Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7570
Gene name
LocationContig_98:21426..23418
Strand-
Gene length (bp)1992
Transcript length (bp)1938
Coding sequence length (bp)1938
Protein length (aa) 646

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05686 Glyco_transf_90 Glycosyl transferase family 90 2.5E-11 499 617

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q5K8R6|CXT1_CRYNJ Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CXT1 PE=1 SV=1 79 621 1.0E-42
sp|Q6UW63|KDEL1_HUMAN KDEL motif-containing protein 1 OS=Homo sapiens GN=KDELC1 PE=1 SV=1 504 615 7.0E-08
sp|Q9JHP7|KDEL1_MOUSE KDEL motif-containing protein 1 OS=Mus musculus GN=Kdelc1 PE=1 SV=1 504 615 5.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 37 0.5

Transmembrane Domains

Domain # Start End Length
1 20 42 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7570
MGNKFLSPTPFRRRPSARYAIFAVLFLFAFFALNQSSHEIYIRSSSSSSSSVIRHHVVVQLEKPLTPPPPIPDEP
TDDGSNHPIDKLIFDAQRTFAGLLSSESKSLGEAAQAYRRRRHRHPPPGFDRWYEFARSRNAVIVEDFFDQIYHD
LEPFWGMDPLGMRRRASQFEMTINVRNGNASAVSNWFWTQLWLNMIKEIEGYLPDMDIALNAMDEPRIVASWEKV
TKHVNKAAQNRRMPRARSVVSKFQKLPEPKKGDLASKVAEIKWDETEPYWLIARRGCSPDSLARTAPLQTSFAEP
PVILTDYANQHMYQGYVSNYTKSNEICHQPDLQGLQGLLIKPISTKATDVLFPMFGGSKLTINNEILLPAPMYWT
EEERFTGGGYHGDPWAEKVNRVVWRGVATGGRNEQDNWRGFQRHRFVAMNNGTKIARVEAGKERPENFALAEERY
NVTAQNKHKLGKWISHTSDVAFIDLFCDQPQDGWCNYTDFYFDPQPTLTMAQQFDSKYLPDIDGNSFSGRYLGFL
QSTSLPIKATVWREWHDSRLVPWKHFVPMDNRFSDYYGILDYFIGFSGRDGHDEAAEKIASDGKEWADRVLRRED
MLIYVLRLLLEYARVVDKRREYMGWVDDILEDPSLDVEEGRSGWW*
Coding >Ophun1|7570
ATGGGCAACAAGTTCTTATCACCGACTCCCTTCCGCAGACGGCCCTCGGCTCGATACGCAATCTTCGCCGTCCTC
TTCCTCTTCGCCTTCTTCGCCTTGAATCAAAGCTCCCACGAGATCTACATCAGATCATCCTCTTCCTCCTCCTCC
TCCGTCATCCGTCACCACGTTGTGGTGCAACTCGAGAAACCCCTGACGCCTCCGCCGCCCATTCCGGACGAGCCC
ACCGACGACGGCAGCAACCACCCCATCGACAAGCTCATATTCGATGCCCAGCGTACCTTTGCCGGACTTCTCTCC
TCCGAGTCAAAGTCGTTGGGAGAGGCCGCCCAGGCGTATCGCCGCCGCCGCCACCGTCACCCCCCTCCGGGCTTC
GACAGGTGGTACGAGTTTGCTCGCTCCCGCAATGCCGTCATCGTGGAGGACTTCTTCGACCAGATCTATCACGAC
CTCGAACCCTTCTGGGGGATGGACCCTCTGGGCATGCGCCGCCGGGCGAGTCAATTTGAGATGACCATCAACGTC
CGCAACGGTAACGCATCCGCCGTCTCGAATTGGTTCTGGACTCAGTTGTGGCTCAACATGATCAAGGAGATTGAA
GGCTACCTCCCTGACATGGACATTGCCCTCAACGCAATGGATGAGCCTCGCATAGTCGCTTCTTGGGAAAAGGTC
ACCAAGCACGTCAACAAGGCCGCCCAGAATCGCCGGATGCCCAGGGCCCGGTCGGTCGTGTCCAAGTTCCAGAAA
CTGCCGGAGCCCAAAAAGGGCGACCTGGCATCCAAAGTCGCCGAAATCAAGTGGGATGAGACGGAACCGTACTGG
CTCATCGCCCGTCGCGGCTGTTCACCGGACAGCCTCGCCCGCACGGCACCCCTGCAGACGTCGTTTGCCGAACCC
CCGGTCATCTTGACCGACTACGCCAATCAGCACATGTACCAGGGCTACGTCTCCAACTACACCAAGTCCAATGAG
ATCTGCCACCAGCCCGACCTCCAGGGCCTACAGGGTCTCCTCATCAAGCCCATCAGCACCAAGGCCACCGATGTC
TTGTTCCCCATGTTTGGTGGCTCCAAGCTGACGATCAACAACGAGATACTGCTGCCGGCCCCCATGTACTGGACC
GAGGAAGAACGCTTCACGGGCGGCGGGTACCACGGAGATCCCTGGGCGGAAAAGGTCAATCGAGTCGTCTGGCGC
GGCGTCGCCACGGGAGGGAGAAACGAGCAAGACAACTGGAGGGGCTTTCAGCGCCATCGCTTCGTCGCCATGAAC
AACGGCACCAAGATTGCCCGGGTCGAGGCGGGAAAGGAGAGGCCCGAGAACTTTGCGCTGGCCGAGGAGCGCTAC
AACGTGACGGCGCAAAACAAGCACAAACTCGGCAAATGGATATCCCACACGTCGGATGTGGCCTTTATCGACCTC
TTCTGCGATCAGCCACAGGACGGCTGGTGCAACTACACCGACTTCTACTTCGACCCCCAGCCGACCCTCACCATG
GCGCAACAGTTCGACTCCAAGTATCTTCCTGATATTGATGGCAACTCCTTTTCCGGCCGATACCTCGGCTTCCTT
CAGTCGACGTCGCTGCCCATCAAGGCGACTGTCTGGCGCGAATGGCACGACAGCCGGCTGGTGCCGTGGAAGCAC
TTTGTGCCCATGGACAACCGCTTCTCTGATTACTACGGCATCCTCGACTACTTCATCGGCTTCTCCGGTCGCGAC
GGGCACGATGAGGCGGCCGAGAAGATTGCCTCGGACGGAAAGGAGTGGGCGGATCGAGTGCTACGCAGGGAGGAC
ATGCTGATTTATGTCCTGAGACTGCTGCTCGAGTACGCGCGCGTGGTTGATAAACGGAGAGAGTACATGGGCTGG
GTCGACGACATACTCGAGGATCCGTCCCTGGACGTGGAGGAGGGGAGGTCTGGCTGGTGGTAG
Transcript >Ophun1|7570
ATGGGCAACAAGTTCTTATCACCGACTCCCTTCCGCAGACGGCCCTCGGCTCGATACGCAATCTTCGCCGTCCTC
TTCCTCTTCGCCTTCTTCGCCTTGAATCAAAGCTCCCACGAGATCTACATCAGATCATCCTCTTCCTCCTCCTCC
TCCGTCATCCGTCACCACGTTGTGGTGCAACTCGAGAAACCCCTGACGCCTCCGCCGCCCATTCCGGACGAGCCC
ACCGACGACGGCAGCAACCACCCCATCGACAAGCTCATATTCGATGCCCAGCGTACCTTTGCCGGACTTCTCTCC
TCCGAGTCAAAGTCGTTGGGAGAGGCCGCCCAGGCGTATCGCCGCCGCCGCCACCGTCACCCCCCTCCGGGCTTC
GACAGGTGGTACGAGTTTGCTCGCTCCCGCAATGCCGTCATCGTGGAGGACTTCTTCGACCAGATCTATCACGAC
CTCGAACCCTTCTGGGGGATGGACCCTCTGGGCATGCGCCGCCGGGCGAGTCAATTTGAGATGACCATCAACGTC
CGCAACGGTAACGCATCCGCCGTCTCGAATTGGTTCTGGACTCAGTTGTGGCTCAACATGATCAAGGAGATTGAA
GGCTACCTCCCTGACATGGACATTGCCCTCAACGCAATGGATGAGCCTCGCATAGTCGCTTCTTGGGAAAAGGTC
ACCAAGCACGTCAACAAGGCCGCCCAGAATCGCCGGATGCCCAGGGCCCGGTCGGTCGTGTCCAAGTTCCAGAAA
CTGCCGGAGCCCAAAAAGGGCGACCTGGCATCCAAAGTCGCCGAAATCAAGTGGGATGAGACGGAACCGTACTGG
CTCATCGCCCGTCGCGGCTGTTCACCGGACAGCCTCGCCCGCACGGCACCCCTGCAGACGTCGTTTGCCGAACCC
CCGGTCATCTTGACCGACTACGCCAATCAGCACATGTACCAGGGCTACGTCTCCAACTACACCAAGTCCAATGAG
ATCTGCCACCAGCCCGACCTCCAGGGCCTACAGGGTCTCCTCATCAAGCCCATCAGCACCAAGGCCACCGATGTC
TTGTTCCCCATGTTTGGTGGCTCCAAGCTGACGATCAACAACGAGATACTGCTGCCGGCCCCCATGTACTGGACC
GAGGAAGAACGCTTCACGGGCGGCGGGTACCACGGAGATCCCTGGGCGGAAAAGGTCAATCGAGTCGTCTGGCGC
GGCGTCGCCACGGGAGGGAGAAACGAGCAAGACAACTGGAGGGGCTTTCAGCGCCATCGCTTCGTCGCCATGAAC
AACGGCACCAAGATTGCCCGGGTCGAGGCGGGAAAGGAGAGGCCCGAGAACTTTGCGCTGGCCGAGGAGCGCTAC
AACGTGACGGCGCAAAACAAGCACAAACTCGGCAAATGGATATCCCACACGTCGGATGTGGCCTTTATCGACCTC
TTCTGCGATCAGCCACAGGACGGCTGGTGCAACTACACCGACTTCTACTTCGACCCCCAGCCGACCCTCACCATG
GCGCAACAGTTCGACTCCAAGTATCTTCCTGATATTGATGGCAACTCCTTTTCCGGCCGATACCTCGGCTTCCTT
CAGTCGACGTCGCTGCCCATCAAGGCGACTGTCTGGCGCGAATGGCACGACAGCCGGCTGGTGCCGTGGAAGCAC
TTTGTGCCCATGGACAACCGCTTCTCTGATTACTACGGCATCCTCGACTACTTCATCGGCTTCTCCGGTCGCGAC
GGGCACGATGAGGCGGCCGAGAAGATTGCCTCGGACGGAAAGGAGTGGGCGGATCGAGTGCTACGCAGGGAGGAC
ATGCTGATTTATGTCCTGAGACTGCTGCTCGAGTACGCGCGCGTGGTTGATAAACGGAGAGAGTACATGGGCTGG
GTCGACGACATACTCGAGGATCCGTCCCTGGACGTGGAGGAGGGGAGGTCTGGCTGGTGGTAG
Gene >Ophun1|7570
ATGGGCAACAAGTTCTTATCACCGACTCCCTTCCGCAGACGGCCCTCGGCTCGATACGCAATCTTCGCCGTCCTC
TTCCTCTTCGCCTTCTTCGCCTTGAATCAAAGCTCCCACGAGATCTACATCAGATCATCCTCTTCCTCCTCCTCC
TCCGTCATCCGTCACCACGTTGTGGTGCAACTCGAGAAACCCCTGACGCCTCCGCCGCCCATTCCGGACGAGCCC
ACCGACGACGGCAGCAACCACCCCATCGACAAGCTCATATTCGATGCCCAGCGTACCTTTGCCGGACTTCTCTCC
TCCGAGTCAAAGTCGTTGGGAGAGGCCGCCCAGGCGTATCGCCGCCGCCGCCACCGTCACCCCCCTCCGGGCTTC
GACAGGTGGTACGAGTTTGCTCGCTCCCGCAATGCCGTCATCGTGGAGGACTTCTTCGACCAGATCTATCACGAC
CTCGAACCCTTCTGGGGGATGGACCCTCTGGGCATGCGCCGCCGGGCGAGTCAATTTGAGATGACCATCAACGTC
CGCAACGGTAACGCATCCGCCGTCTCGAATTGGTTCTGGACTCAGTTGTGGCTCAACATGATCAAGGAGATTGAA
GGCTACCTCCCTGACATGGACATTGCCCTCAACGCAATGGATGAGCCTCGCATAGTCGCTTCTTGGGAAAAGGTC
ACCAAGCACGTCAACAAGGCCGCCCAGAATCGCCGGATGCCCAGGGCCCGGTCGGTCGTGTCCAAGTTCCAGAAA
CTGCCGGAGCCCAAAAAGGGCGACCTGGCATCCAAAGTCGCCGAAATCAAGTGGGATGAGACGGGTATGTTGATG
AACCGCACATGAGAATCAGAAGCTTGTGCTAACAAAATCAAAGAACCGTACTGGCTCATCGCCCGTCGCGGCTGT
TCACCGGACAGCCTCGCCCGCACGGCACCCCTGCAGACGTCGTTTGCCGAACCCCCGGTCATCTTGACCGACTAC
GCCAATCAGCACATGTACCAGGGCTACGTCTCCAACTACACCAAGTCCAATGAGATCTGCCACCAGCCCGACCTC
CAGGGCCTACAGGGTCTCCTCATCAAGCCCATCAGCACCAAGGCCACCGATGTCTTGTTCCCCATGTTTGGTGGC
TCCAAGCTGACGATCAACAACGAGATACTGCTGCCGGCCCCCATGTACTGGACCGAGGAAGAACGCTTCACGGGC
GGCGGGTACCACGGAGATCCCTGGGCGGAAAAGGTCAATCGAGTCGTCTGGCGCGGCGTCGCCACGGGAGGGAGA
AACGAGCAAGACAACTGGAGGGGCTTTCAGCGCCATCGCTTCGTCGCCATGAACAACGGCACCAAGATTGCCCGG
GTCGAGGCGGGAAAGGAGAGGCCCGAGAACTTTGCGCTGGCCGAGGAGCGCTACAACGTGACGGCGCAAAACAAG
CACAAACTCGGCAAATGGATATCCCACACGTCGGATGTGGCCTTTATCGACCTCTTCTGCGATCAGCCACAGGAC
GGCTGGTGCAACTACACCGACTTCTACTTCGACCCCCAGCCGACCCTCACCATGGCGCAACAGTTCGACTCCAAG
TATCTTCCTGATATTGATGGCAACTCCTTTTCCGGCCGATACCTCGGCTTCCTTCAGTCGACGTCGCTGCCCATC
AAGGCGACTGTCTGGCGCGAATGGCACGACAGCCGGCTGGTGCCGTGGAAGCACTTTGTGCCCATGGACAACCGC
TTCTCTGATTACTACGGCATCCTCGACTACTTCATCGGCTTCTCCGGTCGCGACGGGCACGATGAGGCGGCCGAG
AAGATTGCCTCGGACGGAAAGGAGTGGGCGGATCGAGTGCTACGCAGGGAGGACATGCTGATTTATGTCCTGAGA
CTGCTGCTCGAGTACGCGCGCGTGGTTGATAAACGGAGAGAGTACATGGGCTGGGTCGACGACATACTCGAGGAT
CCGTCCCTGGACGTGGAGGAGGGGAGGTCTGGCTGGTGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail