Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7521
Gene name
LocationContig_963:1258..1933
Strand-
Gene length (bp)675
Transcript length (bp)549
Coding sequence length (bp)549
Protein length (aa) 183

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04061 ORMDL ORMDL family 6.5E-58 38 172

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P53224|ORM1_YEAST Protein ORM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ORM1 PE=1 SV=1 21 175 2.0E-60
sp|O42901|YBA9_SCHPO Uncharacterized protein C119.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC119.09c PE=2 SV=3 23 175 4.0E-59
sp|Q96495|ORM1_SACMO Protein ORM1 OS=Saccharomyces pastorianus (strain ATCC 76670 / Carlsberg bottom yeast no.2 / CBS 1503 / CLIB 180 / NBRC 10610 / NRRL Y-1525) GN=ORM1 PE=4 SV=1 39 175 2.0E-55
sp|Q06144|ORM2_YEAST Protein ORM2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ORM2 PE=1 SV=1 19 175 2.0E-52
sp|Q8N138|ORML3_HUMAN ORM1-like protein 3 OS=Homo sapiens GN=ORMDL3 PE=1 SV=1 38 175 6.0E-29
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P53224|ORM1_YEAST Protein ORM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ORM1 PE=1 SV=1 21 175 2.0E-60
sp|O42901|YBA9_SCHPO Uncharacterized protein C119.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC119.09c PE=2 SV=3 23 175 4.0E-59
sp|Q96495|ORM1_SACMO Protein ORM1 OS=Saccharomyces pastorianus (strain ATCC 76670 / Carlsberg bottom yeast no.2 / CBS 1503 / CLIB 180 / NBRC 10610 / NRRL Y-1525) GN=ORM1 PE=4 SV=1 39 175 2.0E-55
sp|Q06144|ORM2_YEAST Protein ORM2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ORM2 PE=1 SV=1 19 175 2.0E-52
sp|Q8N138|ORML3_HUMAN ORM1-like protein 3 OS=Homo sapiens GN=ORMDL3 PE=1 SV=1 38 175 6.0E-29
sp|Q6QI25|ORML3_RAT ORM1-like protein 3 OS=Rattus norvegicus GN=Ormdl3 PE=2 SV=2 38 175 7.0E-29
sp|Q5R570|ORML3_PONAB ORM1-like protein 3 OS=Pongo abelii GN=ORMDL3 PE=2 SV=1 38 175 9.0E-29
sp|Q9CPZ6|ORML3_MOUSE ORM1-like protein 3 OS=Mus musculus GN=Ormdl3 PE=2 SV=1 38 175 1.0E-28
sp|Q0VD15|ORML3_BOVIN ORM1-like protein 3 OS=Bos taurus GN=ORMDL3 PE=2 SV=1 38 175 1.0E-28
sp|D2I2F3|ORML3_AILME ORM1-like protein 3 OS=Ailuropoda melanoleuca GN=ORMDL3 PE=3 SV=1 38 175 2.0E-28
sp|Q5XJR6|ORML3_DANRE ORM1-like protein 3 OS=Danio rerio GN=ormdl3 PE=2 SV=1 38 175 4.0E-28
sp|Q8JFB7|ORML1_DANRE ORM1-like protein 1 OS=Danio rerio GN=ormdl1 PE=2 SV=1 38 175 3.0E-27
sp|Q53FV1|ORML2_HUMAN ORM1-like protein 2 OS=Homo sapiens GN=ORMDL2 PE=1 SV=2 38 175 7.0E-27
sp|Q5XH57|ORML1_XENLA ORM1-like protein 1 OS=Xenopus laevis GN=ormdl1 PE=2 SV=1 38 175 2.0E-26
sp|Q921I0|ORML1_MOUSE ORM1-like protein 1 OS=Mus musculus GN=Ormdl1 PE=2 SV=1 38 175 9.0E-26
sp|Q29RQ9|ORML1_BOVIN ORM1-like protein 1 OS=Bos taurus GN=ORMDL1 PE=2 SV=1 38 175 1.0E-25
sp|Q5R8X5|ORML1_PONAB ORM1-like protein 1 OS=Pongo abelii GN=ORMDL1 PE=2 SV=1 38 175 2.0E-25
sp|Q9P0S3|ORML1_HUMAN ORM1-like protein 1 OS=Homo sapiens GN=ORMDL1 PE=1 SV=1 38 175 2.0E-25
sp|Q9CQZ0|ORML2_MOUSE ORM1-like protein 2 OS=Mus musculus GN=Ormdl2 PE=1 SV=1 38 175 4.0E-25
sp|Q5ZIU0|ORML2_CHICK ORM1-like protein 2 OS=Gallus gallus GN=ORMDL2 PE=2 SV=1 38 175 1.0E-24
sp|Q5E972|ORML2_BOVIN ORM1-like protein 2 OS=Bos taurus GN=ORMDL2 PE=2 SV=1 38 175 2.0E-24
sp|Q9VP04|ORMDL_DROME ORM1-like protein OS=Drosophila melanogaster GN=ORMDL PE=1 SV=1 27 173 1.0E-20
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0005789 endoplasmic reticulum membrane Yes
GO:0031090 organelle membrane No
GO:0005575 cellular_component No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0016020 membrane No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.5

Transmembrane Domains

Domain # Start End Length
1 49 71 22
2 127 144 17
3 148 167 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7521
MDDTDSGARRRRSSSILQVYHEPPETLEQISDQAALPNLNANWTNAKGAWTIHIVVIVMLKIFYDVIPGVSNETS
WTLTNMTYMFGSYLMFHYVRGVPFEFNSGAFDNLNMWEQIDNGAQYTPTKKFLLGVPIVLFLLSTHYTHYDLVYF
VINFLAVLGVIIPKLPFSHRMRFGLFSGPPDV*
Coding >Ophun1|7521
ATGGACGATACAGACAGCGGCGCCCGCAGGAGGAGATCCAGCAGCATCCTTCAGGTCTACCATGAGCCGCCCGAG
ACGCTCGAGCAGATCAGCGACCAGGCGGCGCTGCCCAACCTCAACGCCAACTGGACAAACGCCAAAGGTGCCTGG
ACCATCCACATCGTCGTCATCGTCATGCTCAAAATCTTTTACGACGTGATCCCCGGCGTGTCCAACGAGACGTCG
TGGACGCTCACAAACATGACGTACATGTTCGGCTCCTATCTCATGTTTCACTACGTCCGCGGCGTCCCCTTCGAG
TTCAACAGTGGGGCCTTTGACAACCTCAACATGTGGGAGCAGATCGACAATGGCGCCCAGTACACGCCCACCAAG
AAGTTTCTGCTGGGCGTGCCCATTGTACTGTTTTTGCTGAGCACCCACTACACCCACTACGACCTGGTGTACTTT
GTCATAAACTTTCTCGCCGTCCTGGGTGTTATTATCCCCAAGCTTCCGTTTAGCCACAGGATGCGCTTTGGTCTC
TTCTCGGGGCCGCCAGATGTGTAG
Transcript >Ophun1|7521
ATGGACGATACAGACAGCGGCGCCCGCAGGAGGAGATCCAGCAGCATCCTTCAGGTCTACCATGAGCCGCCCGAG
ACGCTCGAGCAGATCAGCGACCAGGCGGCGCTGCCCAACCTCAACGCCAACTGGACAAACGCCAAAGGTGCCTGG
ACCATCCACATCGTCGTCATCGTCATGCTCAAAATCTTTTACGACGTGATCCCCGGCGTGTCCAACGAGACGTCG
TGGACGCTCACAAACATGACGTACATGTTCGGCTCCTATCTCATGTTTCACTACGTCCGCGGCGTCCCCTTCGAG
TTCAACAGTGGGGCCTTTGACAACCTCAACATGTGGGAGCAGATCGACAATGGCGCCCAGTACACGCCCACCAAG
AAGTTTCTGCTGGGCGTGCCCATTGTACTGTTTTTGCTGAGCACCCACTACACCCACTACGACCTGGTGTACTTT
GTCATAAACTTTCTCGCCGTCCTGGGTGTTATTATCCCCAAGCTTCCGTTTAGCCACAGGATGCGCTTTGGTCTC
TTCTCGGGGCCGCCAGATGTGTAG
Gene >Ophun1|7521
ATGGACGATACAGACAGCGGCGCCCGCAGGAGGAGATCCAGCAGCATCCTTCAGGTCTACCATGAGCCGCCCGAG
ACGCTCGAGCAGATCAGCGACCAGGCGGCGCTGCCCAACCTCAACGCCAACTGGACAAACGCCAAAGGTGAGCAT
CTGATCTGAGTCTAACGAGGGAGGCTGGTTCGCTGACATGGCTCTCGAGGTGCCTGGACCATCCACATCGTCGTC
ATCGTCATGCTCAAAATCTTTTACGACGTGATCCCCGGCGTGTCCAACGAGACGTCGTGGACGCTCACAAACATG
ACGTACATGTTCGGCTCCTATCTCATGTTTCACTACGTCCGCGGCGTCCCCTTCGAGTTCAACAGTGGGGCCTTT
GACAACCTCAACATGTGGGAGCAGATCGACAATGGCGCCCAGTACACGCCCACCAAGAAGTTTCTGCTGGGCGTG
CCCATTGTACTGTTTTTGCTGAGCACCCACTACACCCACTACGACCTGGTGTACTTTGTCATAAACTTTCTCGCC
GTCCTGGGTGTTATTATCCCCAAGCTTCCGTTTGTGCGTTGGCCCTACCTACCTATCCCACGTCGTGCTGTCCGT
GGTGCCTCGCGTGCTGACCATGCTCAGAGCCACAGGATGCGCTTTGGTCTCTTCTCGGGGCCGCCAGATGTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail