751K8|FIP1_ASHGO Pre-mRNA polyadenylation factor FIP1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=FIP1 PE=3 SV=1 134 255 1.0E-12
sp|P45976|FIP1_YEAST Pre-mRNA polyadenylation factor FIP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FIP1 PE=1 SV=1 129 215 2.0E-12
sp|Q6CPC3|FIP1_KLULA Pre-mRNA polyadenylation factor FIP1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=FIP1 PE=3 SV=1 152 220 9.0E-12
sp|Q6FJ55|FIP1_CANGA Pre-mRNA polyadenylation factor FIP1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=FIP1 PE=3 SV=1 141 215 1.0E-11
sp|Q5U317|FIP1_RAT Pre-mRNA 3'-end-processing factor FIP1 OS=Rattus norvegicus GN=Fip1l1 PE=1 SV=1 159 243 1.0E-09
sp|Q9D824|FIP1_MOUSE Pre-mRNA 3'-end-processing factor FIP1 OS=Mus musculus GN=Fip1l1 PE=1 SV=1 159 243 2.0E-09
sp|Q5RAA7|FIP1_PONAB Pre-mRNA 3'-end-processing factor FIP1 OS=Pongo abelii GN=FIP1L1 PE=2 SV=1 159 212 2.0E-09
sp|Q6UN15|FIP1_HUMAN Pre-mRNA 3'-end-processing factor FIP1 OS=Homo sapiens GN=FIP1L1 PE=1 SV=1 159 212 2.0E-09
sp|Q5XJD3|FIP1_DANRE Pre-mRNA 3'-end-processing factor FIP1 OS=Danio rerio GN=fip1l1 PE=1 SV=1 131 212 3.0E-09
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7577
MADQETRMDESDDIYEPEEPKAEDEEVQDAPPKTEELEEGEEEDEKGAMDEDDDDSDIDIITERKDGTKAAPPPY
VMDYHTRRGWNIDGGAGDRQAKYSEIRNIPQRSTASADVPVKPPPPKRDEASRAATNLAVPSADQTSAAASKSSI
DININPIYGSVGKPITQINIDQDLADKEKPWRKPGTDISDYFNYDFDEFTWALYAAKQESIRGEYGAEAFAASNK
KMMDDFNNMMMMGGMGGNGGNGGNGAGGGMPGMEGMPPEMQAMMQQMMASGMDPSQMDPSQLSAMLWRWTGRLWL
*
Coding >Ophun1|7577
ATGGCCGATCAAGAAACGCGGATGGACGAGAGCGACGATATCTACGAACCGGAAGAGCCTAAAGCTGAAGACGAG
GAGGTCCAGGATGCGCCGCCTAAGACGGAGGAGCTGGAGGAGGGAGAGGAGGAGGATGAAAAGGGCGCCATGGAT
GAGGATGACGATGATTCTGATATAGATATAATCACGGAGAGGAAAGATGGGACAAAGGCTGCGCCTCCGCCGTAT
GTTATGGACTACCATACTCGTCGTGGATGGAATATTGACGGGGGTGCTGGCGATAGGCAAGCGAAATACAGCGAG
ATTCGGAATATCCCGCAGCGGTCGACGGCTTCGGCTGATGTGCCGGTTAAGCCTCCACCTCCGAAACGGGATGAG
GCATCGCGCGCTGCGACCAATCTGGCGGTTCCCAGCGCGGATCAGACGTCTGCGGCGGCGTCCAAGTCGAGCATC
GACATTAACATCAACCCCATCTACGGGAGTGTTGGGAAGCCGATCACGCAGATCAACATTGATCAGGATCTGGCG
GACAAGGAGAAGCCGTGGCGCAAACCGGGGACGGACATTAGCGATTACTTCAACTACGACTTTGACGAGTTCACC
TGGGCGCTGTACGCGGCGAAGCAGGAGAGCATTCGGGGAGAGTACGGAGCCGAGGCATTCGCAGCCAGCAACAAG
AAGATGATGGATGACTTTAACAACATGATGATGATGGGCGGCATGGGCGGCAACGGCGGCAACGGAGGGAACGGT
GCTGGAGGTGGCATGCCAGGCATGGAAGGCATGCCCCCCGAGATGCAGGCCATGATGCAGCAGATGATGGCCTCG
GGCATGGACCCTTCGCAGATGGACCCCAGCCAGCTGAGCGCCATGCTTTGGCGGTGGACAGGGCGGCTATGGCTT
TGA
Transcript >Ophun1|7577
ATGGCCGATCAAGAAACGCGGATGGACGAGAGCGACGATATCTACGAACCGGAAGAGCCTAAAGCTGAAGACGAG
GAGGTCCAGGATGCGCCGCCTAAGACGGAGGAGCTGGAGGAGGGAGAGGAGGAGGATGAAAAGGGCGCCATGGAT
GAGGATGACGATGATTCTGATATAGATATAATCACGGAGAGGAAAGATGGGACAAAGGCTGCGCCTCCGCCGTAT
GTTATGGACTACCATACTCGTCGTGGATGGAATATTGACGGGGGTGCTGGCGATAGGCAAGCGAAATACAGCGAG
ATTCGGAATATCCCGCAGCGGTCGACGGCTTCGGCTGATGTGCCGGTTAAGCCTCCACCTCCGAAACGGGATGAG
GCATCGCGCGCTGCGACCAATCTGGCGGTTCCCAGCGCGGATCAGACGTCTGCGGCGGCGTCCAAGTCGAGCATC
GACATTAACATCAACCCCATCTACGGGAGTGTTGGGAAGCCGATCACGCAGATCAACATTGATCAGGATCTGGCG
GACAAGGAGAAGCCGTGGCGCAAACCGGGGACGGACATTAGCGATTACTTCAACTACGACTTTGACGAGTTCACC
TGGGCGCTGTACGCGGCGAAGCAGGAGAGCATTCGGGGAGAGTACGGAGCCGAGGCATTCGCAGCCAGCAACAAG
AAGATGATGGATGACTTTAACAACATGATGATGATGGGCGGCATGGGCGGCAACGGCGGCAACGGAGGGAACGGT
GCTGGAGGTGGCATGCCAGGCATGGAAGGCATGCCCCCCGAGATGCAGGCCATGATGCAGCAGATGATGGCCTCG
GGCATGGACCCTTCGCAGATGGACCCCAGCCAGCTGAGCGCCATGCTTTGGCGGTGGACAGGGCGGCTATGGCTT
TGA
Gene >Ophun1|7577
ATGGCCGATCAAGAAACGCGGATGGACGAGAGCGACGATATCTACGAACCGGAAGAGCCTAAAGCTGAAGACGAG
GAGGTCCAGGATGCGCCGCCTAAGACGGAGGAGCTGGAGGAGGGAGAGGAGGAGGATGAAAAGGGCGCCATGGAT
GAGGATGACGATGATTCTGTGCGTTGGCTGGAGGTTTCTGCGTGACGGTTGCTGATGATTCTTGCAGGATATAGA
TATAATCACGGAGAGGAAAGATGGGACAAAGGCTGCGCCTCCGCCGTATGTTATGGACTACCATACTCGTCGTGG
ATGGAATATTGACGGGGGTGCTGGCGATAGGCAAGCGAAATACAGCGAGATTCGGAATATCCCGCAGCGGTCGAC
GGCTTCGGCTGATGTGCCGGTTAAGCCTCCACCTCCGAAACGGGATGAGGCATCGCGCGCTGCGACCAATCTGGC
GGTTCCCAGCGCGGATCAGACGTCTGCGGCGGCGTCCAAGTCGAGCATCGACATTAACATCAACCCCATCTACGG
GAGTGTTGGGAAGCCGATCACGCAGATCAACATTGATCAGGGTTCGCGATCTTCTGTCATGTTTCTTCGGATTCT
TGCTGATGGGGGATTCGTAGATCTGGCGGACAAGGAGAAGCCGTGGCGCAAACCGGGGACGGACATTAGCGATTA
CTTCAACTACGACTTTGACGAGTTCACCTGGGCGCTGTACGCGGCGAAGCAGGAGAGCATTCGGGGAGAGTACGG
AGCCGAGGCATTCGCAGCCAGCAACAAGAAGATGATGGATGACTTTAACAACATGATGATGATGGGCGGCATGGG
CGGCAACGGCGGCAACGGAGGGAACGGTGCTGGAGGTGGCATGCCAGGCATGGAAGGCATGCCCCCCGAGATGCA
GGCCATGATGCAGCAGATGATGGCCTCGGGCATGGACCCTTCGCAGATGGACCCCAGCCAGCTGAGCGCCATGTG
CGCCGGCATGCAGGGCGGCATGGGCGGCGGCGGCGCGGGAGGCGGACAGGGAAACCAGGGGGGTAACTTTGCAGG
CTTTGGCGGTGGACAGGGCGGCTATGGCTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail