Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7519
Gene name
LocationContig_962:2351..5182
Strand-
Gene length (bp)2831
Transcript length (bp)2103
Coding sequence length (bp)2103
Protein length (aa) 701

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 3.1E-29 221 610

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13880|VHT1_SCHPO Vitamin H transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vht1 PE=2 SV=1 198 677 7.0E-109
sp|O13879|YE1F_SCHPO Uncharacterized transporter C1B3.15C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1B3.15c PE=3 SV=1 160 659 9.0E-103
sp|P70786|TUB3_AGRVI Putative tartrate transporter OS=Agrobacterium vitis GN=ttuB PE=2 SV=1 194 438 2.0E-28
sp|Q44470|TUB4_AGRVI Putative tartrate transporter OS=Agrobacterium vitis GN=ttuB PE=2 SV=1 208 429 1.0E-27
sp|Q88FY6|NICT_PSEPK Putative metabolite transport protein NicT OS=Pseudomonas putida (strain KT2440) GN=nicT PE=2 SV=1 182 421 5.0E-24
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13880|VHT1_SCHPO Vitamin H transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vht1 PE=2 SV=1 198 677 7.0E-109
sp|O13879|YE1F_SCHPO Uncharacterized transporter C1B3.15C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1B3.15c PE=3 SV=1 160 659 9.0E-103
sp|P70786|TUB3_AGRVI Putative tartrate transporter OS=Agrobacterium vitis GN=ttuB PE=2 SV=1 194 438 2.0E-28
sp|Q44470|TUB4_AGRVI Putative tartrate transporter OS=Agrobacterium vitis GN=ttuB PE=2 SV=1 208 429 1.0E-27
sp|Q88FY6|NICT_PSEPK Putative metabolite transport protein NicT OS=Pseudomonas putida (strain KT2440) GN=nicT PE=2 SV=1 182 421 5.0E-24
sp|Q9P6J0|YHDC_SCHPO Uncharacterized transporter C1683.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.12 PE=3 SV=1 186 604 1.0E-23
sp|Q9US44|YIZG_SCHPO Uncharacterized transporter C1002.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1002.16c PE=3 SV=1 211 529 3.0E-21
sp|Q10097|YAOI_SCHPO Uncharacterized transporter C11D3.18C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.18c PE=3 SV=1 166 670 8.0E-17
sp|P76470|RHMT_ECOLI Inner membrane transport protein RhmT OS=Escherichia coli (strain K12) GN=rhmT PE=1 SV=2 205 548 4.0E-16
sp|Q05181|PHT1_PSEPU Phthalate transporter OS=Pseudomonas putida GN=pht1 PE=3 SV=1 205 662 3.0E-12
sp|Q9US37|YFZ4_SCHPO Uncharacterized transporter C1039.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1039.04 PE=3 SV=1 188 547 5.0E-11
sp|O43000|LIZ1_SCHPO Pantothenate transporter liz1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=liz1 PE=2 SV=2 210 473 1.0E-08
sp|P53322|TNA1_YEAST High-affinity nicotinic acid transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TNA1 PE=1 SV=1 208 603 1.0E-08
sp|P40445|YIQ6_YEAST Uncharacterized transporter YIL166C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIL166C PE=1 SV=1 210 649 9.0E-07
sp|P25621|FEN2_YEAST Pantothenate transporter FEN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FEN2 PE=1 SV=1 197 409 4.0E-06
sp|O94491|YC7A_SCHPO Uncharacterized transporter C417.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC417.10 PE=3 SV=1 192 552 5.0E-06
sp|O74923|YJ7D_SCHPO Uncharacterized transporter C757.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC757.13 PE=3 SV=1 191 570 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0006810 transport No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22
2 288 310 22
3 315 337 22
4 347 369 22
5 381 403 22
6 468 490 22
7 502 521 19
8 531 553 22
9 560 582 22
10 592 614 22
11 635 654 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7519
MKASSIPHVVVVIVVVVVVVLDDGWAIGAENMVVIIIMFGKNGIMSRVLAEMLCYIRVGIPRVLGVIAKGAVVDE
VSRLTAAGMEERAGGRLREAARPEDVGLKIPVSMFPAAQGGLFHPDHPPRVALEVGSWRHWLVGGIKMILCCKMI
LCCKMILCCKMILCCKDPKDGPLASSQVSLGPSTTAPGESADVDGGESADDARAMELIYKKLDRRLIPPFWLLYF
ICSSIRSNIGIAQTMNKKQGHDLMKVLDISPKQVSVALGVFYVAYIACDFPSNLLMCKLNPRVWMTRIVFGTGFF
GAILALSNGFFSLVFLRFLLGFVIAGMWPGMAFYLTLFYPPERTGKRIGLYFTAGQVSAIVVGLSSAGFQLMDDV
RGIEGFRWMFLIYGLTAVLLSFVLVWWLPDRPLAPGQARERSRWLKWLPPTPEALTGRDAVVHYRNLSRSYHPEP
WTIKDALKMFLDWRLYPLWLMYVGVVGVGIGTQLYGSVIIKAIRPQATDIQISLLFAPIWLMDLIAILIVTPLSD
RFHHHRALFFSGAVCIQMVGLLTTTYAPADGWARYGGLLMVGFGLGPTVPICMAWTAEVFQRRHGELGVAAATAL
VSGLGNVGSLVTSLGLYTGWEDDRKSSRPFRKSNLVMVGMLLMSLASAVQMTVMLRKFGNPPSGKRNEGEPVEAA
TDGIAEGETQQRGFKGKMSVWRASR*
Coding >Ophun1|7519
ATGAAGGCGAGCAGCATCCCCCACGTCGTCGTCGTCATCGTCGTCGTCGTCGTCGTCGTCCTCGATGATGGTTGG
GCCATCGGGGCCGAGAACATGGTGGTCATCATCATCATGTTCGGCAAGAATGGAATCATGAGCCGTGTATTGGCC
GAGATGCTCTGCTACATCCGAGTCGGTATACCGCGGGTGCTGGGCGTCATCGCAAAAGGCGCCGTCGTTGATGAA
GTTTCTCGACTCACGGCGGCCGGGATGGAAGAGAGAGCCGGTGGGCGGTTGCGCGAGGCTGCGAGGCCCGAGGAT
GTTGGCCTGAAAATTCCCGTGTCGATGTTTCCGGCTGCGCAGGGCGGGCTGTTCCACCCGGATCACCCACCGAGA
GTTGCGCTGGAGGTGGGCAGCTGGCGGCATTGGCTTGTCGGCGGCATCAAGATGATTCTCTGCTGTAAGATGATT
CTCTGCTGTAAGATGATTCTCTGCTGTAAGATGATTCTCTGCTGCAAGGACCCCAAGGATGGCCCCCTGGCCTCC
AGCCAAGTCTCGCTGGGTCCCTCGACAACGGCCCCGGGGGAGAGCGCCGACGTAGACGGTGGCGAGTCCGCGGAT
GATGCTCGAGCCATGGAGCTCATCTACAAAAAGCTCGACAGGAGGTTGATTCCCCCTTTCTGGCTCCTCTACTTC
ATCTGCTCCTCCATCCGGTCCAATATAGGCATCGCTCAGACCATGAACAAGAAACAGGGCCACGATCTGATGAAG
GTCCTCGACATTTCCCCCAAGCAGGTGTCGGTGGCTCTCGGCGTCTTCTACGTCGCCTACATTGCATGCGACTTT
CCCTCCAACCTCTTAATGTGCAAGCTGAACCCCAGAGTCTGGATGACTCGCATCGTCTTTGGTACCGGCTTCTTC
GGCGCCATCCTGGCCTTGAGCAACGGTTTCTTCTCATTGGTATTCTTGCGCTTCCTGCTCGGTTTCGTCATCGCC
GGCATGTGGCCGGGAATGGCCTTTTATCTCACCCTCTTTTATCCGCCGGAGCGGACCGGCAAGCGGATCGGCCTG
TACTTTACTGCCGGACAAGTGTCGGCCATTGTCGTCGGTCTGTCCTCGGCCGGCTTCCAGCTCATGGACGACGTC
CGGGGCATCGAGGGCTTCCGCTGGATGTTTCTCATCTACGGCCTGACGGCTGTCCTCCTCAGCTTCGTCCTCGTG
TGGTGGCTGCCGGATCGCCCCCTGGCGCCGGGACAAGCGAGGGAGAGAAGCCGCTGGCTCAAGTGGTTGCCTCCC
ACGCCCGAGGCTCTCACCGGCCGCGATGCCGTCGTACATTACCGCAACCTGAGCCGCAGCTACCACCCCGAGCCT
TGGACGATCAAGGACGCGCTCAAGATGTTTCTGGACTGGCGGCTGTATCCGTTGTGGTTGATGTACGTTGGTGTC
GTCGGCGTCGGCATCGGCACGCAGCTGTACGGGTCCGTCATCATCAAGGCCATCCGACCGCAGGCGACGGACATT
CAGATTTCCCTCTTGTTTGCGCCCATCTGGCTGATGGACCTGATTGCCATTCTCATCGTCACGCCCCTTTCGGAC
CGCTTCCACCACCACCGCGCCCTCTTCTTCTCGGGGGCCGTCTGCATCCAGATGGTGGGACTCCTCACGACGACG
TATGCTCCGGCAGACGGATGGGCCCGCTACGGCGGCCTGCTGATGGTGGGCTTCGGGCTCGGGCCGACGGTGCCC
ATCTGCATGGCCTGGACTGCCGAGGTGTTCCAGCGGCGGCACGGCGAGTTGGGCGTCGCCGCCGCCACGGCGCTG
GTATCCGGCTTGGGCAATGTGGGCAGCCTGGTGACCTCTCTGGGGCTCTACACCGGCTGGGAGGATGATAGGAAG
TCCAGCAGACCGTTCCGGAAGAGCAACCTCGTCATGGTGGGCATGCTGCTGATGAGCTTGGCGAGCGCGGTGCAG
ATGACGGTGATGCTACGCAAATTTGGGAACCCCCCGAGCGGAAAGCGGAACGAAGGGGAGCCCGTGGAGGCGGCG
ACGGACGGGATCGCCGAGGGGGAGACACAGCAACGGGGATTCAAGGGAAAGATGTCTGTCTGGAGGGCGTCTAGA
TGA
Transcript >Ophun1|7519
ATGAAGGCGAGCAGCATCCCCCACGTCGTCGTCGTCATCGTCGTCGTCGTCGTCGTCGTCCTCGATGATGGTTGG
GCCATCGGGGCCGAGAACATGGTGGTCATCATCATCATGTTCGGCAAGAATGGAATCATGAGCCGTGTATTGGCC
GAGATGCTCTGCTACATCCGAGTCGGTATACCGCGGGTGCTGGGCGTCATCGCAAAAGGCGCCGTCGTTGATGAA
GTTTCTCGACTCACGGCGGCCGGGATGGAAGAGAGAGCCGGTGGGCGGTTGCGCGAGGCTGCGAGGCCCGAGGAT
GTTGGCCTGAAAATTCCCGTGTCGATGTTTCCGGCTGCGCAGGGCGGGCTGTTCCACCCGGATCACCCACCGAGA
GTTGCGCTGGAGGTGGGCAGCTGGCGGCATTGGCTTGTCGGCGGCATCAAGATGATTCTCTGCTGTAAGATGATT
CTCTGCTGTAAGATGATTCTCTGCTGTAAGATGATTCTCTGCTGCAAGGACCCCAAGGATGGCCCCCTGGCCTCC
AGCCAAGTCTCGCTGGGTCCCTCGACAACGGCCCCGGGGGAGAGCGCCGACGTAGACGGTGGCGAGTCCGCGGAT
GATGCTCGAGCCATGGAGCTCATCTACAAAAAGCTCGACAGGAGGTTGATTCCCCCTTTCTGGCTCCTCTACTTC
ATCTGCTCCTCCATCCGGTCCAATATAGGCATCGCTCAGACCATGAACAAGAAACAGGGCCACGATCTGATGAAG
GTCCTCGACATTTCCCCCAAGCAGGTGTCGGTGGCTCTCGGCGTCTTCTACGTCGCCTACATTGCATGCGACTTT
CCCTCCAACCTCTTAATGTGCAAGCTGAACCCCAGAGTCTGGATGACTCGCATCGTCTTTGGTACCGGCTTCTTC
GGCGCCATCCTGGCCTTGAGCAACGGTTTCTTCTCATTGGTATTCTTGCGCTTCCTGCTCGGTTTCGTCATCGCC
GGCATGTGGCCGGGAATGGCCTTTTATCTCACCCTCTTTTATCCGCCGGAGCGGACCGGCAAGCGGATCGGCCTG
TACTTTACTGCCGGACAAGTGTCGGCCATTGTCGTCGGTCTGTCCTCGGCCGGCTTCCAGCTCATGGACGACGTC
CGGGGCATCGAGGGCTTCCGCTGGATGTTTCTCATCTACGGCCTGACGGCTGTCCTCCTCAGCTTCGTCCTCGTG
TGGTGGCTGCCGGATCGCCCCCTGGCGCCGGGACAAGCGAGGGAGAGAAGCCGCTGGCTCAAGTGGTTGCCTCCC
ACGCCCGAGGCTCTCACCGGCCGCGATGCCGTCGTACATTACCGCAACCTGAGCCGCAGCTACCACCCCGAGCCT
TGGACGATCAAGGACGCGCTCAAGATGTTTCTGGACTGGCGGCTGTATCCGTTGTGGTTGATGTACGTTGGTGTC
GTCGGCGTCGGCATCGGCACGCAGCTGTACGGGTCCGTCATCATCAAGGCCATCCGACCGCAGGCGACGGACATT
CAGATTTCCCTCTTGTTTGCGCCCATCTGGCTGATGGACCTGATTGCCATTCTCATCGTCACGCCCCTTTCGGAC
CGCTTCCACCACCACCGCGCCCTCTTCTTCTCGGGGGCCGTCTGCATCCAGATGGTGGGACTCCTCACGACGACG
TATGCTCCGGCAGACGGATGGGCCCGCTACGGCGGCCTGCTGATGGTGGGCTTCGGGCTCGGGCCGACGGTGCCC
ATCTGCATGGCCTGGACTGCCGAGGTGTTCCAGCGGCGGCACGGCGAGTTGGGCGTCGCCGCCGCCACGGCGCTG
GTATCCGGCTTGGGCAATGTGGGCAGCCTGGTGACCTCTCTGGGGCTCTACACCGGCTGGGAGGATGATAGGAAG
TCCAGCAGACCGTTCCGGAAGAGCAACCTCGTCATGGTGGGCATGCTGCTGATGAGCTTGGCGAGCGCGGTGCAG
ATGACGGTGATGCTACGCAAATTTGGGAACCCCCCGAGCGGAAAGCGGAACGAAGGGGAGCCCGTGGAGGCGGCG
ACGGACGGGATCGCCGAGGGGGAGACACAGCAACGGGGATTCAAGGGAAAGATGTCTGTCTGGAGGGCGTCTAGA
TGA
Gene >Ophun1|7519
ATGAAGGCGAGCAGCATCCCCCACGTCGTCGTCGTCATCGTCGTCGTCGTCGTCGTCGTCCTCGATGATGGTTGG
GCCATCGGGGCCGAGAACATGGTGGTCATCATCATCATGTTCGGCAAGAATGGAATCATGAGCCGTGTATTGGCC
GAGATGCTCTGCTACATCCGAGTCGGTATACCGCGGGTGCTGGGCGTCATCGCAAAAGGCGCCGTCGTTGATGAA
GTTTCTCGACTCGTAGGCGACGCTCATGGCGCCGCTTCGTTCGGGGACGGCGCGGCCGGAAGGGGGGCGTTCAGA
CGGCGGCCGGGATGGAAGAGAGAGCCGGTGGGCGGTTGCGCGAGGCTGCGAGGCCCGAGGATGTTGGCCTGAAAA
TTCCCGTGTCGATGTTTCCGGCTGCGCAGGGCGGGCTGGTAGGTAGCCTCGGGGGCATCGTCGCGGGAGGAGTGC
TGAGTCAGGGCACGTGACTGTGTTTCCAGTTCCACCCGGATCACCCACCGAGAGTTGCGCTGGAGGTGGGCAGCT
GGCGGTGAGCTTCCACGGTGAGACGAGGTTTCTCCGTTGAATGCTGGAGATGGGAGGATATACTGATACAGGCAT
TGGCTTGTCGGCGGCATCAAGATGATTCTCTGCTGTAAGATGATTCTCTGCTGTAAGATGATTCTCTGCTGTAAG
ATGATTCTCTGCTGTATGTCAACGAACAGATACATACTCGTATAGCCACCGCAATCACCTCCACAACAACTGATC
AACACCACCATTGCGACATGCCTATCTCAACTCAACAAACGCAATACCGGTAGCTTCGCCAAGTCTCGCACAAAC
AGATAAAGACGACCATCACGCAAACTCAACTCTACCTCTCCAATCCAAACTCAATTCAGCTTGCCTACCCCACCA
CGTGCTCACTGGATCGCTACCTGCGGCTGTTACTGACAAGAAAAAACAGCCTCACTTCTTCCCCTCTCCAGACTG
CTACTGGCTTCATCTCACTGCGACTCGGCGACTCTGCCGCATGAATATCGCTTCTCCGCATCATATCGCTTCTCC
GTCATTGACGCTTTATGGAGCCCGTCGCAGGCAAGGACCCCAAGGATGGCCCCCTGGCCTCCAGCCAAGTCTCGC
TGGGTCCCTCGACAACGGCCCCGGGGGAGAGCGCCGACGTAGACGGTGGCGAGTCCGCGGATGATGCTCGAGCCA
TGGAGCTCATCTACAAGTTGGTCACCACATGGTCTATGCCTCGCGATGCTGACGACTGAACAGAAAGCTCGACAG
GAGGTTGATTCCCCGTAAGACAAGGCCATCCTTTGCCCTCGGCTTCTGCTGACGTCGCAGCTTTCTGGCTCCTCT
ACTTCATCTGCTCCTCCATCCGGTCCAATATAGGCATCGCTCAGACCATGAACAAGAAACAGGGCCACGATCTGA
TGAAGGTCCTCGACATTTCCCCCAAGCAGGTGTCGGTGGCTCTCGGCGTCTTCTACGTCGCCTACATTGCATGCG
ACTTTCCCTCCAACCTCTTAATGTGCAAGCTGAACCCCAGAGTCTGGATGACTCGCATCGTCTTTGGTACCGGCT
TCTTCGGCGCCATCCTGGCCTTGAGCAACGGTTTCTTCTCATTGGTATTCTTGCGCTTCCTGCTCGGTTTCGTCA
TCGCCGGCATGTGGCCGGGAATGGCCTTTTATCTCACCCTCTTTTATCCGCCGGAGCGGACCGGCAAGCGGATCG
GCCTGTACTTTACTGCCGGACAAGTGTCGGCCATTGTCGTCGGTCTGTCCTCGGCCGGCTTCCAGCTCATGGACG
ACGTCCGGGGCATCGAGGGCTTCCGCTGGATGTTTCTCATCTACGGCCTGACGGCTGTCCTCCTCAGCTTCGTCC
TCGTGTGGTGGCTGCCGGATCGCCCCCTGGCGCCGGGACAAGCGAGGGAGAGAAGCCGCTGGCTCAAGTGGTTGC
CTCCCACGCCCGAGGCTCTCACCGGCCGCGATGCCGTCGTACATTACCGCAACCTGAGCCGCAGCTACCACCCCG
AGCCTTGGACGATCAAGGACGCGCTCAAGATGTTTCTGGACTGGCGGCTGTATCCGTTGTGGTTGATGTACGTTG
GTGTCGTCGGCGTCGGCATCGGCACGCAGCTGTACGGGTCCGTCATCATCAAGGCCATCCGACCGCAGGCGACGG
ACATTCAGATTTCCCTCTTGTTTGCGCCCATCTGGCTGGTGAGTTTTCTCTCGGTAAACGAGATACTGGCTGACC
CAGATGTCTAGATGGACCTGATTGCCATTCTCATCGTCACGCCCCTTTCGGACCGCTTCCACCACCACCGCGCCC
TCTTCTTCTCGGGGGCCGTCTGCATCCAGATGGTGGGACTCCTCACGACGACGTATGCTCCGGCAGACGGATGGG
CCCGCTACGGCGGCCTGCTGATGGTGGGCTTCGGGCTCGGGCCGACGGTGCCCATCTGCATGGCCTGGACTGCCG
AGGTGTTCCAGCGGCGGCACGGCGAGTTGGGCGTCGCCGCCGCCACGGCGCTGGTATCCGGCTTGGGCAATGTGG
GCAGCCTGGTGACCTCTCTGGGGCTCTACACCGGCTGGGAGGATGATAGGAAGTCCAGCAGACCGTTCCGGAAGA
GCAACCTCGTCATGGTGGGCATGCTGCTGATGAGCTTGGCGAGCGCGGTGCAGATGACGGTGATGCTACGCAAAT
TTGGGAACCCCCCGAGCGGAAAGCGGAACGAAGGGGAGCCCGTGGAGGCGGCGACGGACGGGATCGCCGAGGGGG
AGACACAGCAACGGGGATTCAAGGGAAAGATGTCTGTCTGGAGGGCGTCTAGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail