Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7518
Gene name
LocationContig_960:2785..4393
Strand+
Gene length (bp)1608
Transcript length (bp)1608
Coding sequence length (bp)1608
Protein length (aa) 536

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04218 CENP-B_N CENP-B N-terminal DNA-binding domain 1.3E-07 136 187
PF03221 HTH_Tnp_Tc5 Tc5 transposase DNA-binding domain 2.9E-07 204 265

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0003676 nucleic acid binding No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2365
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|715
Ophiocordyceps australis map64 (Brazil) OphauB2|2429
Ophiocordyceps camponoti-floridani Ophcf2|04501
Ophiocordyceps camponoti-rufipedis Ophun1|7518 (this protein)
Ophiocordyceps kimflemingae Ophio5|2643
Ophiocordyceps subramaniannii Hirsu2|3285

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7518
MMHTDMDGSAAMDPDSAMAQCHGYGGESWVDLSAYPGTFDDGTMGDYASFAQFMSHESMQQTQSNQQHLQMIQPG
PPPPNMCHQQLPMLNTAWPSQLTNPTPTSSATTTGSFTTGPLASSKAAELVKQAGHQLEKMPRKTLSAEQKRAMC
QYHDDNPGTRQADIGAKFGVERSTVSKVLRHRDQYLKREQEPDFALKRAKGKHPDFDRTLSNYVRRQQQRGFDVK
DEGLMEQARLFARASGNQETLLNSLTTGWLHKFKLKHGIGLNNSNNNNNNNNNNNSNNSRRPSETSLTDERSVRK
STTSPVSPTLSPLSGSRSDEDAHHRDPLDFEMTFRRGGRRRSRSPAGSVTSPGGTISPAPAPFLTDYPAGDKKRS
KTFPSIDVSFARGDDGGHGLTASSPSSSVQSPAPPPPPLFLVPSPEVLPSLEEARVAAMTLLSYMQRAGGGRFDQ
GEFGVVGQVAKKLQLSQQGVAQQQQQQQQQQHHLYHFHHGGQRASMGGLSRIPEGDDRSPTTSTTTTTNNNNNTN
TTTTNTTQVR*
Coding >Ophun1|7518
ATGATGCATACGGACATGGACGGCTCGGCCGCCATGGACCCGGACTCGGCCATGGCGCAGTGTCACGGCTACGGA
GGCGAGAGCTGGGTCGATCTCAGCGCCTATCCAGGCACCTTCGACGACGGCACCATGGGAGACTATGCCTCGTTT
GCGCAATTCATGTCTCACGAGTCGATGCAGCAGACGCAGAGCAACCAGCAGCACCTCCAGATGATACAACCCGGC
CCTCCTCCGCCAAACATGTGCCACCAGCAGCTCCCCATGCTCAACACCGCCTGGCCCAGCCAGCTGACGAACCCG
ACGCCCACATCGTCGGCCACCACCACGGGAAGCTTCACCACCGGACCCCTGGCGTCGAGCAAGGCGGCCGAGCTG
GTCAAGCAGGCGGGCCACCAGCTGGAGAAGATGCCCCGCAAGACGCTGAGCGCGGAGCAGAAGCGAGCCATGTGT
CAATACCACGACGACAACCCGGGCACCCGACAGGCCGACATTGGGGCCAAGTTTGGCGTGGAGCGGAGCACCGTC
TCCAAGGTGCTGCGCCATCGCGATCAGTATCTGAAGCGCGAGCAGGAACCGGACTTTGCCCTCAAGCGCGCAAAG
GGAAAGCATCCGGACTTTGACCGTACGCTTAGCAACTACGTTCGCAGACAGCAGCAGAGGGGCTTTGATGTCAAG
GATGAAGGGTTGATGGAGCAGGCCAGGCTGTTTGCGCGGGCGAGTGGGAATCAGGAGACGTTGTTGAATAGTCTG
ACGACCGGCTGGCTACACAAGTTTAAGCTGAAGCACGGCATCGGCCTCAACAACAGCAACAACAACAACAACAAT
AACAACAATAACAACAGCAACAACAGCAGACGACCTTCGGAAACGAGCCTGACGGATGAACGATCGGTTCGAAAG
TCAACCACTTCGCCCGTCTCCCCCACGCTCTCCCCCCTTTCCGGCAGTCGAAGCGACGAAGACGCCCACCATCGC
GACCCCCTCGACTTTGAAATGACCTTCCGCCGAGGCGGCAGGCGAAGAAGCAGATCACCAGCCGGGAGCGTGACT
TCACCAGGCGGAACCATCAGTCCCGCCCCGGCCCCCTTCCTCACCGACTACCCAGCCGGCGACAAGAAGCGCAGC
AAGACATTCCCCTCGATCGACGTCAGTTTCGCGCGGGGGGACGACGGCGGGCACGGACTGACGGCGTCGTCGCCC
TCTTCGTCGGTGCAATCTCCAGCGCCGCCGCCGCCGCCCTTGTTTCTCGTGCCGTCGCCTGAGGTGCTGCCCTCG
CTTGAGGAGGCCAGGGTGGCGGCGATGACGCTGCTGAGTTATATGCAGAGGGCTGGCGGGGGGCGGTTCGATCAG
GGGGAGTTTGGGGTTGTTGGGCAGGTTGCTAAGAAGCTTCAGCTGTCGCAGCAGGGGGTTGCTCAGCAGCAGCAG
CAGCAGCAGCAGCAGCAGCATCATCTTTATCATTTTCATCATGGGGGGCAGAGGGCTTCGATGGGGGGGTTGAGT
CGGATACCCGAGGGTGACGACCGGTCACCTACAACCTCGACCACTACGACCACCAACAACAACAACAACACCAAC
ACCACCACCACCAACACCACACAAGTCCGCTGA
Transcript >Ophun1|7518
ATGATGCATACGGACATGGACGGCTCGGCCGCCATGGACCCGGACTCGGCCATGGCGCAGTGTCACGGCTACGGA
GGCGAGAGCTGGGTCGATCTCAGCGCCTATCCAGGCACCTTCGACGACGGCACCATGGGAGACTATGCCTCGTTT
GCGCAATTCATGTCTCACGAGTCGATGCAGCAGACGCAGAGCAACCAGCAGCACCTCCAGATGATACAACCCGGC
CCTCCTCCGCCAAACATGTGCCACCAGCAGCTCCCCATGCTCAACACCGCCTGGCCCAGCCAGCTGACGAACCCG
ACGCCCACATCGTCGGCCACCACCACGGGAAGCTTCACCACCGGACCCCTGGCGTCGAGCAAGGCGGCCGAGCTG
GTCAAGCAGGCGGGCCACCAGCTGGAGAAGATGCCCCGCAAGACGCTGAGCGCGGAGCAGAAGCGAGCCATGTGT
CAATACCACGACGACAACCCGGGCACCCGACAGGCCGACATTGGGGCCAAGTTTGGCGTGGAGCGGAGCACCGTC
TCCAAGGTGCTGCGCCATCGCGATCAGTATCTGAAGCGCGAGCAGGAACCGGACTTTGCCCTCAAGCGCGCAAAG
GGAAAGCATCCGGACTTTGACCGTACGCTTAGCAACTACGTTCGCAGACAGCAGCAGAGGGGCTTTGATGTCAAG
GATGAAGGGTTGATGGAGCAGGCCAGGCTGTTTGCGCGGGCGAGTGGGAATCAGGAGACGTTGTTGAATAGTCTG
ACGACCGGCTGGCTACACAAGTTTAAGCTGAAGCACGGCATCGGCCTCAACAACAGCAACAACAACAACAACAAT
AACAACAATAACAACAGCAACAACAGCAGACGACCTTCGGAAACGAGCCTGACGGATGAACGATCGGTTCGAAAG
TCAACCACTTCGCCCGTCTCCCCCACGCTCTCCCCCCTTTCCGGCAGTCGAAGCGACGAAGACGCCCACCATCGC
GACCCCCTCGACTTTGAAATGACCTTCCGCCGAGGCGGCAGGCGAAGAAGCAGATCACCAGCCGGGAGCGTGACT
TCACCAGGCGGAACCATCAGTCCCGCCCCGGCCCCCTTCCTCACCGACTACCCAGCCGGCGACAAGAAGCGCAGC
AAGACATTCCCCTCGATCGACGTCAGTTTCGCGCGGGGGGACGACGGCGGGCACGGACTGACGGCGTCGTCGCCC
TCTTCGTCGGTGCAATCTCCAGCGCCGCCGCCGCCGCCCTTGTTTCTCGTGCCGTCGCCTGAGGTGCTGCCCTCG
CTTGAGGAGGCCAGGGTGGCGGCGATGACGCTGCTGAGTTATATGCAGAGGGCTGGCGGGGGGCGGTTCGATCAG
GGGGAGTTTGGGGTTGTTGGGCAGGTTGCTAAGAAGCTTCAGCTGTCGCAGCAGGGGGTTGCTCAGCAGCAGCAG
CAGCAGCAGCAGCAGCAGCATCATCTTTATCATTTTCATCATGGGGGGCAGAGGGCTTCGATGGGGGGGTTGAGT
CGGATACCCGAGGGTGACGACCGGTCACCTACAACCTCGACCACTACGACCACCAACAACAACAACAACACCAAC
ACCACCACCACCAACACCACACAAGTCCGCTGA
Gene >Ophun1|7518
ATGATGCATACGGACATGGACGGCTCGGCCGCCATGGACCCGGACTCGGCCATGGCGCAGTGTCACGGCTACGGA
GGCGAGAGCTGGGTCGATCTCAGCGCCTATCCAGGCACCTTCGACGACGGCACCATGGGAGACTATGCCTCGTTT
GCGCAATTCATGTCTCACGAGTCGATGCAGCAGACGCAGAGCAACCAGCAGCACCTCCAGATGATACAACCCGGC
CCTCCTCCGCCAAACATGTGCCACCAGCAGCTCCCCATGCTCAACACCGCCTGGCCCAGCCAGCTGACGAACCCG
ACGCCCACATCGTCGGCCACCACCACGGGAAGCTTCACCACCGGACCCCTGGCGTCGAGCAAGGCGGCCGAGCTG
GTCAAGCAGGCGGGCCACCAGCTGGAGAAGATGCCCCGCAAGACGCTGAGCGCGGAGCAGAAGCGAGCCATGTGT
CAATACCACGACGACAACCCGGGCACCCGACAGGCCGACATTGGGGCCAAGTTTGGCGTGGAGCGGAGCACCGTC
TCCAAGGTGCTGCGCCATCGCGATCAGTATCTGAAGCGCGAGCAGGAACCGGACTTTGCCCTCAAGCGCGCAAAG
GGAAAGCATCCGGACTTTGACCGTACGCTTAGCAACTACGTTCGCAGACAGCAGCAGAGGGGCTTTGATGTCAAG
GATGAAGGGTTGATGGAGCAGGCCAGGCTGTTTGCGCGGGCGAGTGGGAATCAGGAGACGTTGTTGAATAGTCTG
ACGACCGGCTGGCTACACAAGTTTAAGCTGAAGCACGGCATCGGCCTCAACAACAGCAACAACAACAACAACAAT
AACAACAATAACAACAGCAACAACAGCAGACGACCTTCGGAAACGAGCCTGACGGATGAACGATCGGTTCGAAAG
TCAACCACTTCGCCCGTCTCCCCCACGCTCTCCCCCCTTTCCGGCAGTCGAAGCGACGAAGACGCCCACCATCGC
GACCCCCTCGACTTTGAAATGACCTTCCGCCGAGGCGGCAGGCGAAGAAGCAGATCACCAGCCGGGAGCGTGACT
TCACCAGGCGGAACCATCAGTCCCGCCCCGGCCCCCTTCCTCACCGACTACCCAGCCGGCGACAAGAAGCGCAGC
AAGACATTCCCCTCGATCGACGTCAGTTTCGCGCGGGGGGACGACGGCGGGCACGGACTGACGGCGTCGTCGCCC
TCTTCGTCGGTGCAATCTCCAGCGCCGCCGCCGCCGCCCTTGTTTCTCGTGCCGTCGCCTGAGGTGCTGCCCTCG
CTTGAGGAGGCCAGGGTGGCGGCGATGACGCTGCTGAGTTATATGCAGAGGGCTGGCGGGGGGCGGTTCGATCAG
GGGGAGTTTGGGGTTGTTGGGCAGGTTGCTAAGAAGCTTCAGCTGTCGCAGCAGGGGGTTGCTCAGCAGCAGCAG
CAGCAGCAGCAGCAGCAGCATCATCTTTATCATTTTCATCATGGGGGGCAGAGGGCTTCGATGGGGGGGTTGAGT
CGGATACCCGAGGGTGACGACCGGTCACCTACAACCTCGACCACTACGACCACCAACAACAACAACAACACCAAC
ACCACCACCACCAACACCACACAAGTCCGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail