Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7572
Gene name
LocationContig_98:26958..29759
Strand+
Gene length (bp)2801
Transcript length (bp)2688
Coding sequence length (bp)2688
Protein length (aa) 896

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01504 PIP5K Phosphatidylinositol-4-phosphate 5-Kinase 1.1E-103 390 708

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13853|ITS3_SCHPO Phosphatidylinositol 4-phosphate 5-kinase its3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=its3 PE=1 SV=3 184 707 0.0E+00
sp|P38994|MSS4_YEAST Probable phosphatidylinositol 4-phosphate 5-kinase MSS4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSS4 PE=1 SV=2 258 725 3.0E-135
sp|Q55GN6|Y7588_DICDI Probable phosphatidylinositol phosphate kinase DDB_G0267588 OS=Dictyostelium discoideum GN=DDB_G0267588 PE=1 SV=1 270 706 5.0E-74
sp|Q8L796|PI5K2_ARATH Phosphatidylinositol 4-phosphate 5-kinase 2 OS=Arabidopsis thaliana GN=PIP5K2 PE=1 SV=2 313 706 1.0E-62
sp|Q9SFB8|PI5K6_ARATH Phosphatidylinositol 4-phosphate 5-kinase 6 OS=Arabidopsis thaliana GN=PIP5K6 PE=2 SV=1 298 706 3.0E-62
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13853|ITS3_SCHPO Phosphatidylinositol 4-phosphate 5-kinase its3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=its3 PE=1 SV=3 184 707 0.0E+00
sp|P38994|MSS4_YEAST Probable phosphatidylinositol 4-phosphate 5-kinase MSS4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSS4 PE=1 SV=2 258 725 3.0E-135
sp|Q55GN6|Y7588_DICDI Probable phosphatidylinositol phosphate kinase DDB_G0267588 OS=Dictyostelium discoideum GN=DDB_G0267588 PE=1 SV=1 270 706 5.0E-74
sp|Q8L796|PI5K2_ARATH Phosphatidylinositol 4-phosphate 5-kinase 2 OS=Arabidopsis thaliana GN=PIP5K2 PE=1 SV=2 313 706 1.0E-62
sp|Q9SFB8|PI5K6_ARATH Phosphatidylinositol 4-phosphate 5-kinase 6 OS=Arabidopsis thaliana GN=PIP5K6 PE=2 SV=1 298 706 3.0E-62
sp|Q9M1K2|PI5K4_ARATH Phosphatidylinositol 4-phosphate 5-kinase 4 OS=Arabidopsis thaliana GN=PIP5K4 PE=3 SV=1 298 706 3.0E-62
sp|Q56YP2|PI5K1_ARATH Phosphatidylinositol 4-phosphate 5-kinase 1 OS=Arabidopsis thaliana GN=PIP5K1 PE=1 SV=1 313 706 1.0E-60
sp|Q9SLG9|PI5K5_ARATH Phosphatidylinositol 4-phosphate 5-kinase 5 OS=Arabidopsis thaliana GN=PIP5K5 PE=2 SV=1 298 706 6.0E-60
sp|Q9SUI2|PI5K7_ARATH Phosphatidylinositol 4-phosphate 5-kinase 7 OS=Arabidopsis thaliana GN=PIP5K7 PE=1 SV=1 307 706 7.0E-60
sp|O48709|PI5K3_ARATH Phosphatidylinositol 4-phosphate 5-kinase 3 OS=Arabidopsis thaliana GN=PIP5K3 PE=3 SV=1 307 706 2.0E-59
sp|O60331|PI51C_HUMAN Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma OS=Homo sapiens GN=PIP5K1C PE=1 SV=2 317 711 3.0E-58
sp|Q99755|PI51A_HUMAN Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha OS=Homo sapiens GN=PIP5K1A PE=1 SV=1 317 711 7.0E-58
sp|Q8RY89|PI5K8_ARATH Phosphatidylinositol 4-phosphate 5-kinase 8 OS=Arabidopsis thaliana GN=PIP5K8 PE=1 SV=1 313 706 2.0E-57
sp|D3ZSI8|PI51A_RAT Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha OS=Rattus norvegicus GN=Pip5k1a PE=2 SV=1 317 711 1.0E-56
sp|O70161|PI51C_MOUSE Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma OS=Mus musculus GN=Pip5k1c PE=1 SV=2 317 711 2.0E-56
sp|Q5I6B8|PI51C_RAT Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma OS=Rattus norvegicus GN=Pip5k1c PE=1 SV=1 317 711 7.0E-56
sp|P70182|PI51A_MOUSE Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha OS=Mus musculus GN=Pip5k1a PE=1 SV=2 317 711 2.0E-55
sp|Q6EX42|PI5K1_ORYSJ Phosphatidylinositol 4-phosphate 5-kinase 1 OS=Oryza sativa subsp. japonica GN=PIPK1 PE=2 SV=2 313 707 2.0E-54
sp|A2A3N6|PIPSL_HUMAN Putative PIP5K1A and PSMD4-like protein OS=Homo sapiens GN=PIPSL PE=5 SV=1 317 711 5.0E-53
sp|Q5CZZ9|PI51B_RAT Phosphatidylinositol 4-phosphate 5-kinase type-1 beta OS=Rattus norvegicus GN=Pip5k1b PE=1 SV=1 303 716 3.0E-51
sp|P70181|PI51B_MOUSE Phosphatidylinositol 4-phosphate 5-kinase type-1 beta OS=Mus musculus GN=Pip5k1b PE=1 SV=1 303 716 3.0E-51
sp|O14986|PI51B_HUMAN Phosphatidylinositol 4-phosphate 5-kinase type-1 beta OS=Homo sapiens GN=PIP5K1B PE=1 SV=2 303 716 5.0E-50
sp|Q5ZJ58|PI51B_CHICK Phosphatidylinositol 4-phosphate 5-kinase type-1 beta OS=Gallus gallus GN=PIP5K1B PE=2 SV=1 317 716 6.0E-50
sp|Q8L850|PI5K9_ARATH Phosphatidylinositol 4-phosphate 5-kinase 9 OS=Arabidopsis thaliana GN=PIP5K9 PE=1 SV=2 194 556 4.0E-49
sp|Q8TBX8|PI42C_HUMAN Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma OS=Homo sapiens GN=PIP4K2C PE=1 SV=3 337 708 3.0E-38
sp|Q0P5F7|PI42C_BOVIN Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma OS=Bos taurus GN=PIP4K2C PE=2 SV=1 337 708 1.0E-37
sp|Q5R488|PI42C_PONAB Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma OS=Pongo abelii GN=PIP4K2C PE=2 SV=1 337 708 8.0E-37
sp|Q91XU3|PI42C_MOUSE Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma OS=Mus musculus GN=Pip4k2c PE=1 SV=1 337 708 3.0E-35
sp|O88377|PI42B_RAT Phosphatidylinositol 5-phosphate 4-kinase type-2 beta OS=Rattus norvegicus GN=Pip4k2b PE=1 SV=1 337 564 2.0E-34
sp|Q80XI4|PI42B_MOUSE Phosphatidylinositol 5-phosphate 4-kinase type-2 beta OS=Mus musculus GN=Pip4k2b PE=1 SV=1 337 561 1.0E-33
sp|P78356|PI42B_HUMAN Phosphatidylinositol 5-phosphate 4-kinase type-2 beta OS=Homo sapiens GN=PIP4K2B PE=1 SV=1 337 561 1.0E-33
sp|Q5F356|PI42A_CHICK Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha OS=Gallus gallus GN=PIP4K2A PE=2 SV=1 314 561 2.0E-33
sp|O88370|PI42C_RAT Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma OS=Rattus norvegicus GN=Pip4k2c PE=1 SV=1 337 708 1.0E-32
sp|O13010|PI42A_PIG Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha OS=Sus scrofa GN=PIP4K2A PE=2 SV=1 314 561 2.0E-32
sp|P48426|PI42A_HUMAN Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha OS=Homo sapiens GN=PIP4K2A PE=1 SV=2 314 561 4.0E-32
sp|Q9R0I8|PI42A_RAT Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha OS=Rattus norvegicus GN=Pip4k2a PE=1 SV=1 314 561 5.0E-32
sp|O70172|PI42A_MOUSE Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha OS=Mus musculus GN=Pip4k2a PE=1 SV=1 314 561 5.0E-32
sp|Q9M149|PI5KB_ARATH Putative phosphatidylinositol 4-phosphate 5-kinase 11 OS=Arabidopsis thaliana GN=PIP5K11 PE=3 SV=1 355 708 3.0E-30
sp|Q9LMN1|PI5KA_ARATH Phosphatidylinositol 4-phosphate 5-kinase 10 OS=Arabidopsis thaliana GN=PIP5K10 PE=2 SV=2 331 706 3.0E-30
sp|Q6GL14|PI42C_XENTR Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma OS=Xenopus tropicalis GN=pip4k2c PE=2 SV=1 337 561 4.0E-29
sp|Q5PQ01|PI42C_XENLA Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma OS=Xenopus laevis GN=pip4k2c PE=2 SV=1 337 560 4.0E-29
sp|Q5T9C9|PI5L1_HUMAN Phosphatidylinositol 4-phosphate 5-kinase-like protein 1 OS=Homo sapiens GN=PIP5KL1 PE=2 SV=2 351 710 7.0E-29
sp|Q6IQE1|PI42C_DANRE Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma OS=Danio rerio GN=pip4k2c PE=2 SV=1 337 558 7.0E-28
sp|Q17QS4|PI5L1_BOVIN Phosphatidylinositol 4-phosphate 5-kinase-like protein 1 OS=Bos taurus GN=PIP5KL1 PE=2 SV=1 351 710 8.0E-28
sp|Q6U7H8|PI5L1_MOUSE Phosphatidylinositol 4-phosphate 5-kinase-like protein 1 OS=Mus musculus GN=Pip5kl1 PE=1 SV=1 361 710 1.0E-24
sp|Q9Y2I7|FYV1_HUMAN 1-phosphatidylinositol 3-phosphate 5-kinase OS=Homo sapiens GN=PIKFYVE PE=1 SV=3 361 559 1.0E-09
sp|Q9SSJ8|FAB1C_ARATH Putative 1-phosphatidylinositol-3-phosphate 5-kinase FAB1C OS=Arabidopsis thaliana GN=FAB1C PE=2 SV=1 361 555 1.0E-09
sp|Q9Z1T6|FYV1_MOUSE 1-phosphatidylinositol 3-phosphate 5-kinase OS=Mus musculus GN=Pikfyve PE=1 SV=3 361 559 4.0E-09
sp|O59722|FAB1_SCHPO 1-phosphatidylinositol 3-phosphate 5-kinase fab1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fab1 PE=3 SV=2 399 555 3.0E-08
sp|P34756|FAB1_YEAST 1-phosphatidylinositol 3-phosphate 5-kinase FAB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FAB1 PE=1 SV=3 402 616 9.0E-08
sp|B0G126|FYV1_DICDI 1-phosphatidylinositol 3-phosphate 5-kinase OS=Dictyostelium discoideum GN=pip5k3 PE=3 SV=1 323 560 1.0E-07
sp|Q0WUR5|FAB1A_ARATH 1-phosphatidylinositol-3-phosphate 5-kinase FAB1A OS=Arabidopsis thaliana GN=FAB1A PE=2 SV=1 355 555 6.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0016307 phosphatidylinositol phosphate kinase activity Yes
GO:0046488 phosphatidylinositol metabolic process Yes
GO:0044255 cellular lipid metabolic process No
GO:0044237 cellular metabolic process No
GO:0044238 primary metabolic process No
GO:0006629 lipid metabolic process No
GO:0003824 catalytic activity No
GO:0009987 cellular process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0008152 metabolic process No
GO:0006644 phospholipid metabolic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0016301 kinase activity No
GO:0016740 transferase activity No
GO:0006650 glycerophospholipid metabolic process No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0006793 phosphorus metabolic process No
GO:0003674 molecular_function No
GO:0019637 organophosphate metabolic process No
GO:0008150 biological_process No
GO:0046486 glycerolipid metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7572
MPLLVADDSSPVLELAFTDDCKANVAAVHSRSGISNGSFDESSASSSDASGAAPMPPNGNGTRPTSMSSLANSKS
LADADASKMTKSSPSKGVSPSDRTMPLLNGHGSAPQAGQQPRMAESLTRRRTADGDDVKVDKPSTPTEAGLPGRG
PEQPLSNPESDPSRGQLHRFSSPPAIQQFHPPASSATSVSGHLQPPNGQLTLRQRHTLEVPKPPSGRQSRDGADP
VFATGRFSPSGPGNRRASLNLVRRTTRSTPSDLPRDEVAPDEDALRWTEAYRQKRASKRKRKEEDDDDRVLVGTR
LDEKNANWAAAYNMLTGIRVSVSRTNAKLDRELTDADFDAKQKLTFDITGNELVPSAMYDFKFKDYAPGVFRSLR
ALFRLDPADYLVSLTGKYILSELGSPGKSGSFFYFSRDYKYIIKTIHHSEHKFLRKILKEYYDHVQKNPNTLLSQ
FYGLHRVKMPLGKKIHFVVMNNLFPPHRDIHQTFDLKGSTIGRDYKESDLDRNPRATLKDLNWQRRKQHLELGLQ
KKQMFLAQLQRDVVLLKRLQIMDYSLLIGIHDVSRGNEENLRDKTLQVFGPGGEKSTDDAAALLRTPSKLESHRK
ARELRQMIRQERPVPMGQASARMPDELDEGQCRSGSVFHQDDGGYRATHQDNEPADEIYYIGIIDCLTHYGAIKK
IEHFWKGLWSDPRQISALPPDEYGGRFVNFIENNTMSAEEARELQQRRDEEAAEAEALERRSHHGIPPMPDHQPP
PPPVTASSREGRETLETATKEAWRTAGRGTPEQDVPDRTLRAIAVGDKRDSLPHESILPVVEEASELGRTEAGPA
PISPPCTSHGPLKTESSDSGYGGAGNGNVSRDGSLKMKPQLSRESLNKRLPPLPGDEDKKQKAGGLKVVA*
Coding >Ophun1|7572
ATGCCCTTGCTCGTCGCCGACGATTCCTCGCCTGTCCTCGAACTCGCCTTTACCGACGATTGCAAGGCAAATGTG
GCTGCCGTTCACTCTCGCTCCGGCATCAGCAACGGCAGCTTCGACGAGAGCTCTGCCAGCTCCTCAGACGCCTCC
GGTGCAGCCCCTATGCCTCCGAATGGCAACGGCACGCGCCCGACGAGCATGAGCTCTCTCGCCAACAGCAAGAGT
CTCGCCGATGCCGATGCTTCAAAGATGACCAAGTCATCACCGTCCAAAGGCGTCTCCCCATCCGACCGCACTATG
CCCCTCCTCAACGGCCACGGCTCCGCTCCTCAGGCAGGTCAACAGCCAAGAATGGCCGAGTCTCTGACCCGTCGT
CGGACTGCCGACGGAGACGATGTCAAAGTTGATAAGCCGTCGACGCCGACAGAGGCCGGTCTCCCCGGCCGCGGT
CCCGAACAGCCTCTGTCGAATCCCGAGTCTGACCCGTCGAGGGGCCAGCTTCACCGATTTTCGTCCCCACCCGCC
ATCCAGCAGTTTCATCCTCCGGCTTCGTCCGCCACATCGGTCTCGGGCCACTTGCAGCCGCCCAACGGGCAGCTG
ACTCTTAGACAGAGGCACACGCTCGAGGTGCCTAAGCCGCCATCGGGCCGCCAGTCGAGAGACGGTGCCGACCCC
GTCTTCGCCACGGGCCGCTTCTCGCCCAGCGGACCGGGCAACCGCCGCGCGTCGCTTAACCTGGTCAGGCGCACT
ACACGGTCTACACCGTCCGATCTACCGCGGGACGAGGTCGCGCCCGACGAAGATGCTCTCCGGTGGACCGAAGCC
TACCGCCAGAAGAGGGCCAGTAAGCGGAAGCGCAAGGAAGAGGACGATGATGATCGCGTGCTGGTGGGCACGAGG
TTGGACGAGAAAAACGCCAACTGGGCCGCGGCATACAACATGCTGACCGGCATCCGGGTGTCCGTCTCGAGGACC
AACGCCAAGCTCGATCGCGAACTGACCGACGCCGACTTTGATGCCAAGCAAAAGTTGACGTTTGACATTACCGGC
AACGAACTGGTCCCCTCGGCAATGTACGACTTCAAGTTCAAGGACTACGCGCCTGGGGTCTTTCGAAGCCTGCGA
GCGCTGTTTCGGCTCGATCCCGCCGATTACCTCGTCTCCCTGACGGGGAAATATATCCTCTCCGAGCTCGGGTCC
CCCGGCAAGAGCGGCAGCTTCTTTTACTTTTCCAGAGATTACAAGTACATCATCAAGACGATCCATCACTCGGAG
CACAAGTTCCTGCGCAAGATCCTCAAGGAATACTACGACCATGTGCAGAAGAACCCCAACACGCTGCTCTCGCAA
TTCTACGGCCTGCATCGCGTCAAGATGCCTTTGGGCAAGAAGATCCACTTTGTCGTCATGAACAACCTCTTCCCG
CCGCACCGCGATATCCATCAGACGTTCGACCTCAAGGGCTCCACCATTGGCAGGGACTACAAGGAGTCGGACCTG
GACAGGAACCCCCGGGCGACGCTCAAGGACCTGAACTGGCAGAGGCGCAAGCAGCACCTCGAGCTCGGCCTCCAG
AAGAAGCAGATGTTCTTGGCCCAGCTGCAGCGCGACGTCGTTCTCCTCAAGCGGCTCCAGATAATGGACTACTCT
TTACTCATCGGCATCCACGACGTCTCCCGCGGCAATGAAGAGAACCTGCGCGACAAGACGTTGCAGGTCTTTGGC
CCGGGAGGCGAAAAGTCGACGGACGACGCGGCCGCCCTGCTCCGCACCCCCTCGAAGCTGGAGAGTCACCGCAAG
GCTCGAGAGCTGCGGCAGATGATTCGACAGGAGCGCCCCGTGCCCATGGGTCAGGCCTCGGCTAGGATGCCGGAC
GAGCTGGACGAGGGCCAGTGCCGGTCCGGCTCTGTCTTTCACCAGGACGACGGCGGCTACAGGGCGACGCACCAG
GACAATGAGCCGGCCGACGAGATCTATTACATTGGTATCATTGACTGCCTGACGCACTACGGAGCCATCAAGAAG
ATTGAGCATTTCTGGAAGGGTCTGTGGAGCGACCCGCGACAGATCTCTGCCCTGCCACCCGACGAGTACGGAGGC
CGATTCGTCAACTTTATCGAGAACAACACCATGTCGGCCGAGGAGGCCAGGGAACTGCAGCAGCGCAGGGACGAG
GAGGCGGCCGAGGCCGAGGCTCTGGAGAGAAGGTCACATCACGGAATACCGCCGATGCCGGACCACCAGCCCCCC
CCGCCGCCGGTGACAGCTTCGTCTCGCGAGGGACGTGAAACGCTCGAGACGGCGACCAAGGAGGCGTGGCGGACG
GCTGGCAGGGGCACGCCGGAGCAGGACGTCCCGGATCGGACGCTGCGGGCGATTGCAGTGGGGGACAAACGAGAC
TCGCTACCGCACGAGTCGATCCTCCCCGTCGTCGAGGAGGCGAGCGAGCTCGGACGGACGGAAGCGGGCCCGGCA
CCCATCTCGCCGCCGTGTACGAGCCACGGACCGCTCAAGACGGAGAGCTCCGACAGCGGCTACGGCGGCGCGGGC
AACGGCAACGTCAGCCGGGACGGATCCCTCAAGATGAAGCCTCAGTTGAGCCGCGAGAGCCTCAACAAGCGGCTG
CCACCGCTGCCGGGCGACGAGGACAAGAAGCAAAAGGCCGGGGGTCTCAAGGTTGTGGCCTAG
Transcript >Ophun1|7572
ATGCCCTTGCTCGTCGCCGACGATTCCTCGCCTGTCCTCGAACTCGCCTTTACCGACGATTGCAAGGCAAATGTG
GCTGCCGTTCACTCTCGCTCCGGCATCAGCAACGGCAGCTTCGACGAGAGCTCTGCCAGCTCCTCAGACGCCTCC
GGTGCAGCCCCTATGCCTCCGAATGGCAACGGCACGCGCCCGACGAGCATGAGCTCTCTCGCCAACAGCAAGAGT
CTCGCCGATGCCGATGCTTCAAAGATGACCAAGTCATCACCGTCCAAAGGCGTCTCCCCATCCGACCGCACTATG
CCCCTCCTCAACGGCCACGGCTCCGCTCCTCAGGCAGGTCAACAGCCAAGAATGGCCGAGTCTCTGACCCGTCGT
CGGACTGCCGACGGAGACGATGTCAAAGTTGATAAGCCGTCGACGCCGACAGAGGCCGGTCTCCCCGGCCGCGGT
CCCGAACAGCCTCTGTCGAATCCCGAGTCTGACCCGTCGAGGGGCCAGCTTCACCGATTTTCGTCCCCACCCGCC
ATCCAGCAGTTTCATCCTCCGGCTTCGTCCGCCACATCGGTCTCGGGCCACTTGCAGCCGCCCAACGGGCAGCTG
ACTCTTAGACAGAGGCACACGCTCGAGGTGCCTAAGCCGCCATCGGGCCGCCAGTCGAGAGACGGTGCCGACCCC
GTCTTCGCCACGGGCCGCTTCTCGCCCAGCGGACCGGGCAACCGCCGCGCGTCGCTTAACCTGGTCAGGCGCACT
ACACGGTCTACACCGTCCGATCTACCGCGGGACGAGGTCGCGCCCGACGAAGATGCTCTCCGGTGGACCGAAGCC
TACCGCCAGAAGAGGGCCAGTAAGCGGAAGCGCAAGGAAGAGGACGATGATGATCGCGTGCTGGTGGGCACGAGG
TTGGACGAGAAAAACGCCAACTGGGCCGCGGCATACAACATGCTGACCGGCATCCGGGTGTCCGTCTCGAGGACC
AACGCCAAGCTCGATCGCGAACTGACCGACGCCGACTTTGATGCCAAGCAAAAGTTGACGTTTGACATTACCGGC
AACGAACTGGTCCCCTCGGCAATGTACGACTTCAAGTTCAAGGACTACGCGCCTGGGGTCTTTCGAAGCCTGCGA
GCGCTGTTTCGGCTCGATCCCGCCGATTACCTCGTCTCCCTGACGGGGAAATATATCCTCTCCGAGCTCGGGTCC
CCCGGCAAGAGCGGCAGCTTCTTTTACTTTTCCAGAGATTACAAGTACATCATCAAGACGATCCATCACTCGGAG
CACAAGTTCCTGCGCAAGATCCTCAAGGAATACTACGACCATGTGCAGAAGAACCCCAACACGCTGCTCTCGCAA
TTCTACGGCCTGCATCGCGTCAAGATGCCTTTGGGCAAGAAGATCCACTTTGTCGTCATGAACAACCTCTTCCCG
CCGCACCGCGATATCCATCAGACGTTCGACCTCAAGGGCTCCACCATTGGCAGGGACTACAAGGAGTCGGACCTG
GACAGGAACCCCCGGGCGACGCTCAAGGACCTGAACTGGCAGAGGCGCAAGCAGCACCTCGAGCTCGGCCTCCAG
AAGAAGCAGATGTTCTTGGCCCAGCTGCAGCGCGACGTCGTTCTCCTCAAGCGGCTCCAGATAATGGACTACTCT
TTACTCATCGGCATCCACGACGTCTCCCGCGGCAATGAAGAGAACCTGCGCGACAAGACGTTGCAGGTCTTTGGC
CCGGGAGGCGAAAAGTCGACGGACGACGCGGCCGCCCTGCTCCGCACCCCCTCGAAGCTGGAGAGTCACCGCAAG
GCTCGAGAGCTGCGGCAGATGATTCGACAGGAGCGCCCCGTGCCCATGGGTCAGGCCTCGGCTAGGATGCCGGAC
GAGCTGGACGAGGGCCAGTGCCGGTCCGGCTCTGTCTTTCACCAGGACGACGGCGGCTACAGGGCGACGCACCAG
GACAATGAGCCGGCCGACGAGATCTATTACATTGGTATCATTGACTGCCTGACGCACTACGGAGCCATCAAGAAG
ATTGAGCATTTCTGGAAGGGTCTGTGGAGCGACCCGCGACAGATCTCTGCCCTGCCACCCGACGAGTACGGAGGC
CGATTCGTCAACTTTATCGAGAACAACACCATGTCGGCCGAGGAGGCCAGGGAACTGCAGCAGCGCAGGGACGAG
GAGGCGGCCGAGGCCGAGGCTCTGGAGAGAAGGTCACATCACGGAATACCGCCGATGCCGGACCACCAGCCCCCC
CCGCCGCCGGTGACAGCTTCGTCTCGCGAGGGACGTGAAACGCTCGAGACGGCGACCAAGGAGGCGTGGCGGACG
GCTGGCAGGGGCACGCCGGAGCAGGACGTCCCGGATCGGACGCTGCGGGCGATTGCAGTGGGGGACAAACGAGAC
TCGCTACCGCACGAGTCGATCCTCCCCGTCGTCGAGGAGGCGAGCGAGCTCGGACGGACGGAAGCGGGCCCGGCA
CCCATCTCGCCGCCGTGTACGAGCCACGGACCGCTCAAGACGGAGAGCTCCGACAGCGGCTACGGCGGCGCGGGC
AACGGCAACGTCAGCCGGGACGGATCCCTCAAGATGAAGCCTCAGTTGAGCCGCGAGAGCCTCAACAAGCGGCTG
CCACCGCTGCCGGGCGACGAGGACAAGAAGCAAAAGGCCGGGGGTCTCAAGGTTGTGGCCTAG
Gene >Ophun1|7572
ATGCCCTTGCTCGTCGCCGACGATTCCTCGCCTGTCCTCGAACTCGCCTTTACCGACGATTGCAAGGCAAATGTG
GCTGCCGTTCACTCTCGCTCCGGCATCAGCAACGGCAGCTTCGACGAGAGCTCTGCCAGCTCCTCAGACGCCTCC
GGTGCAGCCCCTATGCCTCCGAATGGCAACGGCACGCGCCCGACGAGCATGAGCTCTCTCGCCAACAGCAAGAGT
CTCGCCGATGCCGATGCTTCAAAGATGACCAAGTCATCACCGTCCAAAGGCGTCTCCCCATCCGACCGCACTATG
CCCCTCCTCAACGGCCACGGCTCCGCTCCTCAGGCAGGTCAACAGCCAAGAATGGCCGAGTCTCTGACCCGTCGT
CGGACTGCCGACGGAGACGATGTCAAAGTTGATAAGCCGTCGACGCCGACAGAGGCCGGTCTCCCCGGCCGCGGT
CCCGAACAGCCTCTGTCGAATCCCGAGTCTGACCCGTCGAGGGGCCAGCTTCACCGATTTTCGTCCCCACCCGCC
ATCCAGCAGTTTCATCCTCCGGCTTCGTCCGCCACATCGGTCTCGGGCCACTTGCAGCCGCCCAACGGGCAGCTG
ACTCTTAGACAGAGGCACACGCTCGAGGTGCCTAAGCCGCCATCGGGCCGCCAGTCGAGAGACGGTGCCGACCCC
GTCTTCGCCACGGGCCGCTTCTCGCCCAGCGGACCGGGCAACCGCCGCGCGTCGCTTAACCTGGTCAGGCGCACT
ACACGGTCTACACCGTCCGATCTACCGCGGGACGAGGTCGCGCCCGACGAAGATGCTCTCCGGTGGACCGAAGCC
TACCGCCAGAAGAGGGCCAGTAAGCGGAAGCGCAAGGAAGAGGACGATGATGATCGCGTGCTGGTGGGCACGAGG
TTGGACGAGAAAAACGCCAACTGGGCCGCGGCATACAACATGCTGACCGGCATCCGGGTGTCCGTCTCGAGGACC
AACGCCAAGCTCGATCGCGAACTGACCGACGCCGACTTTGATGCCAAGCAAAAGTTGACGTTTGACATGTAAGGC
AGCCGGCGAAAAGGGGCGGACAATGGCTAACAACCCCCGACTGCAGTACCGGCAACGAACTGGTCCCCTCGGCAA
TGTACGACTTCAAGTTCAAGGACTACGCGCCTGGGGTCTTTCGAAGCCTGCGAGCGCTGTTTCGGCTCGATCCCG
CCGATTACCTCGTCTCCCTGACGGGGAAATATATCCTCTCCGAGCTCGGGTCCCCCGGCAAGAGCGGCAGCTTCT
TTTACTTTTCCAGAGATTACAAGTACATCATCAAGACGATCCATCACTCGGAGCACAAGTTCCTGCGCAAGATCC
TCAAGGAATACTACGACCATGTGCAGAAGAACCCCAACACGCTGCTCTCGCAATTCTACGGCCTGCATCGCGTCA
AGATGCCTTTGGGCAAGAAGATCCACTTTGTCGTCATGAACAACCTCTTCCCGCCGCACCGCGATATCCATCAGA
CGTTCGACCTCAAGGGCTCCACCATTGGCAGGGACTACAAGGAGTCGGACCTGGACAGGAACCCCCGGGCGACGC
TCAAGGACCTGAACTGGCAGAGGCGCAAGCAGCACCTCGAGCTCGGCCTCCAGAAGAAGCAGATGTTCTTGGCCC
AGCTGCAGCGCGACGTCGTTCTCCTCAAGCGGCTCCAGATAATGGACTACTCTTTACTCATCGGCATCCACGACG
TCTCCCGCGGCAATGAAGAGAACCTGCGCGACAAGACGTTGCAGGTCTTTGGCCCGGGAGGCGAAAAGTCGACGG
ACGACGCGGCCGCCCTGCTCCGCACCCCCTCGAAGCTGGAGAGTCACCGCAAGGCTCGAGAGCTGCGGCAGATGA
TTCGACAGGAGCGCCCCGTGCCCATGGGTCAGGCCTCGGCTAGGATGCCGGACGAGCTGGACGAGGGCCAGTGCC
GGTCCGGCTCTGTCTTTCACCAGGACGACGGCGGCTACAGGGCGACGCACCAGGACAATGAGCCGGCCGACGAGA
TCTATTACATTGGTATCATTGACTGCCTGACGCACGTAAGTGGTAGCGAAGCCGAGGCCAAGCTGCAGTAACTGA
CGGAGGGGGCCAATGAACAGTACGGAGCCATCAAGAAGATTGAGCATTTCTGGAAGGGTCTGTGGAGCGACCCGC
GACAGATCTCTGCCCTGCCACCCGACGAGTACGGAGGCCGATTCGTCAACTTTATCGAGAACAACACCATGTCGG
CCGAGGAGGCCAGGGAACTGCAGCAGCGCAGGGACGAGGAGGCGGCCGAGGCCGAGGCTCTGGAGAGAAGGTCAC
ATCACGGAATACCGCCGATGCCGGACCACCAGCCCCCCCCGCCGCCGGTGACAGCTTCGTCTCGCGAGGGACGTG
AAACGCTCGAGACGGCGACCAAGGAGGCGTGGCGGACGGCTGGCAGGGGCACGCCGGAGCAGGACGTCCCGGATC
GGACGCTGCGGGCGATTGCAGTGGGGGACAAACGAGACTCGCTACCGCACGAGTCGATCCTCCCCGTCGTCGAGG
AGGCGAGCGAGCTCGGACGGACGGAAGCGGGCCCGGCACCCATCTCGCCGCCGTGTACGAGCCACGGACCGCTCA
AGACGGAGAGCTCCGACAGCGGCTACGGCGGCGCGGGCAACGGCAACGTCAGCCGGGACGGATCCCTCAAGATGA
AGCCTCAGTTGAGCCGCGAGAGCCTCAACAAGCGGCTGCCACCGCTGCCGGGCGACGAGGACAAGAAGCAAAAGG
CCGGGGGTCTCAAGGTTGTGGCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail