Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7533
Gene name
LocationContig_969:1100..4280
Strand-
Gene length (bp)3180
Transcript length (bp)3180
Coding sequence length (bp)3180
Protein length (aa) 1060

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 2.8E-09 597 664
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 7.6E-10 674 737
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 4.7E-16 766 832
PF16842 RRM_occluded Occluded RNA-recognition motif 1.1E-27 878 954
PF13893 RRM_5 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 9.1E-06 759 845

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USY2|YOW4_SCHPO Uncharacterized RNA-binding protein C1861.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1861.04c PE=3 SV=1 2 1040 2.0E-77
sp|P49960|PRP24_YEAST U4/U6 snRNA-associated-splicing factor PRP24 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP24 PE=1 SV=1 565 954 1.0E-35
sp|O22173|PABP4_ARATH Polyadenylate-binding protein 4 OS=Arabidopsis thaliana GN=PAB4 PE=1 SV=1 595 944 3.0E-16
sp|A2Q848|PABP_ASPNC Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pab1 PE=3 SV=1 574 906 2.0E-15
sp|Q2UK72|PABP_ASPOR Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pab1 PE=3 SV=1 673 906 4.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USY2|YOW4_SCHPO Uncharacterized RNA-binding protein C1861.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1861.04c PE=3 SV=1 2 1040 2.0E-77
sp|P49960|PRP24_YEAST U4/U6 snRNA-associated-splicing factor PRP24 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP24 PE=1 SV=1 565 954 1.0E-35
sp|O22173|PABP4_ARATH Polyadenylate-binding protein 4 OS=Arabidopsis thaliana GN=PAB4 PE=1 SV=1 595 944 3.0E-16
sp|A2Q848|PABP_ASPNC Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pab1 PE=3 SV=1 574 906 2.0E-15
sp|Q2UK72|PABP_ASPOR Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pab1 PE=3 SV=1 673 906 4.0E-15
sp|Q4WK03|PABP_ASPFU Polyadenylate-binding protein, cytoplasmic and nuclear OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pab1 PE=3 SV=1 572 906 5.0E-15
sp|Q15020|SART3_HUMAN Squamous cell carcinoma antigen recognized by T-cells 3 OS=Homo sapiens GN=SART3 PE=1 SV=1 668 838 6.0E-15
sp|Q9JLI8|SART3_MOUSE Squamous cell carcinoma antigen recognized by T-cells 3 OS=Mus musculus GN=Sart3 PE=1 SV=1 668 856 8.0E-15
sp|Q13310|PABP4_HUMAN Polyadenylate-binding protein 4 OS=Homo sapiens GN=PABPC4 PE=1 SV=1 595 936 9.0E-15
sp|A1D4K4|PABP_NEOFI Polyadenylate-binding protein, cytoplasmic and nuclear OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=pab1 PE=3 SV=1 673 906 2.0E-14
sp|Q0CR95|PABP_ASPTN Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=pab1 PE=3 SV=1 673 906 2.0E-14
sp|A1CRM1|PABP_ASPCL Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=pab1 PE=3 SV=1 554 906 2.0E-14
sp|Q5B630|PABP_EMENI Polyadenylate-binding protein, cytoplasmic and nuclear OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pab1 PE=2 SV=2 673 906 2.0E-14
sp|Q9FXA2|PABP8_ARATH Polyadenylate-binding protein 8 OS=Arabidopsis thaliana GN=PAB8 PE=1 SV=1 595 869 1.0E-13
sp|A5DW14|PABP_LODEL Polyadenylate-binding protein, cytoplasmic and nuclear OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=PAB1 PE=3 SV=1 661 835 2.0E-13
sp|A5DW14|PABP_LODEL Polyadenylate-binding protein, cytoplasmic and nuclear OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=PAB1 PE=3 SV=1 594 846 4.0E-13
sp|Q9EPH8|PABP1_RAT Polyadenylate-binding protein 1 OS=Rattus norvegicus GN=Pabpc1 PE=1 SV=1 596 849 4.0E-13
sp|P29341|PABP1_MOUSE Polyadenylate-binding protein 1 OS=Mus musculus GN=Pabpc1 PE=1 SV=2 596 849 4.0E-13
sp|Q4VXU2|PAP1L_HUMAN Polyadenylate-binding protein 1-like OS=Homo sapiens GN=PABPC1L PE=2 SV=1 595 849 5.0E-13
sp|Q2GSX8|PABP_CHAGB Polyadenylate-binding protein, cytoplasmic and nuclear OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAB1 PE=3 SV=1 569 938 5.0E-13
sp|Q5REG1|SART3_PONAB Squamous cell carcinoma antigen recognized by T-cells 3 OS=Pongo abelii GN=SART3 PE=2 SV=1 668 838 6.0E-13
sp|Q5R8F7|PABP1_PONAB Polyadenylate-binding protein 1 OS=Pongo abelii GN=PABPC1 PE=2 SV=1 596 849 7.0E-13
sp|P11940|PABP1_HUMAN Polyadenylate-binding protein 1 OS=Homo sapiens GN=PABPC1 PE=1 SV=2 596 849 7.0E-13
sp|P61286|PABP1_BOVIN Polyadenylate-binding protein 1 OS=Bos taurus GN=PABPC1 PE=2 SV=1 596 849 7.0E-13
sp|P0CB38|PAB4L_HUMAN Polyadenylate-binding protein 4-like OS=Homo sapiens GN=PABPC4L PE=2 SV=1 595 839 7.0E-13
sp|Q13310|PABP4_HUMAN Polyadenylate-binding protein 4 OS=Homo sapiens GN=PABPC4 PE=1 SV=1 595 849 9.0E-13
sp|Q05196|PABP5_ARATH Polyadenylate-binding protein 5 OS=Arabidopsis thaliana GN=PAB5 PE=1 SV=3 595 846 9.0E-13
sp|Q6DEY7|EPAB_XENTR Embryonic polyadenylate-binding protein OS=Xenopus tropicalis GN=epabp PE=2 SV=1 595 849 3.0E-12
sp|O64380|PABP3_ARATH Polyadenylate-binding protein 3 OS=Arabidopsis thaliana GN=PAB3 PE=2 SV=1 595 845 3.0E-12
sp|B3DJT0|SART3_DANRE Squamous cell carcinoma antigen recognized by T-cells 3 OS=Danio rerio GN=sart3 PE=2 SV=1 674 838 3.0E-12
sp|Q05196|PABP5_ARATH Polyadenylate-binding protein 5 OS=Arabidopsis thaliana GN=PAB5 PE=1 SV=3 594 905 4.0E-12
sp|F4HT49|PABP1_ARATH Polyadenylate-binding protein 1 OS=Arabidopsis thaliana GN=PAB1 PE=2 SV=2 673 859 4.0E-12
sp|P31209|PABP_SCHPO Polyadenylate-binding protein, cytoplasmic and nuclear OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pab1 PE=1 SV=2 590 853 4.0E-12
sp|Q9ZQA8|PABP7_ARATH Polyadenylate-binding protein 7 OS=Arabidopsis thaliana GN=PAB7 PE=2 SV=1 596 840 5.0E-12
sp|Q9EPH8|PABP1_RAT Polyadenylate-binding protein 1 OS=Rattus norvegicus GN=Pabpc1 PE=1 SV=1 595 936 7.0E-12
sp|Q5AI15|PABP_CANAL Polyadenylate-binding protein, cytoplasmic and nuclear OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PAB1 PE=3 SV=1 673 870 7.0E-12
sp|Q7S6N6|PABP_NEUCR Polyadenylate-binding protein, cytoplasmic and nuclear OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pabp-1 PE=3 SV=1 673 906 7.0E-12
sp|P29341|PABP1_MOUSE Polyadenylate-binding protein 1 OS=Mus musculus GN=Pabpc1 PE=1 SV=2 595 936 8.0E-12
sp|O64380|PABP3_ARATH Polyadenylate-binding protein 3 OS=Arabidopsis thaliana GN=PAB3 PE=2 SV=1 580 835 8.0E-12
sp|P21187|PABP_DROME Polyadenylate-binding protein OS=Drosophila melanogaster GN=pAbp PE=1 SV=3 595 847 9.0E-12
sp|Q6IP09|PABPB_XENLA Polyadenylate-binding protein 1-B OS=Xenopus laevis GN=pabpc1-b PE=2 SV=1 596 849 9.0E-12
sp|P11940|PABP1_HUMAN Polyadenylate-binding protein 1 OS=Homo sapiens GN=PABPC1 PE=1 SV=2 595 936 1.0E-11
sp|P61286|PABP1_BOVIN Polyadenylate-binding protein 1 OS=Bos taurus GN=PABPC1 PE=2 SV=1 595 936 1.0E-11
sp|P0CB38|PAB4L_HUMAN Polyadenylate-binding protein 4-like OS=Homo sapiens GN=PABPC4L PE=2 SV=1 673 936 1.0E-11
sp|Q98SP8|EPABA_XENLA Embryonic polyadenylate-binding protein A OS=Xenopus laevis GN=epabp-a PE=1 SV=2 595 963 1.0E-11
sp|Q98SP8|EPABA_XENLA Embryonic polyadenylate-binding protein A OS=Xenopus laevis GN=epabp-a PE=1 SV=2 595 849 2.0E-11
sp|P20965|PABPA_XENLA Polyadenylate-binding protein 1-A OS=Xenopus laevis GN=pabpc1-a PE=1 SV=3 596 849 2.0E-11
sp|A5DM21|PABP_PICGU Polyadenylate-binding protein, cytoplasmic and nuclear OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PAB1 PE=3 SV=2 673 846 3.0E-11
sp|A4QUF0|PABP_MAGO7 Polyadenylate-binding protein, cytoplasmic and nuclear OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAB1 PE=3 SV=1 570 906 3.0E-11
sp|Q6GR16|EPABB_XENLA Embryonic polyadenylate-binding protein B OS=Xenopus laevis GN=epabp-b PE=2 SV=1 595 849 4.0E-11
sp|Q74ZS6|PABP_ASHGO Polyadenylate-binding protein, cytoplasmic and nuclear OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PAB1 PE=3 SV=1 673 947 5.0E-11
sp|A3LXL0|PABP_PICST Polyadenylate-binding protein, cytoplasmic and nuclear OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PAB1 PE=3 SV=1 595 1029 5.0E-11
sp|Q5R8F7|PABP1_PONAB Polyadenylate-binding protein 1 OS=Pongo abelii GN=PABPC1 PE=2 SV=1 595 936 6.0E-11
sp|Q6DEY7|EPAB_XENTR Embryonic polyadenylate-binding protein OS=Xenopus tropicalis GN=epabp PE=2 SV=1 595 963 6.0E-11
sp|P20397|NUCL_XENLA Nucleolin OS=Xenopus laevis GN=ncl PE=2 SV=3 640 838 6.0E-11
sp|Q6IP09|PABPB_XENLA Polyadenylate-binding protein 1-B OS=Xenopus laevis GN=pabpc1-b PE=2 SV=1 595 980 1.0E-10
sp|Q6GR16|EPABB_XENLA Embryonic polyadenylate-binding protein B OS=Xenopus laevis GN=epabp-b PE=2 SV=1 586 963 1.0E-10
sp|Q9H361|PABP3_HUMAN Polyadenylate-binding protein 3 OS=Homo sapiens GN=PABPC3 PE=1 SV=2 595 984 1.0E-10
sp|O22173|PABP4_ARATH Polyadenylate-binding protein 4 OS=Arabidopsis thaliana GN=PAB4 PE=1 SV=1 595 854 2.0E-10
sp|Q6CSV3|PABP_KLULA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PAB1 PE=3 SV=1 673 835 2.0E-10
sp|Q9JLI8|SART3_MOUSE Squamous cell carcinoma antigen recognized by T-cells 3 OS=Mus musculus GN=Sart3 PE=1 SV=1 4 753 3.0E-10
sp|P20965|PABPA_XENLA Polyadenylate-binding protein 1-A OS=Xenopus laevis GN=pabpc1-a PE=1 SV=3 595 980 3.0E-10
sp|Q0U1G2|PABP_PHANO Polyadenylate-binding protein, cytoplasmic and nuclear OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PAB1 PE=3 SV=3 554 906 3.0E-10
sp|Q54BM2|PAP1A_DICDI Polyadenylate-binding protein 1-A OS=Dictyostelium discoideum GN=pabpc1A PE=1 SV=1 595 846 3.0E-10
sp|Q4P8R9|PABP_USTMA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAB1 PE=3 SV=1 588 852 3.0E-10
sp|Q74ZS6|PABP_ASHGO Polyadenylate-binding protein, cytoplasmic and nuclear OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PAB1 PE=3 SV=1 590 844 4.0E-10
sp|Q4VXU2|PAP1L_HUMAN Polyadenylate-binding protein 1-like OS=Homo sapiens GN=PABPC1L PE=2 SV=1 595 936 5.0E-10
sp|P21187|PABP_DROME Polyadenylate-binding protein OS=Drosophila melanogaster GN=pAbp PE=1 SV=3 595 936 6.0E-10
sp|Q1DXH0|PABP_COCIM Polyadenylate-binding protein, cytoplasmic and nuclear OS=Coccidioides immitis (strain RS) GN=PAB1 PE=3 SV=1 673 906 6.0E-10
sp|Q4P8R9|PABP_USTMA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAB1 PE=3 SV=1 673 944 7.0E-10
sp|Q01085|TIAR_HUMAN Nucleolysin TIAR OS=Homo sapiens GN=TIAL1 PE=1 SV=1 669 945 7.0E-10
sp|Q6BI95|PABP_DEBHA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PAB1 PE=3 SV=2 572 1029 8.0E-10
sp|Q5AI15|PABP_CANAL Polyadenylate-binding protein, cytoplasmic and nuclear OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PAB1 PE=3 SV=1 595 1024 1.0E-09
sp|P0CP46|PABP_CRYNJ Polyadenylate-binding protein, cytoplasmic and nuclear OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAB1 PE=3 SV=1 588 861 3.0E-09
sp|P0CP47|PABP_CRYNB Polyadenylate-binding protein, cytoplasmic and nuclear OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAB1 PE=3 SV=1 588 861 3.0E-09
sp|Q6CDH3|PABP_YARLI Polyadenylate-binding protein, cytoplasmic and nuclear OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PAB1 PE=3 SV=1 595 870 4.0E-09
sp|A5DM21|PABP_PICGU Polyadenylate-binding protein, cytoplasmic and nuclear OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PAB1 PE=3 SV=2 661 835 6.0E-09
sp|Q10422|YDC1_SCHPO Uncharacterized RNA-binding protein C25G10.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC25G10.01 PE=1 SV=1 731 842 8.0E-09
sp|P31483|TIA1_HUMAN Nucleolysin TIA-1 isoform p40 OS=Homo sapiens GN=TIA1 PE=1 SV=3 673 945 9.0E-09
sp|Q15020|SART3_HUMAN Squamous cell carcinoma antigen recognized by T-cells 3 OS=Homo sapiens GN=SART3 PE=1 SV=1 2 752 1.0E-08
sp|P70318|TIAR_MOUSE Nucleolysin TIAR OS=Mus musculus GN=Tial1 PE=1 SV=1 669 945 1.0E-08
sp|P52912|TIA1_MOUSE Nucleolysin TIA-1 OS=Mus musculus GN=Tia1 PE=1 SV=1 673 945 2.0E-08
sp|O04319|PABP6_ARATH Polyadenylate-binding protein 6 OS=Arabidopsis thaliana GN=PAB6 PE=2 SV=1 633 997 2.0E-08
sp|P04147|PABP_YEAST Polyadenylate-binding protein, cytoplasmic and nuclear OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAB1 PE=1 SV=4 662 846 2.0E-08
sp|Q0WW84|RB47B_ARATH Polyadenylate-binding protein RBP47B OS=Arabidopsis thaliana GN=RBP47B PE=2 SV=1 668 936 2.0E-08
sp|Q6CDH3|PABP_YARLI Polyadenylate-binding protein, cytoplasmic and nuclear OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PAB1 PE=3 SV=1 567 906 3.0E-08
sp|A8WLV5|EIF3G_CAEBR Eukaryotic translation initiation factor 3 subunit G OS=Caenorhabditis briggsae GN=eif-3.G.1 PE=3 SV=2 753 841 3.0E-08
sp|P42731|PABP2_ARATH Polyadenylate-binding protein 2 OS=Arabidopsis thaliana GN=PAB2 PE=1 SV=1 595 856 3.0E-08
sp|Q5REG1|SART3_PONAB Squamous cell carcinoma antigen recognized by T-cells 3 OS=Pongo abelii GN=SART3 PE=2 SV=1 2 752 7.0E-08
sp|Q1PEP5|NUCL2_ARATH Nucleolin 2 OS=Arabidopsis thaliana GN=NUCL2 PE=2 SV=1 688 810 9.0E-08
sp|Q8C5L7|RBM34_MOUSE RNA-binding protein 34 OS=Mus musculus GN=Rbm34 PE=1 SV=1 670 835 1.0E-07
sp|O97018|SXL_CHRRU Sex-lethal homolog OS=Chrysomya rufifacies GN=SXL PE=2 SV=2 669 840 1.0E-07
sp|Q54WM4|EIF3G_DICDI Eukaryotic translation initiation factor 3 subunit G OS=Dictyostelium discoideum GN=eif3G PE=3 SV=1 745 843 2.0E-07
sp|P60050|PABP5_PONPY Polyadenylate-binding protein 5 OS=Pongo pygmaeus GN=PABPC5 PE=3 SV=1 595 839 2.0E-07
sp|P60049|PABP5_PANTR Polyadenylate-binding protein 5 OS=Pan troglodytes GN=PABPC5 PE=3 SV=1 595 839 2.0E-07
sp|Q7JGR2|PABP5_MACMU Polyadenylate-binding protein 5 OS=Macaca mulatta GN=PABPC5 PE=3 SV=1 595 839 2.0E-07
sp|P60048|PABP5_HYLLA Polyadenylate-binding protein 5 OS=Hylobates lar GN=PABPC5 PE=3 SV=1 595 839 2.0E-07
sp|Q96DU9|PABP5_HUMAN Polyadenylate-binding protein 5 OS=Homo sapiens GN=PABPC5 PE=2 SV=1 595 839 2.0E-07
sp|P60047|PABP5_GORGO Polyadenylate-binding protein 5 OS=Gorilla gorilla gorilla GN=PABPC5 PE=3 SV=1 595 839 2.0E-07
sp|Q5M9F1|RBM34_RAT RNA-binding protein 34 OS=Rattus norvegicus GN=Rbm34 PE=1 SV=1 670 861 2.0E-07
sp|Q9ZR39|U2A2A_NICPL Splicing factor U2af large subunit A OS=Nicotiana plumbaginifolia GN=U2AF65A PE=2 SV=1 670 944 2.0E-07
sp|Q9SX80|R47CP_ARATH Polyadenylate-binding protein RBP47C' OS=Arabidopsis thaliana GN=RBP47C' PE=2 SV=1 668 835 2.0E-07
sp|Q9SX79|RB47C_ARATH Polyadenylate-binding protein RBP47C OS=Arabidopsis thaliana GN=RBP47C PE=2 SV=1 667 835 4.0E-07
sp|Q15415|RBY1F_HUMAN RNA-binding motif protein, Y chromosome, family 1 member F/J OS=Homo sapiens GN=RBMY1F PE=1 SV=2 764 848 4.0E-07
sp|Q19706|EIF3G_CAEEL Eukaryotic translation initiation factor 3 subunit G OS=Caenorhabditis elegans GN=eif-3.G PE=3 SV=2 767 841 4.0E-07
sp|B3DJT0|SART3_DANRE Squamous cell carcinoma antigen recognized by T-cells 3 OS=Danio rerio GN=sart3 PE=2 SV=1 4 432 5.0E-07
sp|P15771|NUCL_CHICK Nucleolin OS=Gallus gallus GN=NCL PE=1 SV=1 589 839 5.0E-07
sp|P15771|NUCL_CHICK Nucleolin OS=Gallus gallus GN=NCL PE=1 SV=1 673 841 5.0E-07
sp|Q9LEB3|RBP47_NICPL Polyadenylate-binding protein RBP47 OS=Nicotiana plumbaginifolia GN=RBP47 PE=1 SV=1 593 835 5.0E-07
sp|O60506|HNRPQ_HUMAN Heterogeneous nuclear ribonucleoprotein Q OS=Homo sapiens GN=SYNCRIP PE=1 SV=2 558 850 5.0E-07
sp|Q09442|SF3B4_CAEEL Splicing factor 3B subunit 4 OS=Caenorhabditis elegans GN=sap-49 PE=1 SV=2 666 835 5.0E-07
sp|Q9FXA2|PABP8_ARATH Polyadenylate-binding protein 8 OS=Arabidopsis thaliana GN=PAB8 PE=1 SV=1 673 940 6.0E-07
sp|O17310|SXL_MUSDO Sex-lethal homolog OS=Musca domestica GN=SXL PE=2 SV=1 667 840 6.0E-07
sp|P60050|PABP5_PONPY Polyadenylate-binding protein 5 OS=Pongo pygmaeus GN=PABPC5 PE=3 SV=1 599 936 7.0E-07
sp|P60049|PABP5_PANTR Polyadenylate-binding protein 5 OS=Pan troglodytes GN=PABPC5 PE=3 SV=1 599 936 7.0E-07
sp|Q7JGR2|PABP5_MACMU Polyadenylate-binding protein 5 OS=Macaca mulatta GN=PABPC5 PE=3 SV=1 599 936 7.0E-07
sp|P60048|PABP5_HYLLA Polyadenylate-binding protein 5 OS=Hylobates lar GN=PABPC5 PE=3 SV=1 599 936 7.0E-07
sp|Q96DU9|PABP5_HUMAN Polyadenylate-binding protein 5 OS=Homo sapiens GN=PABPC5 PE=2 SV=1 599 936 7.0E-07
sp|P60047|PABP5_GORGO Polyadenylate-binding protein 5 OS=Gorilla gorilla gorilla GN=PABPC5 PE=3 SV=1 599 936 7.0E-07
sp|Q7TMK9|HNRPQ_MOUSE Heterogeneous nuclear ribonucleoprotein Q OS=Mus musculus GN=Syncrip PE=1 SV=2 558 850 7.0E-07
sp|P32588|PUB1_YEAST Nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PUB1 PE=1 SV=4 758 852 9.0E-07
sp|Q7TP47|HNRPQ_RAT Heterogeneous nuclear ribonucleoprotein Q OS=Rattus norvegicus GN=Syncrip PE=2 SV=1 597 850 1.0E-06
sp|P52299|NCBP2_XENLA Nuclear cap-binding protein subunit 2 OS=Xenopus laevis GN=ncbp2 PE=2 SV=2 743 836 1.0E-06
sp|P42696|RBM34_HUMAN RNA-binding protein 34 OS=Homo sapiens GN=RBM34 PE=1 SV=2 535 721 1.0E-06
sp|A4QNI8|ELAV4_XENTR ELAV-like protein 4 OS=Xenopus tropicalis GN=elavl4 PE=2 SV=1 594 837 2.0E-06
sp|Q7SZT7|ELAV4_XENLA ELAV-like protein 4 OS=Xenopus laevis GN=elavl4 PE=2 SV=1 594 837 2.0E-06
sp|Q6FKG4|PABP_CANGA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PAB1 PE=3 SV=1 590 846 2.0E-06
sp|Q6DGV1|CELF4_DANRE CUGBP Elav-like family member 4 OS=Danio rerio GN=celf4 PE=2 SV=1 670 827 2.0E-06
sp|C0H859|NCBP2_SALSA Nuclear cap-binding protein subunit 2 OS=Salmo salar GN=ncbp2 PE=2 SV=1 743 836 2.0E-06
sp|A6NDE4|RBY1B_HUMAN RNA-binding motif protein, Y chromosome, family 1 member B OS=Homo sapiens GN=RBMY1B PE=2 SV=2 764 848 2.0E-06
sp|P49314|ROC2_NICPL 31 kDa ribonucleoprotein, chloroplastic OS=Nicotiana plumbaginifolia PE=2 SV=1 760 946 2.0E-06
sp|A6NEQ0|RBY1E_HUMAN RNA-binding motif protein, Y chromosome, family 1 member E OS=Homo sapiens GN=RBMY1E PE=2 SV=1 764 848 2.0E-06
sp|P0DJD3|RBY1A_HUMAN RNA-binding motif protein, Y chromosome, family 1 member A1 OS=Homo sapiens GN=RBMY1A1 PE=1 SV=1 764 848 2.0E-06
sp|P0C7P1|RBY1D_HUMAN RNA-binding motif protein, Y chromosome, family 1 member D OS=Homo sapiens GN=RBMY1D PE=2 SV=1 764 848 2.0E-06
sp|Q22037|ROA1_CAEEL Heterogeneous nuclear ribonucleoprotein A1 OS=Caenorhabditis elegans GN=hrp-1 PE=1 SV=1 674 820 2.0E-06
sp|Q5R5P4|RBM47_PONAB RNA-binding protein 47 OS=Pongo abelii GN=RBM47 PE=2 SV=2 762 829 3.0E-06
sp|A0AV96|RBM47_HUMAN RNA-binding protein 47 OS=Homo sapiens GN=RBM47 PE=1 SV=2 762 829 3.0E-06
sp|C1BY64|NCBP2_ESOLU Nuclear cap-binding protein subunit 2 OS=Esox lucius GN=ncbp2 PE=2 SV=1 743 836 3.0E-06
sp|A3GGU2|EIF3G_PICST Eukaryotic translation initiation factor 3 subunit G OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=TIF35 PE=3 SV=2 761 843 3.0E-06
sp|Q6C747|EIF3G_YARLI Eukaryotic translation initiation factor 3 subunit G OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TIF35 PE=3 SV=1 765 840 3.0E-06
sp|Q91WT8|RBM47_MOUSE RNA-binding protein 47 OS=Mus musculus GN=Rbm47 PE=1 SV=1 762 829 3.0E-06
sp|Q66H68|RBM47_RAT RNA-binding protein 47 OS=Rattus norvegicus GN=Rbm47 PE=2 SV=1 762 829 3.0E-06
sp|F4HT49|PABP1_ARATH Polyadenylate-binding protein 1 OS=Arabidopsis thaliana GN=PAB1 PE=2 SV=2 593 936 4.0E-06
sp|P31209|PABP_SCHPO Polyadenylate-binding protein, cytoplasmic and nuclear OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pab1 PE=1 SV=2 673 947 4.0E-06
sp|Q08937|ROC2_NICSY 29 kDa ribonucleoprotein B, chloroplastic OS=Nicotiana sylvestris PE=2 SV=1 760 946 4.0E-06
sp|A2SW84|NCBP2_SINCH Nuclear cap-binding protein subunit 2 OS=Siniperca chuatsi GN=ncbp2 PE=2 SV=1 743 836 4.0E-06
sp|Q5M9F1|RBM34_RAT RNA-binding protein 34 OS=Rattus norvegicus GN=Rbm34 PE=1 SV=1 582 754 5.0E-06
sp|A5E1Z4|EIF3G_LODEL Eukaryotic translation initiation factor 3 subunit G OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=TIF35 PE=3 SV=1 726 842 5.0E-06
sp|Q59ZV5|EIF3G_CANAL Eukaryotic translation initiation factor 3 subunit G OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TIF35 PE=3 SV=1 765 843 5.0E-06
sp|P04147|PABP_YEAST Polyadenylate-binding protein, cytoplasmic and nuclear OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAB1 PE=1 SV=4 673 835 6.0E-06
sp|Q9V3G3|PPIE_DROME Peptidyl-prolyl cis-trans isomerase E OS=Drosophila melanogaster GN=cyp33 PE=1 SV=1 763 844 6.0E-06
sp|Q08473|SQD_DROME RNA-binding protein squid OS=Drosophila melanogaster GN=sqd PE=1 SV=3 647 814 6.0E-06
sp|P0DJD4|RBY1C_HUMAN RNA-binding motif protein, Y chromosome, family 1 member C OS=Homo sapiens GN=RBMY1C PE=1 SV=1 764 848 6.0E-06
sp|Q54BM2|PAP1A_DICDI Polyadenylate-binding protein 1-A OS=Dictyostelium discoideum GN=pabpc1A PE=1 SV=1 673 842 7.0E-06
sp|O09032|ELAV4_RAT ELAV-like protein 4 OS=Rattus norvegicus GN=Elavl4 PE=1 SV=1 688 827 7.0E-06
sp|Q93594|NCBP2_CAEEL Nuclear cap-binding protein subunit 2 OS=Caenorhabditis elegans GN=ncbp-2 PE=3 SV=2 753 868 7.0E-06
sp|P19338|NUCL_HUMAN Nucleolin OS=Homo sapiens GN=NCL PE=1 SV=3 640 837 7.0E-06
sp|Q5RF26|NUCL_PONAB Nucleolin OS=Pongo abelii GN=NCL PE=2 SV=3 640 837 7.0E-06
sp|Q9WX37|RBPE_NOSS1 Putative RNA-binding protein RbpE OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rbpE PE=3 SV=3 765 846 8.0E-06
sp|Q6GL69|MK67I_XENTR MKI67 FHA domain-interacting nucleolar phosphoprotein-like OS=Xenopus tropicalis GN=nifk PE=2 SV=1 751 843 8.0E-06
sp|Q4R4J7|NUCL_MACFA Nucleolin OS=Macaca fascicularis GN=NCL PE=2 SV=3 640 837 8.0E-06
sp|A4FV72|PPIE_BOVIN Peptidyl-prolyl cis-trans isomerase E OS=Bos taurus GN=PPIE PE=2 SV=1 763 847 8.0E-06
sp|Q91903|ELAV2_XENLA ELAV-like protein 2 OS=Xenopus laevis GN=elavl2 PE=1 SV=2 673 827 9.0E-06
sp|Q5R723|PPIE_PONAB Peptidyl-prolyl cis-trans isomerase E OS=Pongo abelii GN=PPIE PE=2 SV=1 763 847 9.0E-06
sp|Q9UNP9|PPIE_HUMAN Peptidyl-prolyl cis-trans isomerase E OS=Homo sapiens GN=PPIE PE=1 SV=1 763 847 9.0E-06
sp|Q2HJG2|PUF60_BOVIN Poly(U)-binding-splicing factor PUF60 OS=Bos taurus GN=PUF60 PE=2 SV=1 746 947 9.0E-06
sp|Q6Z1C0|NUCL1_ORYSJ Nucleolin 1 OS=Oryza sativa subsp. japonica GN=Os08g0192900 PE=2 SV=1 667 808 9.0E-06
sp|P42696|RBM34_HUMAN RNA-binding protein 34 OS=Homo sapiens GN=RBM34 PE=1 SV=2 670 835 1.0E-05
sp|O61374|SXL_CERCA Sex-lethal homolog OS=Ceratitis capitata GN=SXL PE=2 SV=2 676 845 1.0E-05
sp|Q9QZH3|PPIE_MOUSE Peptidyl-prolyl cis-trans isomerase E OS=Mus musculus GN=Ppie PE=1 SV=2 763 847 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0003676 nucleic acid binding No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2978
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6356
Ophiocordyceps australis map64 (Brazil) OphauB2|101
Ophiocordyceps camponoti-floridani Ophcf2|00899
Ophiocordyceps camponoti-rufipedis Ophun1|7533 (this protein)
Ophiocordyceps kimflemingae Ophio5|732
Ophiocordyceps subramaniannii Hirsu2|51

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7533
MVNPVGEDSWIAYLEEASRSASDVEQCVNVVELYKRATGAEPASLRLWLAYCQYFWGLWVASHANDSAWPEDDQV
MARELFTFGTALDLWQQGYEAIKYRLDDSHLLWDRWISLEMEQLAKTKTPEGIRRVTHLYCDRLATPHLTWDETS
QAFSTFLSEYNTAAWEETMKKVTALSQDAKQALAARDSFELKLKEASRDGQADVLKSTLREYLEWEMRQGHSDAG
SSKLASDLCCGLFERALSGVFALDDGVWQEYIVFISSSTESQASERLLDILRRAVQHCPWSGQLWNRYILCAEEA
KHSFSDIESIKHAATSENQLYKNGMESMIEMYVAWCGFLKRTAIEATATDEAVDVADVGLRAALEDVAVVGKRLY
GKDFQGDPKFRLERIYIQYLTEKKGAIDEARTVWNKLADVQIHADSYDFWIRYYMWEMFVFSSNSQPARSPTPSS
GVGSCLRVPKLGTAVLHAAANRKTIDWPERVLEVYLQHCNDYEHPSSVRRGTDMVHKLDKAVKRRRQREEEAKAA
AFAAYYGEAVDESVSVNGSKRKRNSQPEPQDDGVSGDKTSKRQKTGEEAAAATQPSSSVELNAKRDRENATIIVT
GLPAGVTQTKVRQYFKEYGHINSLTALVQEKDGKSSTALIEFSTPEEAQSALLRDGKYFGQSQLSVQSGHDLTVY
VANFPPVADDKYIRKLFKDCGEILSIRWPSLKVNTHRRFCYVSFRDREASAKAVAKEGTVLDRKFSLLAKYSDPS
RKKNREGAVAEGRELHVSGLDKAVTEDEIRQVFSRLGTVGRVTVPVNMAGKNRGFAFVAMETKEEAERAAEEMNN
TKLRNQILRVEISKESKVKHAAKTANVEPGADKQAQENEAGDRPGPSAADIEARTVALMGLPDTVNDTRIRALVE
PLGAIVQLVLQPAHGGAKIEFADAATAGKAALELDGADFDGSKLRTGSVADLRRAKADRTDDRIVYGSKDKRSGS
TRKANDDAAHKKPSLMPPPIPVPVRRTGPKRGVGFPAGPRRAAAAPGENGTSAPKTNADFRALLLGVEEGGKQGG
KQGEREGDA*
Coding >Ophun1|7533
ATGGTCAACCCAGTAGGCGAAGACAGCTGGATCGCCTATCTCGAGGAGGCGTCCCGGAGCGCCTCCGACGTCGAG
CAGTGCGTCAATGTCGTCGAGCTCTACAAGCGCGCCACGGGCGCCGAGCCCGCCAGCCTTCGTCTCTGGCTGGCC
TATTGCCAATACTTCTGGGGGCTCTGGGTCGCCAGCCATGCCAATGATAGCGCTTGGCCCGAGGACGATCAGGTC
ATGGCCCGCGAGCTCTTCACCTTTGGCACCGCCTTGGACCTCTGGCAGCAGGGCTACGAAGCCATAAAGTACCGT
CTCGACGACAGCCACCTGCTCTGGGACCGTTGGATCTCCCTCGAGATGGAGCAGCTGGCCAAGACCAAGACGCCC
GAGGGCATCCGGCGCGTAACCCATCTATACTGCGACCGTCTCGCCACCCCCCATCTCACCTGGGACGAAACTTCG
CAGGCCTTTTCCACCTTTTTGTCCGAGTACAATACGGCCGCGTGGGAAGAGACGATGAAAAAGGTCACCGCGCTT
TCTCAGGACGCGAAACAAGCCCTTGCCGCCCGCGATTCCTTTGAGCTCAAGCTAAAGGAGGCTTCGCGAGACGGC
CAGGCCGACGTCCTCAAGTCTACCTTGAGGGAATATCTGGAATGGGAAATGCGTCAGGGTCACAGCGATGCCGGC
TCGTCCAAGTTAGCCTCGGACCTGTGCTGCGGCCTCTTCGAGAGAGCCCTCAGCGGCGTCTTCGCCCTGGACGAT
GGCGTTTGGCAAGAATACATCGTCTTCATCTCCTCGAGCACCGAGTCGCAGGCCTCCGAGAGGCTACTCGACATA
CTTCGTCGGGCCGTCCAACACTGTCCTTGGTCCGGCCAACTTTGGAACCGTTACATACTTTGCGCCGAGGAGGCC
AAACACTCCTTTTCCGACATCGAGTCCATCAAGCACGCGGCAACGAGCGAGAACCAGCTGTACAAGAACGGTATG
GAGAGCATGATCGAGATGTACGTCGCCTGGTGTGGCTTCCTGAAGCGCACCGCCATCGAGGCCACCGCCACCGAC
GAGGCCGTAGACGTGGCCGACGTGGGCCTCAGGGCTGCACTCGAGGACGTCGCCGTCGTCGGCAAGAGGCTCTAC
GGCAAGGACTTTCAGGGCGACCCAAAGTTTCGGCTCGAGAGGATATATATCCAGTATTTAACGGAGAAGAAGGGC
GCCATCGACGAGGCCAGGACCGTGTGGAACAAGCTGGCTGACGTCCAGATCCACGCCGACAGCTACGACTTTTGG
ATCCGCTACTACATGTGGGAAATGTTCGTCTTCTCGTCCAACTCGCAGCCGGCCAGAAGCCCCACGCCGTCGTCT
GGTGTCGGCTCCTGTCTGCGGGTGCCTAAGCTTGGTACCGCTGTGCTGCATGCCGCTGCCAATCGCAAGACCATT
GACTGGCCGGAGAGGGTTTTGGAGGTGTATCTGCAGCATTGCAATGACTATGAGCATCCGTCGTCGGTGCGTCGA
GGGACCGACATGGTACATAAGCTTGACAAGGCGGTCAAGAGGCGGCGACAGCGCGAGGAGGAAGCCAAGGCCGCC
GCCTTCGCCGCTTACTATGGCGAGGCCGTCGATGAGTCGGTCTCGGTCAATGGGTCGAAACGTAAGCGTAATTCG
CAGCCGGAGCCTCAAGACGATGGAGTCAGCGGCGACAAGACCAGCAAGCGGCAGAAGACTGGTGAGGAAGCGGCC
GCCGCGACCCAACCGTCCAGCTCGGTCGAGCTCAATGCCAAGCGAGACCGCGAGAACGCGACCATCATCGTGACG
GGCTTGCCGGCTGGTGTGACGCAGACCAAAGTCCGCCAGTATTTCAAGGAGTACGGCCACATCAACAGCCTCACT
GCCCTCGTGCAGGAAAAGGACGGCAAGTCGTCGACGGCCCTGATCGAGTTCTCCACCCCCGAAGAGGCACAGTCG
GCGCTGCTCAGGGATGGAAAATACTTTGGCCAGTCGCAGCTGAGTGTTCAGTCGGGCCACGATCTTACAGTCTAC
GTGGCCAACTTCCCACCCGTGGCTGATGACAAGTACATACGGAAGCTGTTCAAGGACTGCGGTGAGATACTGAGC
ATCCGGTGGCCGAGCCTCAAGGTCAACACCCATCGGCGCTTCTGCTACGTCTCCTTCCGCGACCGCGAGGCCTCG
GCCAAGGCCGTCGCCAAGGAGGGTACCGTCCTGGACCGCAAGTTCAGCCTGCTGGCCAAGTACTCGGATCCCTCG
CGCAAGAAGAATCGCGAAGGCGCTGTGGCCGAGGGACGCGAGCTTCACGTCTCTGGACTGGATAAGGCGGTCACC
GAGGACGAGATACGGCAGGTCTTTTCCAGGCTGGGCACCGTTGGGAGGGTCACAGTCCCGGTGAACATGGCTGGC
AAGAATCGGGGATTTGCTTTTGTGGCCATGGAGACCAAGGAGGAGGCCGAGAGGGCGGCCGAGGAGATGAACAAC
ACGAAGCTGCGGAACCAGATCCTCCGAGTCGAGATCTCTAAAGAGTCCAAGGTGAAGCATGCGGCCAAGACGGCT
AATGTCGAACCCGGCGCCGATAAGCAAGCTCAGGAGAACGAGGCTGGTGACAGGCCGGGCCCGTCGGCGGCAGAC
ATCGAGGCCCGGACCGTGGCCCTCATGGGTCTACCAGACACCGTCAACGACACACGCATCCGGGCTCTCGTCGAG
CCCCTTGGCGCCATCGTCCAGCTCGTCTTACAGCCCGCCCACGGCGGAGCCAAGATCGAGTTCGCCGACGCCGCC
ACCGCCGGCAAGGCGGCCCTGGAGCTCGACGGCGCCGACTTTGACGGTTCCAAGCTCCGAACCGGCTCCGTCGCC
GACCTCCGCCGGGCAAAGGCCGACCGCACCGACGACCGCATCGTCTACGGCAGCAAAGACAAGAGAAGCGGCAGC
ACCCGCAAAGCCAACGACGACGCCGCCCATAAGAAACCCAGCTTGATGCCGCCCCCCATCCCCGTCCCCGTCCGT
CGCACCGGCCCCAAACGCGGCGTCGGCTTCCCGGCTGGACCTCGGCGCGCCGCGGCGGCGCCGGGTGAGAACGGC
ACGTCGGCGCCCAAGACGAATGCTGACTTTCGGGCCTTGCTCCTGGGTGTTGAGGAGGGTGGGAAGCAGGGCGGG
AAGCAGGGCGAGAGGGAGGGCGATGCTTGA
Transcript >Ophun1|7533
ATGGTCAACCCAGTAGGCGAAGACAGCTGGATCGCCTATCTCGAGGAGGCGTCCCGGAGCGCCTCCGACGTCGAG
CAGTGCGTCAATGTCGTCGAGCTCTACAAGCGCGCCACGGGCGCCGAGCCCGCCAGCCTTCGTCTCTGGCTGGCC
TATTGCCAATACTTCTGGGGGCTCTGGGTCGCCAGCCATGCCAATGATAGCGCTTGGCCCGAGGACGATCAGGTC
ATGGCCCGCGAGCTCTTCACCTTTGGCACCGCCTTGGACCTCTGGCAGCAGGGCTACGAAGCCATAAAGTACCGT
CTCGACGACAGCCACCTGCTCTGGGACCGTTGGATCTCCCTCGAGATGGAGCAGCTGGCCAAGACCAAGACGCCC
GAGGGCATCCGGCGCGTAACCCATCTATACTGCGACCGTCTCGCCACCCCCCATCTCACCTGGGACGAAACTTCG
CAGGCCTTTTCCACCTTTTTGTCCGAGTACAATACGGCCGCGTGGGAAGAGACGATGAAAAAGGTCACCGCGCTT
TCTCAGGACGCGAAACAAGCCCTTGCCGCCCGCGATTCCTTTGAGCTCAAGCTAAAGGAGGCTTCGCGAGACGGC
CAGGCCGACGTCCTCAAGTCTACCTTGAGGGAATATCTGGAATGGGAAATGCGTCAGGGTCACAGCGATGCCGGC
TCGTCCAAGTTAGCCTCGGACCTGTGCTGCGGCCTCTTCGAGAGAGCCCTCAGCGGCGTCTTCGCCCTGGACGAT
GGCGTTTGGCAAGAATACATCGTCTTCATCTCCTCGAGCACCGAGTCGCAGGCCTCCGAGAGGCTACTCGACATA
CTTCGTCGGGCCGTCCAACACTGTCCTTGGTCCGGCCAACTTTGGAACCGTTACATACTTTGCGCCGAGGAGGCC
AAACACTCCTTTTCCGACATCGAGTCCATCAAGCACGCGGCAACGAGCGAGAACCAGCTGTACAAGAACGGTATG
GAGAGCATGATCGAGATGTACGTCGCCTGGTGTGGCTTCCTGAAGCGCACCGCCATCGAGGCCACCGCCACCGAC
GAGGCCGTAGACGTGGCCGACGTGGGCCTCAGGGCTGCACTCGAGGACGTCGCCGTCGTCGGCAAGAGGCTCTAC
GGCAAGGACTTTCAGGGCGACCCAAAGTTTCGGCTCGAGAGGATATATATCCAGTATTTAACGGAGAAGAAGGGC
GCCATCGACGAGGCCAGGACCGTGTGGAACAAGCTGGCTGACGTCCAGATCCACGCCGACAGCTACGACTTTTGG
ATCCGCTACTACATGTGGGAAATGTTCGTCTTCTCGTCCAACTCGCAGCCGGCCAGAAGCCCCACGCCGTCGTCT
GGTGTCGGCTCCTGTCTGCGGGTGCCTAAGCTTGGTACCGCTGTGCTGCATGCCGCTGCCAATCGCAAGACCATT
GACTGGCCGGAGAGGGTTTTGGAGGTGTATCTGCAGCATTGCAATGACTATGAGCATCCGTCGTCGGTGCGTCGA
GGGACCGACATGGTACATAAGCTTGACAAGGCGGTCAAGAGGCGGCGACAGCGCGAGGAGGAAGCCAAGGCCGCC
GCCTTCGCCGCTTACTATGGCGAGGCCGTCGATGAGTCGGTCTCGGTCAATGGGTCGAAACGTAAGCGTAATTCG
CAGCCGGAGCCTCAAGACGATGGAGTCAGCGGCGACAAGACCAGCAAGCGGCAGAAGACTGGTGAGGAAGCGGCC
GCCGCGACCCAACCGTCCAGCTCGGTCGAGCTCAATGCCAAGCGAGACCGCGAGAACGCGACCATCATCGTGACG
GGCTTGCCGGCTGGTGTGACGCAGACCAAAGTCCGCCAGTATTTCAAGGAGTACGGCCACATCAACAGCCTCACT
GCCCTCGTGCAGGAAAAGGACGGCAAGTCGTCGACGGCCCTGATCGAGTTCTCCACCCCCGAAGAGGCACAGTCG
GCGCTGCTCAGGGATGGAAAATACTTTGGCCAGTCGCAGCTGAGTGTTCAGTCGGGCCACGATCTTACAGTCTAC
GTGGCCAACTTCCCACCCGTGGCTGATGACAAGTACATACGGAAGCTGTTCAAGGACTGCGGTGAGATACTGAGC
ATCCGGTGGCCGAGCCTCAAGGTCAACACCCATCGGCGCTTCTGCTACGTCTCCTTCCGCGACCGCGAGGCCTCG
GCCAAGGCCGTCGCCAAGGAGGGTACCGTCCTGGACCGCAAGTTCAGCCTGCTGGCCAAGTACTCGGATCCCTCG
CGCAAGAAGAATCGCGAAGGCGCTGTGGCCGAGGGACGCGAGCTTCACGTCTCTGGACTGGATAAGGCGGTCACC
GAGGACGAGATACGGCAGGTCTTTTCCAGGCTGGGCACCGTTGGGAGGGTCACAGTCCCGGTGAACATGGCTGGC
AAGAATCGGGGATTTGCTTTTGTGGCCATGGAGACCAAGGAGGAGGCCGAGAGGGCGGCCGAGGAGATGAACAAC
ACGAAGCTGCGGAACCAGATCCTCCGAGTCGAGATCTCTAAAGAGTCCAAGGTGAAGCATGCGGCCAAGACGGCT
AATGTCGAACCCGGCGCCGATAAGCAAGCTCAGGAGAACGAGGCTGGTGACAGGCCGGGCCCGTCGGCGGCAGAC
ATCGAGGCCCGGACCGTGGCCCTCATGGGTCTACCAGACACCGTCAACGACACACGCATCCGGGCTCTCGTCGAG
CCCCTTGGCGCCATCGTCCAGCTCGTCTTACAGCCCGCCCACGGCGGAGCCAAGATCGAGTTCGCCGACGCCGCC
ACCGCCGGCAAGGCGGCCCTGGAGCTCGACGGCGCCGACTTTGACGGTTCCAAGCTCCGAACCGGCTCCGTCGCC
GACCTCCGCCGGGCAAAGGCCGACCGCACCGACGACCGCATCGTCTACGGCAGCAAAGACAAGAGAAGCGGCAGC
ACCCGCAAAGCCAACGACGACGCCGCCCATAAGAAACCCAGCTTGATGCCGCCCCCCATCCCCGTCCCCGTCCGT
CGCACCGGCCCCAAACGCGGCGTCGGCTTCCCGGCTGGACCTCGGCGCGCCGCGGCGGCGCCGGGTGAGAACGGC
ACGTCGGCGCCCAAGACGAATGCTGACTTTCGGGCCTTGCTCCTGGGTGTTGAGGAGGGTGGGAAGCAGGGCGGG
AAGCAGGGCGAGAGGGAGGGCGATGCTTGA
Gene >Ophun1|7533
ATGGTCAACCCAGTAGGCGAAGACAGCTGGATCGCCTATCTCGAGGAGGCGTCCCGGAGCGCCTCCGACGTCGAG
CAGTGCGTCAATGTCGTCGAGCTCTACAAGCGCGCCACGGGCGCCGAGCCCGCCAGCCTTCGTCTCTGGCTGGCC
TATTGCCAATACTTCTGGGGGCTCTGGGTCGCCAGCCATGCCAATGATAGCGCTTGGCCCGAGGACGATCAGGTC
ATGGCCCGCGAGCTCTTCACCTTTGGCACCGCCTTGGACCTCTGGCAGCAGGGCTACGAAGCCATAAAGTACCGT
CTCGACGACAGCCACCTGCTCTGGGACCGTTGGATCTCCCTCGAGATGGAGCAGCTGGCCAAGACCAAGACGCCC
GAGGGCATCCGGCGCGTAACCCATCTATACTGCGACCGTCTCGCCACCCCCCATCTCACCTGGGACGAAACTTCG
CAGGCCTTTTCCACCTTTTTGTCCGAGTACAATACGGCCGCGTGGGAAGAGACGATGAAAAAGGTCACCGCGCTT
TCTCAGGACGCGAAACAAGCCCTTGCCGCCCGCGATTCCTTTGAGCTCAAGCTAAAGGAGGCTTCGCGAGACGGC
CAGGCCGACGTCCTCAAGTCTACCTTGAGGGAATATCTGGAATGGGAAATGCGTCAGGGTCACAGCGATGCCGGC
TCGTCCAAGTTAGCCTCGGACCTGTGCTGCGGCCTCTTCGAGAGAGCCCTCAGCGGCGTCTTCGCCCTGGACGAT
GGCGTTTGGCAAGAATACATCGTCTTCATCTCCTCGAGCACCGAGTCGCAGGCCTCCGAGAGGCTACTCGACATA
CTTCGTCGGGCCGTCCAACACTGTCCTTGGTCCGGCCAACTTTGGAACCGTTACATACTTTGCGCCGAGGAGGCC
AAACACTCCTTTTCCGACATCGAGTCCATCAAGCACGCGGCAACGAGCGAGAACCAGCTGTACAAGAACGGTATG
GAGAGCATGATCGAGATGTACGTCGCCTGGTGTGGCTTCCTGAAGCGCACCGCCATCGAGGCCACCGCCACCGAC
GAGGCCGTAGACGTGGCCGACGTGGGCCTCAGGGCTGCACTCGAGGACGTCGCCGTCGTCGGCAAGAGGCTCTAC
GGCAAGGACTTTCAGGGCGACCCAAAGTTTCGGCTCGAGAGGATATATATCCAGTATTTAACGGAGAAGAAGGGC
GCCATCGACGAGGCCAGGACCGTGTGGAACAAGCTGGCTGACGTCCAGATCCACGCCGACAGCTACGACTTTTGG
ATCCGCTACTACATGTGGGAAATGTTCGTCTTCTCGTCCAACTCGCAGCCGGCCAGAAGCCCCACGCCGTCGTCT
GGTGTCGGCTCCTGTCTGCGGGTGCCTAAGCTTGGTACCGCTGTGCTGCATGCCGCTGCCAATCGCAAGACCATT
GACTGGCCGGAGAGGGTTTTGGAGGTGTATCTGCAGCATTGCAATGACTATGAGCATCCGTCGTCGGTGCGTCGA
GGGACCGACATGGTACATAAGCTTGACAAGGCGGTCAAGAGGCGGCGACAGCGCGAGGAGGAAGCCAAGGCCGCC
GCCTTCGCCGCTTACTATGGCGAGGCCGTCGATGAGTCGGTCTCGGTCAATGGGTCGAAACGTAAGCGTAATTCG
CAGCCGGAGCCTCAAGACGATGGAGTCAGCGGCGACAAGACCAGCAAGCGGCAGAAGACTGGTGAGGAAGCGGCC
GCCGCGACCCAACCGTCCAGCTCGGTCGAGCTCAATGCCAAGCGAGACCGCGAGAACGCGACCATCATCGTGACG
GGCTTGCCGGCTGGTGTGACGCAGACCAAAGTCCGCCAGTATTTCAAGGAGTACGGCCACATCAACAGCCTCACT
GCCCTCGTGCAGGAAAAGGACGGCAAGTCGTCGACGGCCCTGATCGAGTTCTCCACCCCCGAAGAGGCACAGTCG
GCGCTGCTCAGGGATGGAAAATACTTTGGCCAGTCGCAGCTGAGTGTTCAGTCGGGCCACGATCTTACAGTCTAC
GTGGCCAACTTCCCACCCGTGGCTGATGACAAGTACATACGGAAGCTGTTCAAGGACTGCGGTGAGATACTGAGC
ATCCGGTGGCCGAGCCTCAAGGTCAACACCCATCGGCGCTTCTGCTACGTCTCCTTCCGCGACCGCGAGGCCTCG
GCCAAGGCCGTCGCCAAGGAGGGTACCGTCCTGGACCGCAAGTTCAGCCTGCTGGCCAAGTACTCGGATCCCTCG
CGCAAGAAGAATCGCGAAGGCGCTGTGGCCGAGGGACGCGAGCTTCACGTCTCTGGACTGGATAAGGCGGTCACC
GAGGACGAGATACGGCAGGTCTTTTCCAGGCTGGGCACCGTTGGGAGGGTCACAGTCCCGGTGAACATGGCTGGC
AAGAATCGGGGATTTGCTTTTGTGGCCATGGAGACCAAGGAGGAGGCCGAGAGGGCGGCCGAGGAGATGAACAAC
ACGAAGCTGCGGAACCAGATCCTCCGAGTCGAGATCTCTAAAGAGTCCAAGGTGAAGCATGCGGCCAAGACGGCT
AATGTCGAACCCGGCGCCGATAAGCAAGCTCAGGAGAACGAGGCTGGTGACAGGCCGGGCCCGTCGGCGGCAGAC
ATCGAGGCCCGGACCGTGGCCCTCATGGGTCTACCAGACACCGTCAACGACACACGCATCCGGGCTCTCGTCGAG
CCCCTTGGCGCCATCGTCCAGCTCGTCTTACAGCCCGCCCACGGCGGAGCCAAGATCGAGTTCGCCGACGCCGCC
ACCGCCGGCAAGGCGGCCCTGGAGCTCGACGGCGCCGACTTTGACGGTTCCAAGCTCCGAACCGGCTCCGTCGCC
GACCTCCGCCGGGCAAAGGCCGACCGCACCGACGACCGCATCGTCTACGGCAGCAAAGACAAGAGAAGCGGCAGC
ACCCGCAAAGCCAACGACGACGCCGCCCATAAGAAACCCAGCTTGATGCCGCCCCCCATCCCCGTCCCCGTCCGT
CGCACCGGCCCCAAACGCGGCGTCGGCTTCCCGGCTGGACCTCGGCGCGCCGCGGCGGCGCCGGGTGAGAACGGC
ACGTCGGCGCCCAAGACGAATGCTGACTTTCGGGCCTTGCTCCTGGGTGTTGAGGAGGGTGGGAAGCAGGGCGGG
AAGCAGGGCGAGAGGGAGGGCGATGCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail