Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7543
Gene name
LocationContig_97:23842..25281
Strand+
Gene length (bp)1439
Transcript length (bp)1386
Coding sequence length (bp)1386
Protein length (aa) 462

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00498 FHA FHA domain 2.2E-12 366 445

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8BIZ6|SNIP1_MOUSE Smad nuclear-interacting protein 1 OS=Mus musculus GN=Snip1 PE=1 SV=1 167 455 1.0E-37
sp|Q5M9G6|SNIP1_RAT Smad nuclear interacting protein 1 OS=Rattus norvegicus GN=Snip1 PE=1 SV=1 167 460 2.0E-37
sp|Q8TAD8|SNIP1_HUMAN Smad nuclear-interacting protein 1 OS=Homo sapiens GN=SNIP1 PE=1 SV=1 202 455 3.0E-35
sp|Q8W4D8|DDL_ARATH FHA domain-containing protein DDL OS=Arabidopsis thaliana GN=DDL PE=1 SV=1 280 455 3.0E-31
sp|Q54VU4|Y8013_DICDI Probable serine/threonine-protein kinase DDB_G0280133 OS=Dictyostelium discoideum GN=DDB_G0280133 PE=3 SV=1 299 455 2.0E-23
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8BIZ6|SNIP1_MOUSE Smad nuclear-interacting protein 1 OS=Mus musculus GN=Snip1 PE=1 SV=1 167 455 1.0E-37
sp|Q5M9G6|SNIP1_RAT Smad nuclear interacting protein 1 OS=Rattus norvegicus GN=Snip1 PE=1 SV=1 167 460 2.0E-37
sp|Q8TAD8|SNIP1_HUMAN Smad nuclear-interacting protein 1 OS=Homo sapiens GN=SNIP1 PE=1 SV=1 202 455 3.0E-35
sp|Q8W4D8|DDL_ARATH FHA domain-containing protein DDL OS=Arabidopsis thaliana GN=DDL PE=1 SV=1 280 455 3.0E-31
sp|Q54VU4|Y8013_DICDI Probable serine/threonine-protein kinase DDB_G0280133 OS=Dictyostelium discoideum GN=DDB_G0280133 PE=3 SV=1 299 455 2.0E-23
sp|Q07930|PML1_YEAST Pre-mRNA leakage protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PML1 PE=1 SV=1 302 446 2.0E-13
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7543
MTTNTIADASGIAETDDARKAVADVTNRVMIIVRAVQLPIIDDKTLVTTGAREALHLIVDVTKTVAIVTTSVRIV
EDLFIDAKLLLTGVRTVERRATILVTALAARGLPMNDAETTIGPERETNARGMAAIAVSIVMSVTWKDAGDRPSD
EQRDERYDDDHEGRLWPRYMSSSSSEYYGDTEEDSYDDSYRRGRDWTDDDDRDDHQDDRSSEHSHDEDDNSSDDR
SYRRGGSTHRRDDEGGRRGRSRDERRVWNSDDEMTSESDNESRHRMEHRAPLASQQESFAIARGDAPSDATQPRE
RPNLASTGTLAAASNSVAHDDGSSTVLKYQEPAEARAPPAREQWRLFVFKDGEVTDEIALSIKSCWLVGRNSRVV
DVLAPNPTVSKQHAVIQFRLVEKRNRYGDTVGETKPYLVDLESGGGTFLNGKLVPKGRYIELRSQDLLMFASSKR
EYVIMLAPNDD*
Coding >Ophun1|7543
ATGACGACGAATACGATCGCGGACGCGAGCGGCATCGCGGAGACAGACGACGCACGGAAGGCCGTGGCCGACGTT
ACGAATCGCGTCATGATTATCGTTCGCGCAGTTCAGCTTCCTATTATCGACGACAAGACTCTTGTGACGACCGGC
GCTCGCGAAGCCCTGCATCTGATCGTCGACGTTACGAAAACCGTGGCCATCGTGACAACCAGCGTTCGCATAGTA
GAAGATCTTTTCATCGACGCGAAACTGTTGTTAACAGGCGTTCGCACAGTCGAGAGGCGCGCTACGATTCTCGTG
ACCGCTCTCGCAGCCCGCGGTCTTCCCATGAACGACGCCGAGACGACTATCGGGCCCGAGAGAGAGACGAACGCG
AGAGGCATGGCGGCCATCGCAGTCAGCATCGTCATGAGCGTGACTTGGAAAGACGCGGGAGACCGGCCCAGCGAC
GAACAGCGAGACGAAAGATATGACGACGACCATGAGGGAAGGCTGTGGCCTAGGTACATGAGCTCCTCATCCTCC
GAATATTATGGTGATACTGAGGAAGACTCCTATGATGACAGTTATCGCCGAGGAAGAGACTGGACCGACGACGAT
GATCGCGATGATCATCAGGATGATAGGTCCAGCGAACATAGCCACGACGAGGACGATAATTCCTCTGATGATCGA
AGCTACAGACGGGGTGGAAGCACACACAGACGCGATGACGAAGGTGGTCGACGTGGTCGCTCGCGAGACGAAAGG
CGAGTCTGGAACTCGGACGACGAGATGACTTCTGAGTCTGACAATGAGTCAAGACACCGAATGGAGCATCGTGCG
CCCCTTGCCTCGCAGCAAGAATCCTTCGCGATCGCGCGGGGAGACGCGCCCAGCGACGCGACCCAGCCTAGGGAG
AGGCCCAACTTGGCCAGCACGGGCACCCTGGCTGCCGCTTCCAACTCGGTCGCCCACGACGACGGCTCGTCCACA
GTCCTCAAGTACCAAGAGCCGGCCGAGGCGCGCGCGCCACCGGCACGCGAACAGTGGAGGCTCTTTGTCTTCAAA
GATGGTGAAGTCACGGACGAGATTGCGCTGAGCATCAAGAGCTGCTGGCTCGTCGGTCGAAACTCACGCGTCGTC
GACGTGCTGGCGCCGAACCCCACCGTTAGCAAGCAACATGCCGTCATCCAGTTTCGCCTTGTGGAGAAGCGCAAC
AGATATGGCGACACGGTTGGCGAGACGAAGCCCTATCTTGTCGACTTGGAGAGCGGAGGCGGTACCTTTCTCAAT
GGCAAGCTTGTGCCAAAGGGCCGATACATCGAGCTCCGATCCCAAGACTTGCTCATGTTTGCAAGCAGCAAGCGG
GAATACGTGATCATGCTGGCCCCCAATGATGATTGA
Transcript >Ophun1|7543
ATGACGACGAATACGATCGCGGACGCGAGCGGCATCGCGGAGACAGACGACGCACGGAAGGCCGTGGCCGACGTT
ACGAATCGCGTCATGATTATCGTTCGCGCAGTTCAGCTTCCTATTATCGACGACAAGACTCTTGTGACGACCGGC
GCTCGCGAAGCCCTGCATCTGATCGTCGACGTTACGAAAACCGTGGCCATCGTGACAACCAGCGTTCGCATAGTA
GAAGATCTTTTCATCGACGCGAAACTGTTGTTAACAGGCGTTCGCACAGTCGAGAGGCGCGCTACGATTCTCGTG
ACCGCTCTCGCAGCCCGCGGTCTTCCCATGAACGACGCCGAGACGACTATCGGGCCCGAGAGAGAGACGAACGCG
AGAGGCATGGCGGCCATCGCAGTCAGCATCGTCATGAGCGTGACTTGGAAAGACGCGGGAGACCGGCCCAGCGAC
GAACAGCGAGACGAAAGATATGACGACGACCATGAGGGAAGGCTGTGGCCTAGGTACATGAGCTCCTCATCCTCC
GAATATTATGGTGATACTGAGGAAGACTCCTATGATGACAGTTATCGCCGAGGAAGAGACTGGACCGACGACGAT
GATCGCGATGATCATCAGGATGATAGGTCCAGCGAACATAGCCACGACGAGGACGATAATTCCTCTGATGATCGA
AGCTACAGACGGGGTGGAAGCACACACAGACGCGATGACGAAGGTGGTCGACGTGGTCGCTCGCGAGACGAAAGG
CGAGTCTGGAACTCGGACGACGAGATGACTTCTGAGTCTGACAATGAGTCAAGACACCGAATGGAGCATCGTGCG
CCCCTTGCCTCGCAGCAAGAATCCTTCGCGATCGCGCGGGGAGACGCGCCCAGCGACGCGACCCAGCCTAGGGAG
AGGCCCAACTTGGCCAGCACGGGCACCCTGGCTGCCGCTTCCAACTCGGTCGCCCACGACGACGGCTCGTCCACA
GTCCTCAAGTACCAAGAGCCGGCCGAGGCGCGCGCGCCACCGGCACGCGAACAGTGGAGGCTCTTTGTCTTCAAA
GATGGTGAAGTCACGGACGAGATTGCGCTGAGCATCAAGAGCTGCTGGCTCGTCGGTCGAAACTCACGCGTCGTC
GACGTGCTGGCGCCGAACCCCACCGTTAGCAAGCAACATGCCGTCATCCAGTTTCGCCTTGTGGAGAAGCGCAAC
AGATATGGCGACACGGTTGGCGAGACGAAGCCCTATCTTGTCGACTTGGAGAGCGGAGGCGGTACCTTTCTCAAT
GGCAAGCTTGTGCCAAAGGGCCGATACATCGAGCTCCGATCCCAAGACTTGCTCATGTTTGCAAGCAGCAAGCGG
GAATACGTGATCATGCTGGCCCCCAATGATGATTGA
Gene >Ophun1|7543
ATGACGACGAATACGATCGCGGACGCGAGCGGCATCGCGGAGACAGACGACGCACGGAAGGCCGTGGCCGACGTT
ACGAATCGCGTCATGATTATCGTTCGCGCAGTTCAGCTTCCTATTATCGACGACAAGACTCTTGTGACGACCGGC
GCTCGCGAAGCCCTGCATCTGATCGTCGACGTTACGAAAACCGTGGCCATCGTGACAACCAGCGTTCGCATAGTA
GAAGATCTTTTCATCGACGCGAAACTGTTGTTAACAGGCGTTCGCACAGTCGAGAGGCGCGCTACGATTCTCGTG
ACCGCTCTCGCAGCCCGCGGTCTTCCCATGAACGACGCCGAGACGACTATCGGGCCCGAGAGAGAGACGAACGCG
AGAGGCATGGCGGCCATCGCAGTCAGCATCGTCATGAGCGTGACTTGGAAAGACGCGGGAGGTACGACGATGATC
ACTACTACCGTCGTACTATTGAAGTTAACGGCAGACGAGACCGGCCCAGCGACGAACAGCGAGACGAAAGATATG
ACGACGACCATGAGGGAAGGCTGTGGCCTAGGTACATGAGCTCCTCATCCTCCGAATATTATGGTGATACTGAGG
AAGACTCCTATGATGACAGTTATCGCCGAGGAAGAGACTGGACCGACGACGATGATCGCGATGATCATCAGGATG
ATAGGTCCAGCGAACATAGCCACGACGAGGACGATAATTCCTCTGATGATCGAAGCTACAGACGGGGTGGAAGCA
CACACAGACGCGATGACGAAGGTGGTCGACGTGGTCGCTCGCGAGACGAAAGGCGAGTCTGGAACTCGGACGACG
AGATGACTTCTGAGTCTGACAATGAGTCAAGACACCGAATGGAGCATCGTGCGCCCCTTGCCTCGCAGCAAGAAT
CCTTCGCGATCGCGCGGGGAGACGCGCCCAGCGACGCGACCCAGCCTAGGGAGAGGCCCAACTTGGCCAGCACGG
GCACCCTGGCTGCCGCTTCCAACTCGGTCGCCCACGACGACGGCTCGTCCACAGTCCTCAAGTACCAAGAGCCGG
CCGAGGCGCGCGCGCCACCGGCACGCGAACAGTGGAGGCTCTTTGTCTTCAAAGATGGTGAAGTCACGGACGAGA
TTGCGCTGAGCATCAAGAGCTGCTGGCTCGTCGGTCGAAACTCACGCGTCGTCGACGTGCTGGCGCCGAACCCCA
CCGTTAGCAAGCAACATGCCGTCATCCAGTTTCGCCTTGTGGAGAAGCGCAACAGATATGGCGACACGGTTGGCG
AGACGAAGCCCTATCTTGTCGACTTGGAGAGCGGAGGCGGTACCTTTCTCAATGGCAAGCTTGTGCCAAAGGGCC
GATACATCGAGCTCCGATCCCAAGACTTGCTCATGTTTGCAAGCAGCAAGCGGGAATACGTGATCATGCTGGCCC
CCAATGATGATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail