Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7561
Gene name
LocationContig_98:2273..4339
Strand+
Gene length (bp)2066
Transcript length (bp)1878
Coding sequence length (bp)1878
Protein length (aa) 626

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05021 NPL4 NPL4 family 6.7E-137 263 580
PF05020 zf-NPL4 NPL4 family, putative zinc binding region 7.8E-66 117 260

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A2Q8R9|NPL4_ASPNC Nuclear protein localization protein 4 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=npl4 PE=3 SV=1 1 589 0.0E+00
sp|A4RN19|NPL4_MAGO7 Nuclear protein localization protein 4 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=NPL4 PE=3 SV=2 1 618 0.0E+00
sp|A6R538|NPL4_AJECN Nuclear protein localization protein 4 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=NPL4 PE=3 SV=1 1 608 0.0E+00
sp|A1CS06|NPL4_ASPCL Nuclear protein localization protein 4 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=npl4 PE=3 SV=1 1 589 0.0E+00
sp|Q5BGN5|NPL4_EMENI Nuclear protein localization protein 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=npl4 PE=3 SV=2 1 589 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A2Q8R9|NPL4_ASPNC Nuclear protein localization protein 4 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=npl4 PE=3 SV=1 1 589 0.0E+00
sp|A4RN19|NPL4_MAGO7 Nuclear protein localization protein 4 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=NPL4 PE=3 SV=2 1 618 0.0E+00
sp|A6R538|NPL4_AJECN Nuclear protein localization protein 4 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=NPL4 PE=3 SV=1 1 608 0.0E+00
sp|A1CS06|NPL4_ASPCL Nuclear protein localization protein 4 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=npl4 PE=3 SV=1 1 589 0.0E+00
sp|Q5BGN5|NPL4_EMENI Nuclear protein localization protein 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=npl4 PE=3 SV=2 1 589 0.0E+00
sp|A1D4X8|NPL4_NEOFI Nuclear protein localization protein 4 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=npl4 PE=3 SV=1 1 589 0.0E+00
sp|Q2URI8|NPL4_ASPOR Nuclear protein localization protein 4 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=npl4 PE=3 SV=1 1 589 0.0E+00
sp|Q4WKD7|NPL4_ASPFU Nuclear protein localization protein 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=npl4 PE=3 SV=1 1 589 0.0E+00
sp|P0C7N6|NPL4_PHANO Nuclear protein localization protein 4 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=NPL4 PE=3 SV=1 1 589 0.0E+00
sp|Q1DY54|NPL4_COCIM Nuclear protein localization protein 4 OS=Coccidioides immitis (strain RS) GN=NPL4 PE=3 SV=1 1 589 0.0E+00
sp|A7EGK5|NPL4_SCLS1 Nuclear protein localization protein 4 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=npl4 PE=3 SV=1 1 583 0.0E+00
sp|Q7SH49|NPL4_NEUCR Nuclear protein localization protein 4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=npl4 PE=3 SV=2 1 622 0.0E+00
sp|Q6CLY1|NPL4_KLULA Nuclear protein localization protein 4 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=NPL4 PE=3 SV=1 1 582 1.0E-179
sp|P33755|NPL4_YEAST Nuclear protein localization protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NPL4 PE=1 SV=1 1 583 3.0E-177
sp|Q6FJI2|NPL4_CANGA Nuclear protein localization protein 4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=NPL4 PE=3 SV=1 1 581 3.0E-173
sp|Q6C619|NPL4_YARLI Nuclear protein localization protein 4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=NPL4 PE=3 SV=2 1 580 5.0E-170
sp|A7TTC4|NPL4_VANPO Nuclear protein localization protein 4 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=NPL4 PE=3 SV=1 1 580 1.0E-168
sp|A5DX93|NPL4_LODEL Nuclear protein localization protein 4 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=NPL4 PE=3 SV=1 1 582 3.0E-168
sp|Q9P780|NPL4_SCHPO Nuclear protein localization protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=npl4 PE=3 SV=2 1 582 2.0E-165
sp|Q6BRJ9|NPL4_DEBHA Nuclear protein localization protein 4 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=NPL4 PE=3 SV=2 11 582 4.0E-164
sp|Q74ZJ1|NPL4_ASHGO Nuclear protein localization protein 4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=NPL4 PE=3 SV=1 1 580 5.0E-160
sp|A5DBC9|NPL4_PICGU Nuclear protein localization protein 4 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=NPL4 PE=3 SV=2 2 551 3.0E-159
sp|A3GFS1|NPL4_PICST Nuclear protein localization protein 4 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=NPL4 PE=3 SV=2 3 582 1.0E-157
sp|Q5AA50|NPL4_CANAL Nuclear protein localization protein 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NPL4 PE=3 SV=1 1 582 1.0E-154
sp|P0CP30|NPL4_CRYNJ Nuclear protein localization protein 4 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=NPL4 PE=3 SV=1 1 581 6.0E-140
sp|P0CP31|NPL4_CRYNB Nuclear protein localization protein 4 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=NPL4 PE=3 SV=1 1 581 5.0E-139
sp|Q8TAT6|NPL4_HUMAN Nuclear protein localization protein 4 homolog OS=Homo sapiens GN=NPLOC4 PE=1 SV=3 1 587 6.0E-107
sp|P60670|NPL4_MOUSE Nuclear protein localization protein 4 homolog OS=Mus musculus GN=Nploc4 PE=1 SV=3 1 587 1.0E-105
sp|Q9ES54|NPL4_RAT Nuclear protein localization protein 4 homolog OS=Rattus norvegicus GN=Nploc4 PE=1 SV=3 1 587 2.0E-105
sp|Q9VBP9|NPL4_DROME Nuclear protein localization protein 4 homolog OS=Drosophila melanogaster GN=Npl4 PE=1 SV=3 68 581 2.0E-96
sp|Q9AS33|NPL4_ORYSJ NPL4-like protein OS=Oryza sativa subsp. japonica GN=Os01g0377700 PE=2 SV=1 260 566 3.0E-10
sp|Q9LYC2|NPL41_ARATH NPL4-like protein 1 OS=Arabidopsis thaliana GN=At3g63000 PE=1 SV=1 252 557 9.0E-08
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1397
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3698
Ophiocordyceps australis map64 (Brazil) OphauB2|1857
Ophiocordyceps camponoti-floridani Ophcf2|04559
Ophiocordyceps camponoti-rufipedis Ophun1|7561 (this protein)
Ophiocordyceps kimflemingae Ophio5|7073
Ophiocordyceps subramaniannii Hirsu2|1088

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7561
MLLRLRGPDGMIRLTVEQGTTFGELGQKLMPQLPASVDPNTVSMSNAPTGGDAKKLVDIANFKVGQIGLRHGDLI
FIDYKYADPSTNGKAAAVPAMPAQDTPIDHKPQRIARPWEVVRQSALDDSLDRLSGKIPRGRDRMCRHGPKGMCD
YCQPLDPFDAGYLADKKIKYTSFHSHLRKVNASTNKPELGSSYIPPLVEPYYRVRSDCPSGHSPWPEGICSKCQP
SAITLQPQSFRMVDHVEFADSSIVDSFINTWRKTGTQRMGFLYGRYAEYPEVPLGVKAVVEAIYEPPQMDETDGI
TTNAWDNQQEVDEVAGLCGLEPVGVIFTDLLDSGLGDGSVVCKRHADSYYLSSLEICFCSRLQAQRPKPSKWSDT
GRFGSNFVTCVISGNESGEIAIASYQMSNAAVEMVRADIIEPSADPNVMLVRDENDDDGSASRTRYVPEVFYRKV
NEYGANVQENAKPSFPVEYLFVTLTHGFPANPKPVFTNMGGFPIENREYVGESQEHAVLARALRMSSGLKPSDGL
QEVSDFHLLCFLYRMAVFSKDEFALLCRVASHHDLADSFHLGSTEGWQTLQAILQSTGERIPKRRRECRDGTDVA
AAIDSGEPLTKRFAAFRLKEGRSAA*
Coding >Ophun1|7561
ATGCTGCTTCGACTGCGTGGGCCTGATGGCATGATTCGCCTGACGGTCGAGCAGGGCACTACCTTTGGAGAGCTG
GGCCAAAAGCTGATGCCTCAACTGCCTGCTTCGGTCGATCCCAATACGGTTTCCATGTCGAATGCCCCGACTGGA
GGTGACGCCAAGAAGCTCGTCGATATTGCAAACTTCAAGGTCGGCCAGATCGGACTGCGACACGGAGACCTCATC
TTCATCGACTACAAGTATGCCGATCCCTCGACCAACGGGAAAGCTGCCGCTGTGCCCGCCATGCCCGCCCAAGAC
ACCCCCATCGACCACAAGCCCCAGAGGATAGCGCGGCCGTGGGAGGTGGTGAGGCAGTCGGCTCTCGACGATTCC
CTCGACAGACTCAGTGGCAAGATTCCCCGCGGTCGCGATAGGATGTGTCGACATGGCCCCAAGGGCATGTGTGAC
TACTGCCAACCGCTGGATCCCTTTGACGCCGGCTACCTGGCCGACAAGAAGATCAAGTACACCTCTTTTCACTCG
CACCTCCGCAAGGTCAACGCCTCGACCAACAAGCCCGAGTTGGGGAGCTCCTACATTCCTCCCCTGGTCGAGCCC
TACTACCGCGTCAGGTCCGACTGCCCATCCGGTCACTCTCCCTGGCCCGAGGGCATCTGCTCCAAGTGCCAACCC
AGCGCCATTACGCTACAGCCGCAGTCTTTCCGCATGGTCGATCACGTCGAGTTTGCCGATTCCTCCATCGTCGAC
TCCTTCATCAACACGTGGCGCAAGACGGGAACCCAGCGCATGGGCTTCCTCTACGGTCGGTACGCCGAGTACCCC
GAGGTTCCCCTCGGCGTCAAGGCCGTTGTCGAGGCCATCTACGAGCCGCCTCAGATGGACGAGACGGACGGCATC
ACCACCAACGCCTGGGACAACCAGCAAGAGGTGGACGAGGTGGCGGGACTGTGCGGTCTGGAGCCCGTCGGCGTC
ATCTTTACCGACCTGCTCGACTCGGGACTCGGCGACGGCTCCGTCGTCTGCAAGCGTCACGCCGACTCGTACTAC
CTCTCGTCGCTCGAGATTTGCTTCTGCTCGCGCCTCCAGGCTCAGCGGCCCAAGCCTTCCAAATGGAGCGACACG
GGCCGCTTCGGCTCCAACTTTGTCACCTGCGTCATCTCGGGCAACGAGTCGGGCGAGATCGCCATCGCCTCGTAC
CAAATGTCCAACGCCGCCGTCGAGATGGTCCGCGCCGACATCATCGAGCCGTCTGCCGACCCCAACGTGATGCTG
GTCCGCGACGAGAACGACGACGACGGTTCCGCCAGCCGGACGCGATACGTGCCCGAGGTCTTTTACCGCAAGGTC
AACGAGTACGGGGCCAACGTGCAGGAGAATGCGAAGCCGTCGTTTCCCGTCGAGTACCTCTTCGTCACGCTGACG
CACGGGTTTCCCGCCAACCCGAAACCCGTCTTCACCAACATGGGAGGCTTCCCCATCGAGAACCGCGAATACGTG
GGCGAGAGTCAGGAGCATGCCGTCTTGGCCCGGGCGCTCAGGATGAGCTCGGGTCTGAAACCCAGCGATGGATTG
CAGGAGGTTTCCGACTTTCACCTGCTCTGCTTCCTCTACCGCATGGCCGTCTTCTCCAAGGACGAGTTCGCCCTG
CTGTGCCGCGTCGCCAGCCACCACGACCTCGCCGACTCGTTCCACCTCGGCTCTACCGAAGGCTGGCAGACGCTG
CAGGCCATCCTCCAATCGACCGGTGAGCGCATCCCCAAGCGTAGGCGCGAGTGCAGGGACGGCACCGACGTCGCT
GCCGCGATAGACTCTGGTGAGCCGCTGACGAAGCGATTTGCTGCCTTCAGGCTGAAGGAGGGTCGGAGCGCTGCC
TGA
Transcript >Ophun1|7561
ATGCTGCTTCGACTGCGTGGGCCTGATGGCATGATTCGCCTGACGGTCGAGCAGGGCACTACCTTTGGAGAGCTG
GGCCAAAAGCTGATGCCTCAACTGCCTGCTTCGGTCGATCCCAATACGGTTTCCATGTCGAATGCCCCGACTGGA
GGTGACGCCAAGAAGCTCGTCGATATTGCAAACTTCAAGGTCGGCCAGATCGGACTGCGACACGGAGACCTCATC
TTCATCGACTACAAGTATGCCGATCCCTCGACCAACGGGAAAGCTGCCGCTGTGCCCGCCATGCCCGCCCAAGAC
ACCCCCATCGACCACAAGCCCCAGAGGATAGCGCGGCCGTGGGAGGTGGTGAGGCAGTCGGCTCTCGACGATTCC
CTCGACAGACTCAGTGGCAAGATTCCCCGCGGTCGCGATAGGATGTGTCGACATGGCCCCAAGGGCATGTGTGAC
TACTGCCAACCGCTGGATCCCTTTGACGCCGGCTACCTGGCCGACAAGAAGATCAAGTACACCTCTTTTCACTCG
CACCTCCGCAAGGTCAACGCCTCGACCAACAAGCCCGAGTTGGGGAGCTCCTACATTCCTCCCCTGGTCGAGCCC
TACTACCGCGTCAGGTCCGACTGCCCATCCGGTCACTCTCCCTGGCCCGAGGGCATCTGCTCCAAGTGCCAACCC
AGCGCCATTACGCTACAGCCGCAGTCTTTCCGCATGGTCGATCACGTCGAGTTTGCCGATTCCTCCATCGTCGAC
TCCTTCATCAACACGTGGCGCAAGACGGGAACCCAGCGCATGGGCTTCCTCTACGGTCGGTACGCCGAGTACCCC
GAGGTTCCCCTCGGCGTCAAGGCCGTTGTCGAGGCCATCTACGAGCCGCCTCAGATGGACGAGACGGACGGCATC
ACCACCAACGCCTGGGACAACCAGCAAGAGGTGGACGAGGTGGCGGGACTGTGCGGTCTGGAGCCCGTCGGCGTC
ATCTTTACCGACCTGCTCGACTCGGGACTCGGCGACGGCTCCGTCGTCTGCAAGCGTCACGCCGACTCGTACTAC
CTCTCGTCGCTCGAGATTTGCTTCTGCTCGCGCCTCCAGGCTCAGCGGCCCAAGCCTTCCAAATGGAGCGACACG
GGCCGCTTCGGCTCCAACTTTGTCACCTGCGTCATCTCGGGCAACGAGTCGGGCGAGATCGCCATCGCCTCGTAC
CAAATGTCCAACGCCGCCGTCGAGATGGTCCGCGCCGACATCATCGAGCCGTCTGCCGACCCCAACGTGATGCTG
GTCCGCGACGAGAACGACGACGACGGTTCCGCCAGCCGGACGCGATACGTGCCCGAGGTCTTTTACCGCAAGGTC
AACGAGTACGGGGCCAACGTGCAGGAGAATGCGAAGCCGTCGTTTCCCGTCGAGTACCTCTTCGTCACGCTGACG
CACGGGTTTCCCGCCAACCCGAAACCCGTCTTCACCAACATGGGAGGCTTCCCCATCGAGAACCGCGAATACGTG
GGCGAGAGTCAGGAGCATGCCGTCTTGGCCCGGGCGCTCAGGATGAGCTCGGGTCTGAAACCCAGCGATGGATTG
CAGGAGGTTTCCGACTTTCACCTGCTCTGCTTCCTCTACCGCATGGCCGTCTTCTCCAAGGACGAGTTCGCCCTG
CTGTGCCGCGTCGCCAGCCACCACGACCTCGCCGACTCGTTCCACCTCGGCTCTACCGAAGGCTGGCAGACGCTG
CAGGCCATCCTCCAATCGACCGGTGAGCGCATCCCCAAGCGTAGGCGCGAGTGCAGGGACGGCACCGACGTCGCT
GCCGCGATAGACTCTGGTGAGCCGCTGACGAAGCGATTTGCTGCCTTCAGGCTGAAGGAGGGTCGGAGCGCTGCC
TGA
Gene >Ophun1|7561
ATGCTGCTTCGACTGCGTGGGCCTGATGGCATGATTCGCCTGACGGTCGAGCAGGGCACTACCTTTGGAGAGCTG
GGCCAAAAGGTTGGAGACGATTCTGGCTGTTGAGATGGATGCTGATTTCGTCTAGCTGATGCCTCAACTGCCTGC
TTCGGTCGATCCCAATACGGTTTCCATGTCGAATGCCCCGACTGGAGGTGACGCCAAGAAGCTCGTCGATATTGC
AAACTTCAAGGTCGGCCAGATCGGACTGCGGTACGTCGTCGTCGTCGTCGTCATCATCATCATCATCCTCGCCTG
AAGCACTCACCACTTGAGCTGACTAACCGTCATCCTCGCCAGACACGGAGACCTCATCTTCATCGACTACAAGTA
TGCCGATCCCTCGACCAACGGGAAAGCTGCCGCTGTGCCCGCCATGCCCGCCCAAGACACCCCCATCGACCACAA
GCCCCAGAGGATAGCGCGGCCGTGGGAGGTGGTGAGGCAGTCGGCTCTCGACGATTCCCTCGACAGACTCAGTGG
CAAGATTCCCCGCGGTCGCGATAGGATGTGTCGACATGGCCCCAAGGGCATGTGTGACTACTGCCAACCGCTGGA
TCCCTTTGACGCCGGCTACCTGGCCGACAAGAAGATCAAGTACACCTCTTTTCACTCGCACCTCCGCAAGGTCAA
CGCCTCGACCAACAAGCCCGAGTTGGGGAGCTCCTACATTCCTCCCCTGGTCGAGCCCTACTACCGCGTCAGGTC
CGACTGCCCATCCGGTCACTCTCCCTGGCCCGAGGGCATCTGCTCCAAGTGCCAACCCAGCGCCATTACGCTACA
GCCGCAGTCTTTCCGCATGGTCGATCACGTCGAGTTTGCCGATTCCTCCATCGTCGACTCCTTCATCAACACGTG
GCGCAAGACGGGAACCCAGCGCATGGGCTTCCTCTACGGTCGGTACGCCGAGTACCCCGAGGTTCCCCTCGGCGT
CAAGGCCGTTGTCGAGGCCATCTACGAGCCGCCTCAGATGGACGAGACGGACGGCATCACCACCAACGCCTGGGA
CAACCAGCAAGAGGTGGACGAGGTGGCGGGACTGTGCGGTCTGGAGCCCGTCGGCGTCATCTTTACCGACCTGCT
CGACTCGGGACTCGGCGACGGCTCCGTCGTCTGCAAGCGTCACGCCGACTCGTACTACCTCTCGTCGCTCGAGAT
TTGCTTCTGCTCGCGCCTCCAGGCTCAGCGGCCCAAGCCTTCCAAATGGAGCGACACGGGCCGCTTCGGCTCCAA
CTTTGTCACCTGCGTCATCTCGGGCAACGAGTCGGGCGAGATCGCCATCGCCTCGTACCAAATGTCCAACGCCGC
CGTCGAGATGGTCCGCGCCGACATCATCGAGCCGTCTGCCGACCCCAACGTGATGCTGGTCCGCGACGAGAACGA
CGACGACGGTTCCGCCAGCCGGACGCGATACGTGCCCGAGGTCTTTTACCGCAAGGTCAACGAGTACGGGGCCAA
CGTGCAGGAGAATGCGAAGCCGTCGTTTCCCGTCGAGTACCTCTTCGTCACGCTGACGCACGGGTTTCCCGCCAA
CCCGAAACCCGTCTTCACCAACATGGGAGGCTTCCCCATCGAGAACCGCGAATACGTGGGCGAGAGTCAGGAGCA
TGCCGTCTTGGCCCGGGCGCTCAGGATGAGCTCGGGTCTGAAACCCAGCGATGGATTGCAGGAGGTTTCCGACTT
TCACCTGCTCTGCTTCCTCTACCGCATGGCCGTCTTCTCCAAGGTATCGCCCACTTCTTCCTTGCACTGGTTTGA
ATAATGCCTCCTGACGATACCAGGACGAGTTCGCCCTGCTGTGCCGCGTCGCCAGCCACCACGACCTCGCCGACT
CGTTCCACCTCGGCTCTACCGAAGGCTGGCAGACGCTGCAGGCCATCCTCCAATCGACCGGTGAGCGCATCCCCA
AGCGTAGGCGCGAGTGCAGGGACGGCACCGACGTCGCTGCCGCGATAGACTCTGGTGAGCCGCTGACGAAGCGAT
TTGCTGCCTTCAGGCTGAAGGAGGGTCGGAGCGCTGCCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail