Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7549
Gene name
LocationContig_972:51..2050
Strand-
Gene length (bp)1999
Transcript length (bp)1641
Coding sequence length (bp)1641
Protein length (aa) 547

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17683 TFIIF_beta_N TFIIF, beta subunit N-terminus 3.8E-30 43 206
PF02270 TFIIF_beta TFIIF, beta subunit HTH domain 3.2E-27 275 339
PF12710 HAD haloacid dehalogenase-like hydrolase 1.1E-06 408 540

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94424|T2FB_SCHPO Transcription initiation factor IIF subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tfg2 PE=1 SV=1 12 339 6.0E-37
sp|P41896|T2FB_YEAST Transcription initiation factor IIF subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TFG2 PE=1 SV=2 26 375 1.0E-28
sp|Q03123|T2FB_XENLA General transcription factor IIF subunit 2 OS=Xenopus laevis GN=gtf2f2 PE=2 SV=1 267 345 5.0E-08
sp|Q54KT7|T2FB_DICDI General transcription factor IIF subunit 2 OS=Dictyostelium discoideum GN=gtf2f2 PE=3 SV=2 277 344 1.0E-07
sp|P13984|T2FB_HUMAN General transcription factor IIF subunit 2 OS=Homo sapiens GN=GTF2F2 PE=1 SV=2 267 345 2.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94424|T2FB_SCHPO Transcription initiation factor IIF subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tfg2 PE=1 SV=1 12 339 6.0E-37
sp|P41896|T2FB_YEAST Transcription initiation factor IIF subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TFG2 PE=1 SV=2 26 375 1.0E-28
sp|Q03123|T2FB_XENLA General transcription factor IIF subunit 2 OS=Xenopus laevis GN=gtf2f2 PE=2 SV=1 267 345 5.0E-08
sp|Q54KT7|T2FB_DICDI General transcription factor IIF subunit 2 OS=Dictyostelium discoideum GN=gtf2f2 PE=3 SV=2 277 344 1.0E-07
sp|P13984|T2FB_HUMAN General transcription factor IIF subunit 2 OS=Homo sapiens GN=GTF2F2 PE=1 SV=2 267 345 2.0E-06
sp|Q2T9L9|T2FB_BOVIN General transcription factor IIF subunit 2 OS=Bos taurus GN=GTF2F2 PE=2 SV=1 267 339 8.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4610
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5447
Ophiocordyceps australis map64 (Brazil) OphauB2|3018
Ophiocordyceps camponoti-floridani Ophcf2|07329
Ophiocordyceps camponoti-rufipedis Ophun1|7549 (this protein)
Ophiocordyceps kimflemingae Ophio5|8371
Ophiocordyceps subramaniannii Hirsu2|9670

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7549
MADSFVKPEPDEEKPTLPLEDEDPDEDAGDLEFYDKSNNQFETLYLARVPRYMWDAWLKMTERLGDDDEIQIGTL
RTWNQSEVDAEGVAHDVTKLRMLLEANCPEHQALPREYELEVLDRDVQNHFIFSEEDLPSYKARNKARAEAANSG
IPASLLRQRAQGNGQDHGPQRNSFDRRNRFQPYFRKAIPKKTKMFGKIHYDVRVEPRNVRDEERVLARKLLDAEQ
SKSKLQIISRNSASSIMNPGTAVAAQWGGNFIKNAAQQVKPKKGEVFKAARIPKNQLLDLIFDCFRHYQYWSMKA
LRQKLQQPDTYLRQVLEEVAVLHKSGRFANHYGLNDAYKDKAGSDAKEEAATAAEDGGAFGDDDDDDDEELEDVL
PAQDGTDDDFASSYHEEMSMADDQDAALKMHLVFDFDGTITVQDTMGEFAASAVAWQQQRLGRNLQGEWDEAVRA
YAADLTAVTGWDSATTIEAECRFLASLRTVEEASLQRVQRSGLLTGLGRRELFRMGGSAVSEGRVKIREGFRAVT
EVAARRGWRTDVVSGWGSGGE*
Coding >Ophun1|7549
ATGGCGGACTCGTTCGTCAAGCCGGAACCCGACGAGGAGAAACCGACGCTGCCGCTGGAAGACGAGGACCCGGAC
GAGGATGCTGGCGACCTCGAGTTTTACGACAAATCCAACAATCAGTTCGAGACGCTGTATCTCGCTCGCGTGCCC
CGTTACATGTGGGATGCCTGGCTGAAAATGACGGAACGGCTAGGCGACGACGATGAGATTCAGATCGGCACGCTT
CGCACCTGGAATCAGTCCGAGGTTGATGCCGAGGGCGTGGCGCACGATGTCACCAAGTTGCGCATGCTACTCGAG
GCCAACTGCCCCGAGCATCAGGCGCTGCCTCGCGAGTACGAGCTCGAGGTGCTGGATCGTGATGTGCAGAATCAT
TTCATCTTTAGTGAGGAGGATCTGCCGAGTTACAAGGCTCGCAACAAGGCTCGTGCCGAGGCGGCAAACTCTGGG
ATTCCCGCCTCCCTACTGCGGCAACGGGCGCAGGGTAACGGGCAGGACCATGGGCCGCAGCGGAACAGCTTCGAT
CGGAGGAACCGATTTCAACCGTACTTTCGCAAGGCCATACCGAAAAAGACCAAGATGTTTGGGAAGATTCACTAC
GACGTACGCGTCGAACCGCGTAACGTGCGGGACGAAGAGCGTGTGTTGGCGCGGAAGCTTCTGGACGCCGAGCAG
TCCAAGTCCAAGCTACAGATCATCAGCAGGAACAGCGCGTCGTCCATCATGAACCCGGGCACCGCCGTCGCGGCT
CAATGGGGAGGCAACTTTATCAAAAATGCAGCGCAGCAGGTCAAGCCCAAGAAGGGCGAGGTGTTCAAGGCGGCG
CGGATTCCCAAGAACCAGCTGCTGGATCTCATCTTCGACTGCTTCCGGCACTACCAGTATTGGTCTATGAAGGCG
CTGCGTCAGAAGCTGCAGCAGCCCGACACGTACCTGCGACAGGTGCTGGAAGAGGTGGCTGTGCTGCACAAGAGC
GGCCGCTTCGCCAACCACTACGGACTCAACGACGCCTACAAGGACAAGGCTGGCAGCGATGCCAAGGAAGAGGCG
GCCACGGCGGCCGAAGATGGGGGCGCGTTTGGCGATGACGACGATGACGATGACGAGGAGCTGGAAGACGTGCTG
CCGGCACAGGATGGCACCGACGACGACTTTGCTAGCTCGTATCACGAAGAGATGTCCATGGCAGATGACCAAGAC
GCTGCTCTCAAGATGCACCTCGTCTTCGACTTTGACGGCACCATCACGGTCCAAGACACCATGGGCGAGTTTGCG
GCATCGGCCGTGGCCTGGCAGCAGCAGCGTCTGGGCCGCAACCTGCAGGGCGAATGGGACGAGGCGGTACGAGCG
TACGCAGCCGACCTGACAGCCGTTACGGGATGGGACTCTGCGACGACGATAGAAGCCGAGTGCCGCTTCCTGGCG
AGCCTCCGAACCGTGGAAGAGGCGTCACTGCAGCGGGTGCAGCGCAGCGGGCTCCTCACGGGGCTAGGACGGAGG
GAGCTGTTCCGGATGGGGGGCTCGGCGGTTTCGGAGGGCCGGGTGAAGATTCGGGAGGGCTTCCGGGCGGTGACG
GAGGTGGCGGCGCGGCGCGGGTGGCGGACCGACGTCGTCTCGGGTTGGGGGAGTGGCGGCGAATGA
Transcript >Ophun1|7549
ATGGCGGACTCGTTCGTCAAGCCGGAACCCGACGAGGAGAAACCGACGCTGCCGCTGGAAGACGAGGACCCGGAC
GAGGATGCTGGCGACCTCGAGTTTTACGACAAATCCAACAATCAGTTCGAGACGCTGTATCTCGCTCGCGTGCCC
CGTTACATGTGGGATGCCTGGCTGAAAATGACGGAACGGCTAGGCGACGACGATGAGATTCAGATCGGCACGCTT
CGCACCTGGAATCAGTCCGAGGTTGATGCCGAGGGCGTGGCGCACGATGTCACCAAGTTGCGCATGCTACTCGAG
GCCAACTGCCCCGAGCATCAGGCGCTGCCTCGCGAGTACGAGCTCGAGGTGCTGGATCGTGATGTGCAGAATCAT
TTCATCTTTAGTGAGGAGGATCTGCCGAGTTACAAGGCTCGCAACAAGGCTCGTGCCGAGGCGGCAAACTCTGGG
ATTCCCGCCTCCCTACTGCGGCAACGGGCGCAGGGTAACGGGCAGGACCATGGGCCGCAGCGGAACAGCTTCGAT
CGGAGGAACCGATTTCAACCGTACTTTCGCAAGGCCATACCGAAAAAGACCAAGATGTTTGGGAAGATTCACTAC
GACGTACGCGTCGAACCGCGTAACGTGCGGGACGAAGAGCGTGTGTTGGCGCGGAAGCTTCTGGACGCCGAGCAG
TCCAAGTCCAAGCTACAGATCATCAGCAGGAACAGCGCGTCGTCCATCATGAACCCGGGCACCGCCGTCGCGGCT
CAATGGGGAGGCAACTTTATCAAAAATGCAGCGCAGCAGGTCAAGCCCAAGAAGGGCGAGGTGTTCAAGGCGGCG
CGGATTCCCAAGAACCAGCTGCTGGATCTCATCTTCGACTGCTTCCGGCACTACCAGTATTGGTCTATGAAGGCG
CTGCGTCAGAAGCTGCAGCAGCCCGACACGTACCTGCGACAGGTGCTGGAAGAGGTGGCTGTGCTGCACAAGAGC
GGCCGCTTCGCCAACCACTACGGACTCAACGACGCCTACAAGGACAAGGCTGGCAGCGATGCCAAGGAAGAGGCG
GCCACGGCGGCCGAAGATGGGGGCGCGTTTGGCGATGACGACGATGACGATGACGAGGAGCTGGAAGACGTGCTG
CCGGCACAGGATGGCACCGACGACGACTTTGCTAGCTCGTATCACGAAGAGATGTCCATGGCAGATGACCAAGAC
GCTGCTCTCAAGATGCACCTCGTCTTCGACTTTGACGGCACCATCACGGTCCAAGACACCATGGGCGAGTTTGCG
GCATCGGCCGTGGCCTGGCAGCAGCAGCGTCTGGGCCGCAACCTGCAGGGCGAATGGGACGAGGCGGTACGAGCG
TACGCAGCCGACCTGACAGCCGTTACGGGATGGGACTCTGCGACGACGATAGAAGCCGAGTGCCGCTTCCTGGCG
AGCCTCCGAACCGTGGAAGAGGCGTCACTGCAGCGGGTGCAGCGCAGCGGGCTCCTCACGGGGCTAGGACGGAGG
GAGCTGTTCCGGATGGGGGGCTCGGCGGTTTCGGAGGGCCGGGTGAAGATTCGGGAGGGCTTCCGGGCGGTGACG
GAGGTGGCGGCGCGGCGCGGGTGGCGGACCGACGTCGTCTCGGGTTGGGGGAGTGGCGGCGAATGA
Gene >Ophun1|7549
ATGGCGGACTCGTTCGTCAAGCCGGAACCCGACGAGGAGAAACCGACGCTGCCGCTGGAAGACGAGGACCCGGAC
GAGGATGCTGGCGACCTCGAGTTTTACGACAAATCCAACAATCAGTTCGAGACGCTGTATCTCGCTCGCGTGCCC
CGTTACATGTGGGATGCCTGGCTGAAAATGACGGAACGGCTAGGCGACGACGATGAGATTCAGATCGGCACGCTT
CGCACCTGGAATCAGTCCGAGGTTGATGCCGAGGGCGTGGCGCACGATGTCACCAAGTTGCGCATGCTACTCGAG
GCCAACTGCCCCGAGCATCAGGCGCTGCCTCGCGAGTACGAGCTCGAGGTGCTGGATCGTGATGTGCAGAATCAT
TTCATCTTTAGTGAGGAGGATCTGCCGAGTTACAAGGCTCGCAACAAGGCTCGTGCCGAGGCGGCAAACTCTGGG
ATTCCCGCCTCCCTACTGCGGCAACGGGCGCAGGGTAACGGGCAGGACCATGGGCCGCAGCGGAACAGCTTCGAT
CGGAGGAACCGATTTCAACCGTACTTTCGCAAGGCCATACCGAGTGAGTGCCAACATCTTTTCTCTTCTCCTGCC
GTCTTCCCCTTCCATCATCCATACGAAGGCTAGGTGCTGACGGGTAGCTGTGCAGAAAAGACCAAGATGTTTGGG
AAGATTCACTACGACGTACGCGTCGAACCGCGTAACGTGCGGGACGAAGAGCGTGTGTTGGCGCGGAAGCTTCTG
GACGCCGAGCAGTCCAAGTCCAAGCTACAGATCATCAGCAGGAACAGCGCGTCGTCCATCATGAACCCGGGCACC
GCCGTCGCGGCTCAATGGGGAGGCAACTTTATCGTACGTGGCCCTCGCGTAGACGTGCGAACCGTGCTGACCCGC
TTGAACAGAAAAATGCAGCGCAGCAGGTCAAGCCCAAGAAGGGCGAGGTGTTCAAGGCGGCGCGGATTCCCAAGA
ACCAGCTGCTGGATCTCATCTTCGACTGCTTCCGGCACTACCAGTATTGGTCTATGAAGGCGCTGCGTCAGAAGC
TGCAGCAGCCCGACACGTACCTGCGACAGGTGCTGGAAGAGGTGGCTGTGCTGCACAAGAGCGGCCGCTTCGCCA
ACCACTACGGACTCAACGACGCCTACAAGGACAAGGCTGGCAGCGATGCCAAGGAAGAGGCGGCCACGGCGGCCG
AAGATGGGGGCGCGTTTGGCGATGACGACGATGACGATGACGAGGAGCTGGAAGACGTGCTGCCGGCGTGAGAGG
AATGGCTTCAGGGAAGAGAACGGGCTCGGGGCGTTTAGAGCATGATACCCTCGAGTGGTTTGTTTAGAAGCAAGC
GGATGAGATGTGGTTGGTCCACGAGTTTCTAGATGGTATATAACTGGTAGTCACGTGCACTGGGGCTTCCACTTC
TGAAGCCCAGACAGGATGGCACCGACGACGACTTTGCTAGCTCGTATCACGAAGAGATGTCCATGGCAGATGACC
AAGACGCTGCTCTCAAGATGCACCTCGTCTTCGACTTTGACGGCACCATCACGGTCCAAGACACCATGGGCGAGT
TTGCGGCATCGGCCGTGGCCTGGCAGCAGCAGCGTCTGGGCCGCAACCTGCAGGGCGAATGGGACGAGGCGGTAC
GAGCGTACGCAGCCGACCTGACAGCCGTTACGGGATGGGACTCTGCGACGACGATAGAAGCCGAGTGCCGCTTCC
TGGCGAGCCTCCGAACCGTGGAAGAGGCGTCACTGCAGCGGGTGCAGCGCAGCGGGCTCCTCACGGGGCTAGGAC
GGAGGGAGCTGTTCCGGATGGGGGGCTCGGCGGTTTCGGAGGGCCGGGTGAAGATTCGGGAGGGCTTCCGGGCGG
TGACGGAGGTGGCGGCGCGGCGCGGGTGGCGGACCGACGTCGTCTCGGTGCATTGGTCCGGGGCTTTTGTCGAGG
GGGTTTTGGAGGCGGCGGGGGTGAGGGTTGGGGGAGTGGCGGCGAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail