Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7575
Gene name
LocationContig_98:34128..37180
Strand-
Gene length (bp)3052
Transcript length (bp)2994
Coding sequence length (bp)2994
Protein length (aa) 998

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16661 Lactamase_B_6 Metallo-beta-lactamase superfamily domain 4.0E-63 20 248
PF13299 CPSF100_C Cleavage and polyadenylation factor 2 C-terminal 2.4E-50 800 991
PF10996 Beta-Casp Beta-Casp domain 8.9E-17 294 432
PF07521 RMMBL Zn-dependent metallo-hydrolase RNA specificity domain 7.7E-15 719 783

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74740|CFT2_SCHPO Cleavage factor two protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cft2 PE=1 SV=1 21 994 3.0E-75
sp|O35218|CPSF2_MOUSE Cleavage and polyadenylation specificity factor subunit 2 OS=Mus musculus GN=Cpsf2 PE=1 SV=1 11 994 4.0E-73
sp|Q10568|CPSF2_BOVIN Cleavage and polyadenylation specificity factor subunit 2 OS=Bos taurus GN=CPSF2 PE=1 SV=1 11 994 2.0E-72
sp|Q9P2I0|CPSF2_HUMAN Cleavage and polyadenylation specificity factor subunit 2 OS=Homo sapiens GN=CPSF2 PE=1 SV=2 11 994 8.0E-72
sp|Q9W799|CPSF2_XENLA Cleavage and polyadenylation specificity factor subunit 2 OS=Xenopus laevis GN=cpsf2 PE=1 SV=1 7 994 2.0E-58
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74740|CFT2_SCHPO Cleavage factor two protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cft2 PE=1 SV=1 21 994 3.0E-75
sp|O35218|CPSF2_MOUSE Cleavage and polyadenylation specificity factor subunit 2 OS=Mus musculus GN=Cpsf2 PE=1 SV=1 11 994 4.0E-73
sp|Q10568|CPSF2_BOVIN Cleavage and polyadenylation specificity factor subunit 2 OS=Bos taurus GN=CPSF2 PE=1 SV=1 11 994 2.0E-72
sp|Q9P2I0|CPSF2_HUMAN Cleavage and polyadenylation specificity factor subunit 2 OS=Homo sapiens GN=CPSF2 PE=1 SV=2 11 994 8.0E-72
sp|Q9W799|CPSF2_XENLA Cleavage and polyadenylation specificity factor subunit 2 OS=Xenopus laevis GN=cpsf2 PE=1 SV=1 7 994 2.0E-58
sp|Q9V3D6|CPSF2_DROME Probable cleavage and polyadenylation specificity factor subunit 2 OS=Drosophila melanogaster GN=Cpsf100 PE=1 SV=1 7 994 3.0E-58
sp|A8XUS3|CPSF2_CAEBR Probable cleavage and polyadenylation specificity factor subunit 2 OS=Caenorhabditis briggsae GN=cpsf-2 PE=3 SV=2 19 956 5.0E-51
sp|Q55BS1|CPSF2_DICDI Cleavage and polyadenylation specificity factor subunit 2 OS=Dictyostelium discoideum GN=cpsf2 PE=3 SV=1 1 512 1.0E-40
sp|Q9LKF9|CPSF2_ARATH Cleavage and polyadenylation specificity factor subunit 2 OS=Arabidopsis thaliana GN=CPSF100 PE=1 SV=2 6 632 1.0E-40
sp|O17403|CPSF2_CAEEL Probable cleavage and polyadenylation specificity factor subunit 2 OS=Caenorhabditis elegans GN=cpsf-2 PE=3 SV=1 19 616 5.0E-40
sp|Q652P4|CPSF2_ORYSJ Cleavage and polyadenylation specificity factor subunit 2 OS=Oryza sativa subsp. japonica GN=Os09g0569400 PE=2 SV=1 6 432 1.0E-36
sp|Q12102|CFT2_YEAST Cleavage factor two protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CFT2 PE=1 SV=1 26 351 6.0E-25
sp|O17403|CPSF2_CAEEL Probable cleavage and polyadenylation specificity factor subunit 2 OS=Caenorhabditis elegans GN=cpsf-2 PE=3 SV=1 698 994 6.0E-14
sp|Q6C2Z7|YSH1_YARLI Endoribonuclease YSH1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YSH1 PE=3 SV=2 2 430 7.0E-12
sp|Q2YDM2|INT11_BOVIN Integrator complex subunit 11 OS=Bos taurus GN=CPSF3L PE=2 SV=2 175 440 4.0E-11
sp|P0CM89|YSH1_CRYNB Endoribonuclease YSH1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=YSH1 PE=3 SV=1 174 430 6.0E-11
sp|P0CM88|YSH1_CRYNJ Endoribonuclease YSH1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=YSH1 PE=3 SV=1 174 430 6.0E-11
sp|Q5ZIH0|INT11_CHICK Integrator complex subunit 11 OS=Gallus gallus GN=CPSF3L PE=2 SV=1 175 440 1.0E-10
sp|Q5NVE6|INT11_PONAB Integrator complex subunit 11 OS=Pongo abelii GN=CPSF3L PE=2 SV=2 175 440 2.0E-10
sp|Q5TA45|INT11_HUMAN Integrator complex subunit 11 OS=Homo sapiens GN=CPSF3L PE=1 SV=2 175 440 2.0E-10
sp|Q9CWS4|INT11_MOUSE Integrator complex subunit 11 OS=Mus musculus GN=Cpsf3l PE=1 SV=1 175 440 2.0E-10
sp|Q3MHC2|INT11_RAT Integrator complex subunit 11 OS=Rattus norvegicus GN=Cpsf3l PE=2 SV=1 175 440 2.0E-10
sp|Q503E1|INT11_DANRE Integrator complex subunit 11 OS=Danio rerio GN=cpsf3l PE=2 SV=1 175 440 5.0E-10
sp|Q54YL3|INT11_DICDI Integrator complex subunit 11 homolog OS=Dictyostelium discoideum GN=ints11 PE=3 SV=1 175 440 1.0E-09
sp|Q5BEP0|YSH1_EMENI Endoribonuclease ysh1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ysh1 PE=3 SV=1 48 430 1.0E-09
sp|Q59P50|YSH1_CANAL Endoribonuclease YSH1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=YSH1 PE=3 SV=1 48 430 2.0E-09
sp|Q4WRC2|YSH1_ASPFU Endoribonuclease ysh1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ysh1 PE=3 SV=1 53 430 3.0E-09
sp|Q86A79|CPSF3_DICDI Cleavage and polyadenylation specificity factor subunit 3 OS=Dictyostelium discoideum GN=cpsf3 PE=3 SV=1 9 460 5.0E-09
sp|Q74ZC0|YSH1_ASHGO Endoribonuclease YSH1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=YSH1 PE=3 SV=2 23 430 2.0E-08
sp|Q8GUU3|CPS3B_ARATH Cleavage and polyadenylation specificity factor subunit 3-II OS=Arabidopsis thaliana GN=CPSF73-II PE=1 SV=2 175 440 1.0E-07
sp|Q6CUI5|YSH1_KLULA Endoribonuclease YSH1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=YSH1 PE=3 SV=1 21 430 1.0E-07
sp|Q55BS1|CPSF2_DICDI Cleavage and polyadenylation specificity factor subunit 2 OS=Dictyostelium discoideum GN=cpsf2 PE=3 SV=1 706 834 2.0E-07
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2553
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5972
Ophiocordyceps australis map64 (Brazil) OphauB2|2844
Ophiocordyceps camponoti-floridani Ophcf2|00565
Ophiocordyceps camponoti-rufipedis Ophun1|7575 (this protein)
Ophiocordyceps kimflemingae Ophio5|1215
Ophiocordyceps subramaniannii Hirsu2|3782

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7575
MFSFCPLQGALSESTASQYLLELDGGVKVLVDLGWDESFDVDKLEELEKHVPTLSLILLTHATVSHLAAYVHCCK
NIPLFTRVPAYATRPVIDLGRSLSQDLYSSTPAASTTISQSSLSDLAYSFSQTAPTAQNLLLESPTPDEIARYFS
LIQPLKYSQPHQPLPSPFSPPLNGLTITAYNAGHTLGGTIWHIQHGLESIVYAVDWNQARENVFAGAAWLDGGGS
GGGGGGGGGAEVIEQLRKPTALVCSSRGAQRSAQVGGRVKRDDMLIDMIKACVSKRGTVLIPVDSSARVLEMAYL
LEHAWRADAASPDGTLKSAKLYLAGRNMSSTMRYARSMLEWMDKNIVQEFEACAEGQRRANGPAGDSKDGGPFDF
RHLRLVERKAQVARLLSSEGQGRVILASDTSMEWGFSRDLIKGLAADPDNLVILTDKPGMARDGSPSIARRLWEW
WRERRDGVQVTQTASGDSVETVYSGGRELEIREATRRALEGDQLAVYQQWLATQRQLQATQQAGGAAALEASADV
DDASSESSSDSDDDEGQQQGKALTVSATMGQAGRKNVVLKDEDLGINVLLKKKGVYDFDSRGKRGRDRCFPMPIR
RKRNDDFGELVRPEDYLRAEEKDEDNGGEGGDEAAEDDKPGKKRKWDDVAKQASGRPRKRLQMGGPRAPLAAAAA
PVSDEADGGDGAEHDDLDAVDEPEPEEPKGPCKAVYSSEVVTAKLRIGFVDFSGLHDRRSLDMLIPLIQPRKLIL
VGGNREETTALAADCRAALGLEGSDKAVDVFTPEVGVWVDASVDTNAWIVRLADALVKKLKWQKVRGLSIVTISG
QLLAVEGSSSSGNNDGDVMKMNRTGEGEGNDDDEDGNDKGDDDDDDGAPSAKRLKTDPATAMALTTSTPPTALPV
LEAVPPNRLSATRTAAQPLHVGDLRLADLRRAMQGDGHGAEFRGEGMLVVDGTVAVRKTTEGRVEVESVGLPALG
RRSTVYAVKKAIYDGLAVVAGA*
Coding >Ophun1|7575
ATGTTTTCCTTCTGTCCGCTTCAGGGCGCCCTCTCGGAGTCGACCGCCTCGCAGTACCTCCTCGAGCTCGACGGC
GGAGTCAAAGTCCTCGTCGACTTGGGCTGGGACGAATCCTTCGACGTCGACAAGCTTGAAGAGCTGGAAAAACAT
GTCCCCACGCTCTCGCTCATCCTCCTCACCCACGCCACCGTCTCCCATCTCGCCGCCTACGTCCACTGCTGCAAG
AACATACCTCTCTTCACCCGCGTCCCGGCCTACGCAACCCGTCCCGTCATCGATCTAGGCCGCTCACTGAGTCAG
GATCTCTACTCGTCTACGCCCGCCGCCTCGACGACAATCTCCCAGAGCTCGCTCTCCGACCTGGCCTACTCCTTT
TCCCAGACGGCTCCGACGGCGCAGAATCTCCTGCTCGAGTCGCCGACCCCCGACGAGATTGCCCGGTATTTTTCC
CTCATACAGCCTCTCAAATACTCGCAGCCCCATCAGCCGCTGCCCTCGCCCTTCTCCCCGCCCCTCAATGGTTTG
ACCATCACGGCTTACAATGCCGGCCACACCCTAGGCGGCACCATCTGGCATATCCAGCACGGCCTCGAGTCCATC
GTCTACGCCGTCGACTGGAATCAAGCTCGGGAAAACGTCTTTGCCGGTGCCGCCTGGCTTGATGGAGGTGGCAGC
GGCGGCGGTGGTGGCGGTGGTGGCGGAGCCGAGGTCATCGAACAGTTGCGCAAGCCGACGGCGCTCGTATGCAGC
AGTCGAGGTGCCCAGAGGAGCGCGCAGGTGGGCGGACGCGTCAAGAGGGACGACATGCTCATCGACATGATCAAG
GCCTGTGTCTCGAAGCGAGGAACCGTGCTGATTCCCGTCGACTCTAGCGCTCGCGTCCTCGAGATGGCCTACCTC
CTCGAGCACGCCTGGAGGGCCGACGCCGCCTCCCCGGACGGCACGCTCAAGTCGGCCAAGCTGTATCTTGCTGGC
CGCAACATGTCGAGCACCATGCGCTACGCCAGAAGCATGCTGGAGTGGATGGACAAGAACATTGTCCAGGAGTTC
GAAGCTTGCGCTGAGGGGCAGCGAAGGGCCAATGGACCTGCTGGCGACAGTAAGGACGGCGGGCCCTTTGACTTT
AGACACCTGCGCCTGGTCGAGCGAAAGGCGCAGGTGGCCAGGCTGCTGAGTAGCGAGGGACAGGGCCGCGTCATT
CTCGCCAGCGACACCAGCATGGAATGGGGCTTCTCCAGGGATCTGATCAAGGGCCTGGCCGCCGATCCAGACAAC
CTCGTCATCCTCACCGACAAGCCCGGCATGGCCCGCGACGGCAGCCCTTCGATCGCGAGGAGGCTATGGGAGTGG
TGGAGGGAGAGGCGAGACGGCGTTCAGGTGACGCAGACGGCGAGCGGCGACAGCGTCGAGACGGTCTACAGCGGC
GGACGCGAACTCGAGATCCGGGAGGCGACTCGGCGGGCGCTCGAGGGCGACCAGCTGGCTGTCTATCAGCAATGG
CTCGCCACTCAGAGGCAGCTTCAGGCGACGCAGCAGGCGGGCGGAGCGGCGGCCCTGGAGGCCTCAGCCGACGTC
GACGATGCCTCGTCTGAATCCTCGTCGGACTCGGACGACGACGAGGGCCAGCAGCAGGGCAAGGCGCTGACCGTG
TCGGCTACCATGGGCCAGGCCGGACGCAAGAACGTGGTGCTCAAAGACGAAGACCTCGGCATCAACGTGCTGCTT
AAGAAGAAGGGCGTCTACGACTTTGACTCGCGCGGGAAGAGAGGCCGCGACCGGTGCTTCCCGATGCCGATCCGA
CGGAAGCGCAACGACGACTTTGGCGAGCTGGTCCGGCCGGAAGACTACCTCCGGGCCGAGGAGAAGGATGAAGAC
AACGGCGGCGAAGGCGGCGACGAGGCTGCCGAGGACGACAAGCCGGGAAAGAAGCGCAAGTGGGACGACGTCGCC
AAGCAGGCCTCGGGCCGGCCGAGGAAGCGCCTTCAGATGGGCGGACCGAGAGCTCCGTTGGCGGCGGCGGCGGCA
CCGGTTTCGGACGAGGCCGACGGCGGCGACGGAGCGGAGCACGATGACCTGGACGCCGTGGACGAGCCGGAGCCG
GAAGAGCCCAAGGGTCCGTGCAAGGCCGTGTACAGCTCCGAGGTGGTGACGGCCAAGCTGCGCATCGGCTTCGTC
GATTTCAGCGGGCTACACGACCGACGAAGCCTCGACATGCTCATCCCCCTGATCCAGCCTCGCAAGCTGATACTC
GTCGGCGGCAACCGGGAAGAGACGACGGCGCTGGCGGCAGACTGTCGGGCAGCACTGGGACTGGAAGGGAGCGAC
AAGGCCGTCGACGTCTTTACGCCCGAGGTCGGAGTCTGGGTGGACGCCAGCGTGGATACAAACGCCTGGATCGTC
CGGCTGGCGGACGCGCTGGTCAAGAAGCTCAAGTGGCAAAAGGTACGGGGGCTGAGTATCGTCACCATCAGTGGC
CAGTTGCTGGCGGTTGAAGGCAGCAGCAGCAGCGGGAACAACGATGGCGACGTCATGAAGATGAACAGAACCGGC
GAAGGCGAGGGCAACGACGACGATGAAGACGGCAACGATAAAGGAGACGACGACGACGACGACGGGGCACCATCG
GCGAAGCGTCTCAAGACGGACCCAGCCACCGCCATGGCCCTCACAACATCAACCCCCCCCACAGCCCTCCCCGTC
CTCGAAGCCGTGCCCCCGAACCGACTCTCAGCAACGCGGACGGCAGCCCAGCCGCTACACGTGGGCGATCTCCGG
CTGGCCGACCTGCGGCGGGCCATGCAGGGGGACGGACACGGGGCCGAGTTCCGGGGCGAGGGCATGCTCGTCGTC
GATGGCACCGTCGCTGTCCGCAAGACGACGGAGGGGAGGGTCGAGGTTGAGAGCGTTGGGCTGCCGGCCTTGGGG
AGGCGGAGTACCGTCTATGCTGTTAAGAAGGCGATTTACGATGGGTTGGCTGTGGTGGCGGGCGCGTGA
Transcript >Ophun1|7575
ATGTTTTCCTTCTGTCCGCTTCAGGGCGCCCTCTCGGAGTCGACCGCCTCGCAGTACCTCCTCGAGCTCGACGGC
GGAGTCAAAGTCCTCGTCGACTTGGGCTGGGACGAATCCTTCGACGTCGACAAGCTTGAAGAGCTGGAAAAACAT
GTCCCCACGCTCTCGCTCATCCTCCTCACCCACGCCACCGTCTCCCATCTCGCCGCCTACGTCCACTGCTGCAAG
AACATACCTCTCTTCACCCGCGTCCCGGCCTACGCAACCCGTCCCGTCATCGATCTAGGCCGCTCACTGAGTCAG
GATCTCTACTCGTCTACGCCCGCCGCCTCGACGACAATCTCCCAGAGCTCGCTCTCCGACCTGGCCTACTCCTTT
TCCCAGACGGCTCCGACGGCGCAGAATCTCCTGCTCGAGTCGCCGACCCCCGACGAGATTGCCCGGTATTTTTCC
CTCATACAGCCTCTCAAATACTCGCAGCCCCATCAGCCGCTGCCCTCGCCCTTCTCCCCGCCCCTCAATGGTTTG
ACCATCACGGCTTACAATGCCGGCCACACCCTAGGCGGCACCATCTGGCATATCCAGCACGGCCTCGAGTCCATC
GTCTACGCCGTCGACTGGAATCAAGCTCGGGAAAACGTCTTTGCCGGTGCCGCCTGGCTTGATGGAGGTGGCAGC
GGCGGCGGTGGTGGCGGTGGTGGCGGAGCCGAGGTCATCGAACAGTTGCGCAAGCCGACGGCGCTCGTATGCAGC
AGTCGAGGTGCCCAGAGGAGCGCGCAGGTGGGCGGACGCGTCAAGAGGGACGACATGCTCATCGACATGATCAAG
GCCTGTGTCTCGAAGCGAGGAACCGTGCTGATTCCCGTCGACTCTAGCGCTCGCGTCCTCGAGATGGCCTACCTC
CTCGAGCACGCCTGGAGGGCCGACGCCGCCTCCCCGGACGGCACGCTCAAGTCGGCCAAGCTGTATCTTGCTGGC
CGCAACATGTCGAGCACCATGCGCTACGCCAGAAGCATGCTGGAGTGGATGGACAAGAACATTGTCCAGGAGTTC
GAAGCTTGCGCTGAGGGGCAGCGAAGGGCCAATGGACCTGCTGGCGACAGTAAGGACGGCGGGCCCTTTGACTTT
AGACACCTGCGCCTGGTCGAGCGAAAGGCGCAGGTGGCCAGGCTGCTGAGTAGCGAGGGACAGGGCCGCGTCATT
CTCGCCAGCGACACCAGCATGGAATGGGGCTTCTCCAGGGATCTGATCAAGGGCCTGGCCGCCGATCCAGACAAC
CTCGTCATCCTCACCGACAAGCCCGGCATGGCCCGCGACGGCAGCCCTTCGATCGCGAGGAGGCTATGGGAGTGG
TGGAGGGAGAGGCGAGACGGCGTTCAGGTGACGCAGACGGCGAGCGGCGACAGCGTCGAGACGGTCTACAGCGGC
GGACGCGAACTCGAGATCCGGGAGGCGACTCGGCGGGCGCTCGAGGGCGACCAGCTGGCTGTCTATCAGCAATGG
CTCGCCACTCAGAGGCAGCTTCAGGCGACGCAGCAGGCGGGCGGAGCGGCGGCCCTGGAGGCCTCAGCCGACGTC
GACGATGCCTCGTCTGAATCCTCGTCGGACTCGGACGACGACGAGGGCCAGCAGCAGGGCAAGGCGCTGACCGTG
TCGGCTACCATGGGCCAGGCCGGACGCAAGAACGTGGTGCTCAAAGACGAAGACCTCGGCATCAACGTGCTGCTT
AAGAAGAAGGGCGTCTACGACTTTGACTCGCGCGGGAAGAGAGGCCGCGACCGGTGCTTCCCGATGCCGATCCGA
CGGAAGCGCAACGACGACTTTGGCGAGCTGGTCCGGCCGGAAGACTACCTCCGGGCCGAGGAGAAGGATGAAGAC
AACGGCGGCGAAGGCGGCGACGAGGCTGCCGAGGACGACAAGCCGGGAAAGAAGCGCAAGTGGGACGACGTCGCC
AAGCAGGCCTCGGGCCGGCCGAGGAAGCGCCTTCAGATGGGCGGACCGAGAGCTCCGTTGGCGGCGGCGGCGGCA
CCGGTTTCGGACGAGGCCGACGGCGGCGACGGAGCGGAGCACGATGACCTGGACGCCGTGGACGAGCCGGAGCCG
GAAGAGCCCAAGGGTCCGTGCAAGGCCGTGTACAGCTCCGAGGTGGTGACGGCCAAGCTGCGCATCGGCTTCGTC
GATTTCAGCGGGCTACACGACCGACGAAGCCTCGACATGCTCATCCCCCTGATCCAGCCTCGCAAGCTGATACTC
GTCGGCGGCAACCGGGAAGAGACGACGGCGCTGGCGGCAGACTGTCGGGCAGCACTGGGACTGGAAGGGAGCGAC
AAGGCCGTCGACGTCTTTACGCCCGAGGTCGGAGTCTGGGTGGACGCCAGCGTGGATACAAACGCCTGGATCGTC
CGGCTGGCGGACGCGCTGGTCAAGAAGCTCAAGTGGCAAAAGGTACGGGGGCTGAGTATCGTCACCATCAGTGGC
CAGTTGCTGGCGGTTGAAGGCAGCAGCAGCAGCGGGAACAACGATGGCGACGTCATGAAGATGAACAGAACCGGC
GAAGGCGAGGGCAACGACGACGATGAAGACGGCAACGATAAAGGAGACGACGACGACGACGACGGGGCACCATCG
GCGAAGCGTCTCAAGACGGACCCAGCCACCGCCATGGCCCTCACAACATCAACCCCCCCCACAGCCCTCCCCGTC
CTCGAAGCCGTGCCCCCGAACCGACTCTCAGCAACGCGGACGGCAGCCCAGCCGCTACACGTGGGCGATCTCCGG
CTGGCCGACCTGCGGCGGGCCATGCAGGGGGACGGACACGGGGCCGAGTTCCGGGGCGAGGGCATGCTCGTCGTC
GATGGCACCGTCGCTGTCCGCAAGACGACGGAGGGGAGGGTCGAGGTTGAGAGCGTTGGGCTGCCGGCCTTGGGG
AGGCGGAGTACCGTCTATGCTGTTAAGAAGGCGATTTACGATGGGTTGGCTGTGGTGGCGGGCGCGTGA
Gene >Ophun1|7575
ATGTTTTCCTTCTGTCCGCTTCAGGGCGCCCTCTCGGAGTCGACCGCCTCGCAGTACCTCCTCGAGCTCGACGGC
GGAGTCAAAGTCCTCGTCGACTTGGGCTGGGACGAATCCTTCGACGTCGACAAGCTTGAAGAGCTGGAAAAGTGA
GAGACTCGCCCGATTAACCCTCGCCCCTACGCGCCTGACTGACTGAGAAATAAGACATGTCCCCACGCTCTCGCT
CATCCTCCTCACCCACGCCACCGTCTCCCATCTCGCCGCCTACGTCCACTGCTGCAAGAACATACCTCTCTTCAC
CCGCGTCCCGGCCTACGCAACCCGTCCCGTCATCGATCTAGGCCGCTCACTGAGTCAGGATCTCTACTCGTCTAC
GCCCGCCGCCTCGACGACAATCTCCCAGAGCTCGCTCTCCGACCTGGCCTACTCCTTTTCCCAGACGGCTCCGAC
GGCGCAGAATCTCCTGCTCGAGTCGCCGACCCCCGACGAGATTGCCCGGTATTTTTCCCTCATACAGCCTCTCAA
ATACTCGCAGCCCCATCAGCCGCTGCCCTCGCCCTTCTCCCCGCCCCTCAATGGTTTGACCATCACGGCTTACAA
TGCCGGCCACACCCTAGGCGGCACCATCTGGCATATCCAGCACGGCCTCGAGTCCATCGTCTACGCCGTCGACTG
GAATCAAGCTCGGGAAAACGTCTTTGCCGGTGCCGCCTGGCTTGATGGAGGTGGCAGCGGCGGCGGTGGTGGCGG
TGGTGGCGGAGCCGAGGTCATCGAACAGTTGCGCAAGCCGACGGCGCTCGTATGCAGCAGTCGAGGTGCCCAGAG
GAGCGCGCAGGTGGGCGGACGCGTCAAGAGGGACGACATGCTCATCGACATGATCAAGGCCTGTGTCTCGAAGCG
AGGAACCGTGCTGATTCCCGTCGACTCTAGCGCTCGCGTCCTCGAGATGGCCTACCTCCTCGAGCACGCCTGGAG
GGCCGACGCCGCCTCCCCGGACGGCACGCTCAAGTCGGCCAAGCTGTATCTTGCTGGCCGCAACATGTCGAGCAC
CATGCGCTACGCCAGAAGCATGCTGGAGTGGATGGACAAGAACATTGTCCAGGAGTTCGAAGCTTGCGCTGAGGG
GCAGCGAAGGGCCAATGGACCTGCTGGCGACAGTAAGGACGGCGGGCCCTTTGACTTTAGACACCTGCGCCTGGT
CGAGCGAAAGGCGCAGGTGGCCAGGCTGCTGAGTAGCGAGGGACAGGGCCGCGTCATTCTCGCCAGCGACACCAG
CATGGAATGGGGCTTCTCCAGGGATCTGATCAAGGGCCTGGCCGCCGATCCAGACAACCTCGTCATCCTCACCGA
CAAGCCCGGCATGGCCCGCGACGGCAGCCCTTCGATCGCGAGGAGGCTATGGGAGTGGTGGAGGGAGAGGCGAGA
CGGCGTTCAGGTGACGCAGACGGCGAGCGGCGACAGCGTCGAGACGGTCTACAGCGGCGGACGCGAACTCGAGAT
CCGGGAGGCGACTCGGCGGGCGCTCGAGGGCGACCAGCTGGCTGTCTATCAGCAATGGCTCGCCACTCAGAGGCA
GCTTCAGGCGACGCAGCAGGCGGGCGGAGCGGCGGCCCTGGAGGCCTCAGCCGACGTCGACGATGCCTCGTCTGA
ATCCTCGTCGGACTCGGACGACGACGAGGGCCAGCAGCAGGGCAAGGCGCTGACCGTGTCGGCTACCATGGGCCA
GGCCGGACGCAAGAACGTGGTGCTCAAAGACGAAGACCTCGGCATCAACGTGCTGCTTAAGAAGAAGGGCGTCTA
CGACTTTGACTCGCGCGGGAAGAGAGGCCGCGACCGGTGCTTCCCGATGCCGATCCGACGGAAGCGCAACGACGA
CTTTGGCGAGCTGGTCCGGCCGGAAGACTACCTCCGGGCCGAGGAGAAGGATGAAGACAACGGCGGCGAAGGCGG
CGACGAGGCTGCCGAGGACGACAAGCCGGGAAAGAAGCGCAAGTGGGACGACGTCGCCAAGCAGGCCTCGGGCCG
GCCGAGGAAGCGCCTTCAGATGGGCGGACCGAGAGCTCCGTTGGCGGCGGCGGCGGCACCGGTTTCGGACGAGGC
CGACGGCGGCGACGGAGCGGAGCACGATGACCTGGACGCCGTGGACGAGCCGGAGCCGGAAGAGCCCAAGGGTCC
GTGCAAGGCCGTGTACAGCTCCGAGGTGGTGACGGCCAAGCTGCGCATCGGCTTCGTCGATTTCAGCGGGCTACA
CGACCGACGAAGCCTCGACATGCTCATCCCCCTGATCCAGCCTCGCAAGCTGATACTCGTCGGCGGCAACCGGGA
AGAGACGACGGCGCTGGCGGCAGACTGTCGGGCAGCACTGGGACTGGAAGGGAGCGACAAGGCCGTCGACGTCTT
TACGCCCGAGGTCGGAGTCTGGGTGGACGCCAGCGTGGATACAAACGCCTGGATCGTCCGGCTGGCGGACGCGCT
GGTCAAGAAGCTCAAGTGGCAAAAGGTACGGGGGCTGAGTATCGTCACCATCAGTGGCCAGTTGCTGGCGGTTGA
AGGCAGCAGCAGCAGCGGGAACAACGATGGCGACGTCATGAAGATGAACAGAACCGGCGAAGGCGAGGGCAACGA
CGACGATGAAGACGGCAACGATAAAGGAGACGACGACGACGACGACGGGGCACCATCGGCGAAGCGTCTCAAGAC
GGACCCAGCCACCGCCATGGCCCTCACAACATCAACCCCCCCCACAGCCCTCCCCGTCCTCGAAGCCGTGCCCCC
GAACCGACTCTCAGCAACGCGGACGGCAGCCCAGCCGCTACACGTGGGCGATCTCCGGCTGGCCGACCTGCGGCG
GGCCATGCAGGGGGACGGACACGGGGCCGAGTTCCGGGGCGAGGGCATGCTCGTCGTCGATGGCACCGTCGCTGT
CCGCAAGACGACGGAGGGGAGGGTCGAGGTTGAGAGCGTTGGGCTGCCGGCCTTGGGGAGGCGGAGTACCGTCTA
TGCTGTTAAGAAGGCGATTTACGATGGGTTGGCTGTGGTGGCGGGCGCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail