Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7558
Gene name
LocationContig_978:996..4383
Strand-
Gene length (bp)3387
Transcript length (bp)3150
Coding sequence length (bp)3150
Protein length (aa) 1050

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07651 ANTH ANTH domain 3.0E-79 15 275
PF01608 I_LWEQ I/LWEQ domain 7.8E-58 898 1047

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P6L5|SLA2_SCHPO Endocytosis protein end4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=end4 PE=1 SV=2 1 1047 0.0E+00
sp|P33338|SLA2_YEAST Protein SLA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLA2 PE=1 SV=5 10 275 2.0E-93
sp|Q9JKY5|HIP1R_MOUSE Huntingtin-interacting protein 1-related protein OS=Mus musculus GN=Hip1r PE=1 SV=2 8 1046 4.0E-85
sp|O00291|HIP1_HUMAN Huntingtin-interacting protein 1 OS=Homo sapiens GN=HIP1 PE=1 SV=5 18 1047 4.0E-84
sp|Q8VD75|HIP1_MOUSE Huntingtin-interacting protein 1 OS=Mus musculus GN=Hip1 PE=1 SV=2 2 1047 3.0E-74
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P6L5|SLA2_SCHPO Endocytosis protein end4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=end4 PE=1 SV=2 1 1047 0.0E+00
sp|P33338|SLA2_YEAST Protein SLA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLA2 PE=1 SV=5 10 275 2.0E-93
sp|Q9JKY5|HIP1R_MOUSE Huntingtin-interacting protein 1-related protein OS=Mus musculus GN=Hip1r PE=1 SV=2 8 1046 4.0E-85
sp|O00291|HIP1_HUMAN Huntingtin-interacting protein 1 OS=Homo sapiens GN=HIP1 PE=1 SV=5 18 1047 4.0E-84
sp|Q8VD75|HIP1_MOUSE Huntingtin-interacting protein 1 OS=Mus musculus GN=Hip1 PE=1 SV=2 2 1047 3.0E-74
sp|P33338|SLA2_YEAST Protein SLA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLA2 PE=1 SV=5 640 1046 5.0E-72
sp|O75146|HIP1R_HUMAN Huntingtin-interacting protein 1-related protein OS=Homo sapiens GN=HIP1R PE=1 SV=2 383 1046 1.0E-52
sp|Q02328|SLAP2_CAEEL Huntington interacting protein related 1 OS=Caenorhabditis elegans GN=hipr-1 PE=3 SV=3 821 1047 7.0E-34
sp|Q54K81|TALB_DICDI Talin-B OS=Dictyostelium discoideum GN=talB PE=2 SV=1 852 1049 8.0E-26
sp|Q02328|SLAP2_CAEEL Huntington interacting protein related 1 OS=Caenorhabditis elegans GN=hipr-1 PE=3 SV=3 19 440 3.0E-25
sp|P0CE95|TALA1_DICDI Talin-A OS=Dictyostelium discoideum GN=talA PE=1 SV=1 653 1048 7.0E-22
sp|Q9Y4G6|TLN2_HUMAN Talin-2 OS=Homo sapiens GN=TLN2 PE=1 SV=4 841 1047 1.0E-20
sp|Q9Y490|TLN1_HUMAN Talin-1 OS=Homo sapiens GN=TLN1 PE=1 SV=3 841 1047 2.0E-20
sp|P26039|TLN1_MOUSE Talin-1 OS=Mus musculus GN=Tln1 PE=1 SV=2 841 1047 3.0E-20
sp|P54939|TLN1_CHICK Talin-1 OS=Gallus gallus GN=TLN1 PE=1 SV=2 841 1047 4.0E-20
sp|Q71LX4|TLN2_MOUSE Talin-2 OS=Mus musculus GN=Tln2 PE=1 SV=3 841 978 4.0E-16
[Show less]

GO

GO Term Description Terminal node
GO:0003779 actin binding Yes
GO:0005543 phospholipid binding Yes
GO:0008289 lipid binding No
GO:0008092 cytoskeletal protein binding No
GO:0003674 molecular_function No
GO:0005515 protein binding No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1951
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5280
Ophiocordyceps australis map64 (Brazil) OphauB2|5044
Ophiocordyceps camponoti-floridani Ophcf2|06134
Ophiocordyceps camponoti-rufipedis Ophun1|7558 (this protein)
Ophiocordyceps kimflemingae Ophio5|5024
Ophiocordyceps subramaniannii Hirsu2|2099

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7558
MASMRTQEHTKTDQELAISIKKATNGEELSPKRKHVRACIVYTWDHRSAQAFWTGIKVQPILADEVMTFKALITI
HKVLQEGHPSAIKDAMANRSWIDGLNRSINGEGIRGYGPLIREYVYYLLAKLSFHQQHPEFNGTFEYEEYLSLKA
INDPDEGYETITDLMVLQDKIEQFQKLIFSHFRNVGNNECRISALVPLVQESYGIYKFITSMMRAMYQMTGDEEA
LEPLHQRYDAQHYRLVKFYYECSNLRYLTSLITIPKLPQEPPNLLAIDDTAPALPARPKQEIERQPTPPPEPKSE
EPGEISEFWKNELDRQNREYEEQQRVLEQRQQAALLAQQQAQMQAQRDFDEQQRRLMEQQQREQEALLAQQAQWQ
TQGRLAELERENLNARAQYERDQLMLQQYDQRVKALEGELGQIQGSFGQQMSSRDEQIRALQEQVNTWRTKYEAL
AKLYSQLRHEHLDLLQKFKSVQLKAASAQEAMDRRERLEREIKTKNLELANMIRERDRAMHDRDRLSGSNKDEVE
RLKRELRMAQERLDNSERSKGNELSTMLAKYNREMSDLEEALRSKSKALEEAQSRARDGSSDLERLLRDKEEELE
VYKAGMDQTLMELSELKLSQGDTDKALDGQIDALIMSSLDKITDMMDSVLQAGVSRVDDALYELDSSMQAGNQNA
SPSYVLSQIEKSSASAMEFATAFNNFIADGPNSEHGDVIKAVSVFSGAVADLCSNTKGLTRLATDDGRTDALMGG
ARQSATATVAFFRALQSFRLTGLEPLQKTDVVINSNNDVQMRLQKLSKLVEALAPGFGQLTRGQGDLGDLVDSEL
NKAAEAIEAAAARLAKMKSKPSMSTYEVKVHDSILEAATAMTSAIAELIRAATVTQQEIVQAGRGSSSRTAFYKK
NNRWTEGLISAAKAVASSTNRLIETADGVLSGRNSPEQLIVASNDVAASTAQLVAASRVKAGFMSKSQERLEQAS
KAVGAACRSLVRQVQAMIRERSQDEEQVDYAKLGAHEFKVREMEQQVEILQLENSLASARHRLGEMRKISYQEE*
Coding >Ophun1|7558
ATGGCGTCTATGCGCACTCAAGAGCATACAAAAACCGACCAAGAGCTCGCCATCAGCATCAAAAAGGCCACAAAC
GGCGAAGAGCTCTCCCCCAAGCGCAAGCATGTACGAGCCTGCATCGTCTATACCTGGGATCACAGGTCCGCCCAG
GCCTTCTGGACCGGTATCAAGGTGCAACCGATTCTCGCGGACGAGGTCATGACCTTCAAGGCCCTCATCACCATC
CACAAGGTGCTGCAGGAGGGACACCCTTCGGCTATTAAAGATGCCATGGCCAACCGCAGCTGGATCGACGGCCTC
AACCGATCCATCAACGGCGAGGGCATCCGTGGGTATGGGCCCTTGATTCGAGAATACGTGTACTACCTGCTCGCC
AAGCTCTCTTTCCACCAGCAGCACCCCGAGTTCAACGGCACTTTCGAGTACGAGGAGTACCTGAGTCTGAAAGCT
ATTAACGACCCAGACGAAGGCTACGAGACCATCACCGACCTCATGGTCCTGCAGGACAAGATTGAGCAGTTCCAG
AAGCTGATTTTCTCGCATTTTCGAAACGTCGGTAACAACGAGTGTCGAATCTCGGCCCTAGTGCCGCTTGTGCAG
GAGAGCTACGGCATCTACAAGTTCATCACCAGCATGATGAGGGCCATGTATCAGATGACGGGCGACGAAGAAGCC
CTTGAACCCTTGCACCAGCGATACGACGCCCAGCACTACCGACTCGTCAAGTTTTACTACGAGTGCTCCAACCTG
CGATACCTCACGAGCCTCATAACGATTCCCAAGCTGCCGCAGGAGCCTCCGAACTTGCTGGCGATCGACGATACA
GCCCCAGCGCTGCCGGCGCGGCCCAAGCAGGAGATTGAACGTCAGCCGACGCCTCCGCCAGAGCCAAAGTCGGAA
GAGCCCGGGGAGATTTCCGAGTTTTGGAAGAATGAGCTGGACCGGCAGAATCGCGAGTACGAGGAGCAGCAGCGC
GTGCTGGAGCAGAGGCAGCAGGCGGCGTTGCTGGCGCAGCAACAGGCCCAGATGCAGGCGCAGCGCGACTTTGAC
GAGCAGCAACGGCGGCTGATGGAGCAGCAGCAGCGTGAGCAGGAGGCTCTTCTGGCGCAACAGGCCCAGTGGCAG
ACACAAGGGCGGCTGGCGGAGCTGGAGCGGGAGAACCTCAACGCGCGAGCGCAGTACGAGCGCGACCAGCTGATG
CTGCAGCAGTACGACCAGCGAGTCAAGGCGCTCGAGGGCGAGCTGGGCCAGATCCAGGGCAGCTTCGGACAGCAA
ATGTCGAGCCGAGACGAGCAGATCCGGGCGCTACAGGAGCAGGTCAACACTTGGAGGACCAAGTACGAGGCGCTG
GCCAAGCTGTACTCGCAACTACGGCACGAGCACCTGGATCTGCTGCAAAAGTTCAAGTCGGTGCAGCTCAAGGCG
GCGAGCGCGCAAGAGGCCATGGACCGACGCGAGCGGCTGGAGCGGGAGATCAAGACGAAGAACCTGGAGCTGGCC
AACATGATACGGGAGAGGGACAGGGCCATGCACGACCGGGACAGGCTCAGCGGCAGCAACAAGGACGAGGTCGAG
CGGCTCAAGCGGGAGCTGCGGATGGCGCAGGAGCGGTTGGACAACTCGGAGCGCAGCAAGGGCAACGAGCTGTCG
ACGATGCTGGCCAAGTACAACCGCGAGATGAGCGACCTGGAAGAGGCGCTGCGCAGCAAGTCCAAGGCGCTGGAG
GAGGCGCAATCCCGGGCGCGAGACGGCAGCTCGGACCTGGAGCGGCTGCTGCGCGACAAGGAGGAGGAGCTGGAG
GTTTACAAGGCGGGCATGGACCAGACGCTGATGGAGCTGAGCGAGCTCAAGCTGAGCCAGGGCGACACGGACAAG
GCGCTGGACGGGCAGATTGACGCTCTCATCATGTCGAGCCTGGACAAGATCACCGACATGATGGACTCGGTGCTC
CAGGCGGGCGTGTCGCGGGTCGACGATGCCCTGTACGAGCTCGACTCGTCGATGCAGGCGGGCAACCAGAACGCG
TCGCCGTCGTACGTGCTGTCGCAGATTGAGAAGTCTTCGGCCTCGGCCATGGAGTTTGCGACGGCCTTTAACAAC
TTCATCGCCGACGGGCCCAACAGCGAGCACGGCGACGTCATCAAGGCCGTCAGCGTCTTCTCGGGCGCCGTGGCG
GATCTCTGCAGCAACACCAAGGGGCTGACGAGGCTGGCGACGGACGACGGGCGGACGGACGCCCTGATGGGAGGC
GCGCGACAGTCGGCGACGGCGACGGTGGCCTTTTTCCGCGCGCTCCAGAGCTTCCGGCTGACGGGGCTGGAGCCT
CTGCAGAAGACGGACGTGGTCATCAACAGCAACAACGACGTACAGATGCGACTGCAGAAGCTCAGCAAGCTGGTC
GAGGCCCTGGCGCCGGGCTTCGGCCAGCTGACGCGCGGGCAGGGCGACCTGGGCGACCTGGTCGACTCGGAGCTC
AACAAGGCGGCAGAGGCCATCGAGGCGGCGGCGGCTCGACTGGCCAAGATGAAGAGCAAGCCCTCGATGTCGACG
TACGAGGTCAAGGTGCACGACTCGATCCTGGAGGCGGCGACGGCCATGACGAGCGCCATCGCGGAGCTGATCCGG
GCGGCGACGGTGACGCAGCAGGAGATTGTACAGGCGGGTCGCGGTTCCTCGTCGCGGACGGCGTTTTACAAGAAG
AACAACCGGTGGACCGAGGGTCTGATCTCGGCGGCCAAGGCGGTGGCCTCGTCGACCAACCGGCTGATTGAGACG
GCCGACGGGGTGCTTTCGGGACGCAACAGTCCGGAGCAGCTGATTGTGGCGTCCAACGACGTGGCGGCCTCTACG
GCTCAGCTGGTGGCGGCCAGCCGCGTCAAGGCGGGCTTCATGTCCAAGAGCCAGGAGAGGCTGGAGCAGGCGAGC
AAGGCGGTGGGAGCGGCGTGTCGGTCGCTGGTGCGCCAGGTGCAGGCCATGATCCGGGAGAGGAGCCAGGACGAG
GAGCAGGTCGACTATGCGAAGCTGGGGGCGCACGAATTCAAGGTGCGAGAGATGGAGCAGCAGGTGGAGATTTTG
CAGCTGGAGAATTCGCTGGCTTCGGCGAGGCATCGGTTGGGCGAGATGCGCAAGATTTCTTATCAGGAGGAGTGA
Transcript >Ophun1|7558
ATGGCGTCTATGCGCACTCAAGAGCATACAAAAACCGACCAAGAGCTCGCCATCAGCATCAAAAAGGCCACAAAC
GGCGAAGAGCTCTCCCCCAAGCGCAAGCATGTACGAGCCTGCATCGTCTATACCTGGGATCACAGGTCCGCCCAG
GCCTTCTGGACCGGTATCAAGGTGCAACCGATTCTCGCGGACGAGGTCATGACCTTCAAGGCCCTCATCACCATC
CACAAGGTGCTGCAGGAGGGACACCCTTCGGCTATTAAAGATGCCATGGCCAACCGCAGCTGGATCGACGGCCTC
AACCGATCCATCAACGGCGAGGGCATCCGTGGGTATGGGCCCTTGATTCGAGAATACGTGTACTACCTGCTCGCC
AAGCTCTCTTTCCACCAGCAGCACCCCGAGTTCAACGGCACTTTCGAGTACGAGGAGTACCTGAGTCTGAAAGCT
ATTAACGACCCAGACGAAGGCTACGAGACCATCACCGACCTCATGGTCCTGCAGGACAAGATTGAGCAGTTCCAG
AAGCTGATTTTCTCGCATTTTCGAAACGTCGGTAACAACGAGTGTCGAATCTCGGCCCTAGTGCCGCTTGTGCAG
GAGAGCTACGGCATCTACAAGTTCATCACCAGCATGATGAGGGCCATGTATCAGATGACGGGCGACGAAGAAGCC
CTTGAACCCTTGCACCAGCGATACGACGCCCAGCACTACCGACTCGTCAAGTTTTACTACGAGTGCTCCAACCTG
CGATACCTCACGAGCCTCATAACGATTCCCAAGCTGCCGCAGGAGCCTCCGAACTTGCTGGCGATCGACGATACA
GCCCCAGCGCTGCCGGCGCGGCCCAAGCAGGAGATTGAACGTCAGCCGACGCCTCCGCCAGAGCCAAAGTCGGAA
GAGCCCGGGGAGATTTCCGAGTTTTGGAAGAATGAGCTGGACCGGCAGAATCGCGAGTACGAGGAGCAGCAGCGC
GTGCTGGAGCAGAGGCAGCAGGCGGCGTTGCTGGCGCAGCAACAGGCCCAGATGCAGGCGCAGCGCGACTTTGAC
GAGCAGCAACGGCGGCTGATGGAGCAGCAGCAGCGTGAGCAGGAGGCTCTTCTGGCGCAACAGGCCCAGTGGCAG
ACACAAGGGCGGCTGGCGGAGCTGGAGCGGGAGAACCTCAACGCGCGAGCGCAGTACGAGCGCGACCAGCTGATG
CTGCAGCAGTACGACCAGCGAGTCAAGGCGCTCGAGGGCGAGCTGGGCCAGATCCAGGGCAGCTTCGGACAGCAA
ATGTCGAGCCGAGACGAGCAGATCCGGGCGCTACAGGAGCAGGTCAACACTTGGAGGACCAAGTACGAGGCGCTG
GCCAAGCTGTACTCGCAACTACGGCACGAGCACCTGGATCTGCTGCAAAAGTTCAAGTCGGTGCAGCTCAAGGCG
GCGAGCGCGCAAGAGGCCATGGACCGACGCGAGCGGCTGGAGCGGGAGATCAAGACGAAGAACCTGGAGCTGGCC
AACATGATACGGGAGAGGGACAGGGCCATGCACGACCGGGACAGGCTCAGCGGCAGCAACAAGGACGAGGTCGAG
CGGCTCAAGCGGGAGCTGCGGATGGCGCAGGAGCGGTTGGACAACTCGGAGCGCAGCAAGGGCAACGAGCTGTCG
ACGATGCTGGCCAAGTACAACCGCGAGATGAGCGACCTGGAAGAGGCGCTGCGCAGCAAGTCCAAGGCGCTGGAG
GAGGCGCAATCCCGGGCGCGAGACGGCAGCTCGGACCTGGAGCGGCTGCTGCGCGACAAGGAGGAGGAGCTGGAG
GTTTACAAGGCGGGCATGGACCAGACGCTGATGGAGCTGAGCGAGCTCAAGCTGAGCCAGGGCGACACGGACAAG
GCGCTGGACGGGCAGATTGACGCTCTCATCATGTCGAGCCTGGACAAGATCACCGACATGATGGACTCGGTGCTC
CAGGCGGGCGTGTCGCGGGTCGACGATGCCCTGTACGAGCTCGACTCGTCGATGCAGGCGGGCAACCAGAACGCG
TCGCCGTCGTACGTGCTGTCGCAGATTGAGAAGTCTTCGGCCTCGGCCATGGAGTTTGCGACGGCCTTTAACAAC
TTCATCGCCGACGGGCCCAACAGCGAGCACGGCGACGTCATCAAGGCCGTCAGCGTCTTCTCGGGCGCCGTGGCG
GATCTCTGCAGCAACACCAAGGGGCTGACGAGGCTGGCGACGGACGACGGGCGGACGGACGCCCTGATGGGAGGC
GCGCGACAGTCGGCGACGGCGACGGTGGCCTTTTTCCGCGCGCTCCAGAGCTTCCGGCTGACGGGGCTGGAGCCT
CTGCAGAAGACGGACGTGGTCATCAACAGCAACAACGACGTACAGATGCGACTGCAGAAGCTCAGCAAGCTGGTC
GAGGCCCTGGCGCCGGGCTTCGGCCAGCTGACGCGCGGGCAGGGCGACCTGGGCGACCTGGTCGACTCGGAGCTC
AACAAGGCGGCAGAGGCCATCGAGGCGGCGGCGGCTCGACTGGCCAAGATGAAGAGCAAGCCCTCGATGTCGACG
TACGAGGTCAAGGTGCACGACTCGATCCTGGAGGCGGCGACGGCCATGACGAGCGCCATCGCGGAGCTGATCCGG
GCGGCGACGGTGACGCAGCAGGAGATTGTACAGGCGGGTCGCGGTTCCTCGTCGCGGACGGCGTTTTACAAGAAG
AACAACCGGTGGACCGAGGGTCTGATCTCGGCGGCCAAGGCGGTGGCCTCGTCGACCAACCGGCTGATTGAGACG
GCCGACGGGGTGCTTTCGGGACGCAACAGTCCGGAGCAGCTGATTGTGGCGTCCAACGACGTGGCGGCCTCTACG
GCTCAGCTGGTGGCGGCCAGCCGCGTCAAGGCGGGCTTCATGTCCAAGAGCCAGGAGAGGCTGGAGCAGGCGAGC
AAGGCGGTGGGAGCGGCGTGTCGGTCGCTGGTGCGCCAGGTGCAGGCCATGATCCGGGAGAGGAGCCAGGACGAG
GAGCAGGTCGACTATGCGAAGCTGGGGGCGCACGAATTCAAGGTGCGAGAGATGGAGCAGCAGGTGGAGATTTTG
CAGCTGGAGAATTCGCTGGCTTCGGCGAGGCATCGGTTGGGCGAGATGCGCAAGATTTCTTATCAGGAGGAGTGA
Gene >Ophun1|7558
ATGGCGTCTATGCGCACTCAAGAGCATACAAAGTTCGTCCGCAGGATTCTGAGAGTCTTTTCGACCTCTGCTAAC
TCGCCTCGCCCGCGCAGAACCGACCAAGAGCTCGCCATCAGCATCAAAAAGGCCACAAACGGCGAAGAGCTCTCC
CCCAAGCGCAAGCATGTACGAGCCTGCATCGTCTATACCTGGGATCACAGGTCCGCCCAGGCCTTCTGGACCGGT
ATCAAGGTGTAGGTTCCTCCCCTCCGTCGATCAAGATCGAAAGCTGAGTAATGGCACGCAGGCAACCGATTCTCG
CGGACGAGGTCATGACCTTCAAGGCCCTCATCACCATCCACAAGGTGCTGCAGGAGGGACACCCTTCGGCTATTA
AAGATGCCATGGCCAACCGCAGCTGGATCGACGGCCTCAACCGATCCATCAACGGCGAGGGCATCCGTGGGTATG
GGCCCTTGATTCGAGAATACGTGTACTACCTGCTCGCCAAGCTCTCTTTCCACCAGCAGCACCCCGAGTTCAACG
GCACTTTCGAGTACGAGGAGTACCTGAGTCTGAAAGCTATTAACGACCCAGACGAAGGCTACGAGACCATCACCG
ACCTCATGGTCCTGCAGGACAAGATTGAGCAGTTCCAGAAGCTGATTTTCTCGCATTTTCGAAACGTCGGTAACA
ACGAGTGTCGAATCTCGGCCCTAGTGCCGCTTGTGCAGGAGAGCTACGGCATCTACAAGTTCATCACCAGCATGA
TGAGGGCCATGTATCAGAGTAAGAGAAACCCTGGCGGCGAGGTAGCGTGTTACGAAGAACTGCATGCTAACTTAT
GTGACGTTTCTAGTGACGGGCGACGAAGAAGCCCTTGAACCCTTGCACCAGCGATACGACGCCCAGCACTACCGA
CTCGTCAAGTTTTACTACGAGTGCTCCAACCTGCGATACCTCACGAGCCTCATAACGATTCCCAAGCTGCCGCAG
GAGCCTCCGAACTTGCTGGCGATCGACGATACAGCCCCAGCGCTGCCGGCGCGGCCCAAGCAGGAGATTGAACGT
CAGCCGACGCCTCCGCCAGAGCCAAAGTCGGAAGAGCCCGGGGAGATTTCCGAGTTTTGGAAGAATGAGCTGGAC
CGGCAGAATCGCGAGTACGAGGAGCAGCAGCGCGTGCTGGAGCAGAGGCAGCAGGCGGCGTTGCTGGCGCAGCAA
CAGGCCCAGATGCAGGCGCAGCGCGACTTTGACGAGCAGCAACGGCGGCTGATGGAGCAGCAGCAGCGTGAGCAG
GAGGCTCTTCTGGCGCAACAGGCCCAGTGGCAGACACAAGGGCGGCTGGCGGAGCTGGAGCGGGAGAACCTCAAC
GCGCGAGCGCAGTACGAGCGCGACCAGCTGATGCTGCAGCAGTACGACCAGCGAGTCAAGGCGCTCGAGGGCGAG
CTGGGCCAGATCCAGGGCAGCTTCGGACAGCAAATGTCGAGCCGAGACGAGCAGATCCGGGCGCTACAGGAGCAG
GTCAACACTTGGAGGACCAAGTACGAGGCGCTGGCCAAGCTGTACTCGCAACTACGGCACGAGCACCTGGATCTG
CTGCAAAAGTTCAAGTCGGTGCAGCTCAAGGCGGCGAGCGCGCAAGAGGCCATGGACCGACGCGAGCGGCTGGAG
CGGGAGATCAAGACGAAGAACCTGGAGCTGGCCAACATGATACGGGAGAGGGACAGGGCCATGCACGACCGGGAC
AGGCTCAGCGGCAGCAACAAGGACGAGGTCGAGCGGCTCAAGCGGGAGCTGCGGATGGCGCAGGAGCGGTTGGAC
AACTCGGAGCGCAGCAAGGGCAACGAGCTGTCGACGATGCTGGCCAAGTACAACCGCGAGATGAGCGACCTGGAA
GAGGCGCTGCGCAGCAAGTCCAAGGCGCTGGAGGAGGCGCAATCCCGGGCGCGAGACGGCAGCTCGGACCTGGAG
CGGCTGCTGCGCGACAAGGAGGAGGAGCTGGAGGTTTACAAGGCGGGCATGGACCAGACGCTGATGGAGCTGAGC
GAGCTCAAGCTGAGCCAGGGCGACACGGACAAGGCGCTGGACGGGCAGATTGACGCTCTCATCATGTCGAGCCTG
GACAAGATCACCGACATGATGGACTCGGTGCTCCAGGCGGGCGTGTCGCGGGTCGACGATGCCCTGTACGAGCTC
GACTCGTCGATGCAGGCGGGCAACCAGAACGCGTCGCCGTCGTACGTGCTGTCGCAGATTGAGAAGTCTTCGGCC
TCGGCCATGGAGTTTGCGACGGCCTTTAACAACTTCATCGCCGACGGGCCCAACAGCGAGCACGGCGACGTCATC
AAGGCCGTCAGCGTCTTCTCGGGCGCCGTGGCGGATCTCTGCAGCAACACCAAGGGGCTGACGAGGCTGGCGACG
GACGACGGGCGGACGGACGCCCTGATGGGAGGCGCGCGACAGTCGGCGACGGCGACGGTGGCCTTTTTCCGCGCG
CTCCAGAGCTTCCGGCTGACGGGGCTGGAGCCTCTGCAGAAGACGGACGTGGTCATCAACAGCAACAACGACGTA
CAGATGCGACTGCAGAAGCTCAGCAAGCTGGTCGAGGCCCTGGCGCCGGGCTTCGGCCAGCTGACGCGCGGGCAG
GGCGACCTGGGCGACCTGGTCGACTCGGAGCTCAACAAGGCGGCAGAGGCCATCGAGGCGGCGGCGGCTCGACTG
GCCAAGATGAAGAGCAAGCCCTCGATGTCGACGTACGAGGTCAAGGTGCACGACTCGATCCTGGAGGCGGCGACG
GCCATGACGAGCGCCATCGCGGAGCTGATCCGGGCGGCGACGGTGACGCAGCAGGAGATTGTACAGGCGGGTCGC
GGTTCCTCGTCGCGGACGGCGTTTTACAAGAAGAACAACCGGTGGACCGAGGGTCTGATCTCGGCGGCCAAGGCG
GTGGCCTCGTCGACCAACCGGCTGATTGAGACGGCCGACGGGGTGCTTTCGGGACGCAACAGTCCGGAGCAGCTG
ATTGTGGCGTCCAACGACGTGGCGGCCTCTACGGCTCAGCTGGTGGCGGCCAGCCGCGTCAAGGCGGGCTTCATG
TCCAAGAGCCAGGAGAGGCTGGAGCAGGCGAGCAAGGCGGTGGGAGCGGCGTGTCGGTCGCTGGTGCGCCAGGTG
CAGGCCATGATCCGGGAGAGGAGCCAGGACGAGGAGCAGGTCGACTATGCGAAGCTGGGGGCGCACGAATTCAAG
GTGCGAGAGATGGAGCAGCAGGTGAGTTTCTACAAATGTTTCTACGTTGGTGTTCTGGACTGACAGGATGGACAG
GTGGAGATTTTGCAGCTGGAGAATTCGCTGGCTTCGGCGAGGCATCGGTTGGGCGAGATGCGCAAGATTTCTTAT
CAGGAGGAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail