Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7517
Gene name
LocationContig_96:36561..39409
Strand-
Gene length (bp)2848
Transcript length (bp)2619
Coding sequence length (bp)2619
Protein length (aa) 873

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04950 RIBIOP_C 40S ribosome biogenesis protein Tsr1 and BMS1 C-terminal 6.8E-97 520 794
PF08142 AARP2CN AARP2CN (NUC121) domain 1.5E-15 264 337

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13956|TSR1_SCHPO Ribosome biogenesis protein tsr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tsr1 PE=3 SV=1 41 797 6.0E-177
sp|Q07381|TSR1_YEAST Ribosome biogenesis protein TSR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TSR1 PE=1 SV=1 41 794 2.0E-155
sp|Q2NL82|TSR1_HUMAN Pre-rRNA-processing protein TSR1 homolog OS=Homo sapiens GN=TSR1 PE=1 SV=1 50 794 7.0E-93
sp|Q5SWD9|TSR1_MOUSE Pre-rRNA-processing protein TSR1 homolog OS=Mus musculus GN=Tsr1 PE=1 SV=1 68 794 6.0E-92
sp|Q5R434|TSR1_PONAB Pre-rRNA-processing protein TSR1 homolog OS=Pongo abelii GN=TSR1 PE=2 SV=1 50 794 1.0E-90
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13956|TSR1_SCHPO Ribosome biogenesis protein tsr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tsr1 PE=3 SV=1 41 797 6.0E-177
sp|Q07381|TSR1_YEAST Ribosome biogenesis protein TSR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TSR1 PE=1 SV=1 41 794 2.0E-155
sp|Q2NL82|TSR1_HUMAN Pre-rRNA-processing protein TSR1 homolog OS=Homo sapiens GN=TSR1 PE=1 SV=1 50 794 7.0E-93
sp|Q5SWD9|TSR1_MOUSE Pre-rRNA-processing protein TSR1 homolog OS=Mus musculus GN=Tsr1 PE=1 SV=1 68 794 6.0E-92
sp|Q5R434|TSR1_PONAB Pre-rRNA-processing protein TSR1 homolog OS=Pongo abelii GN=TSR1 PE=2 SV=1 50 794 1.0E-90
sp|Q5XGY1|TSR1_XENLA Pre-rRNA-processing protein TSR1 homolog OS=Xenopus laevis GN=tsr1 PE=2 SV=1 42 794 1.0E-90
sp|Q9VP47|TSR1_DROME Pre-rRNA-processing protein TSR1 homolog OS=Drosophila melanogaster GN=CG7338 PE=1 SV=1 51 794 9.0E-84
sp|Q61WR2|TSR1_CAEBR Pre-rRNA-processing protein TSR1 homolog OS=Caenorhabditis briggsae GN=tag-151 PE=3 SV=1 51 814 3.0E-75
sp|Q19329|TSR1_CAEEL Pre-rRNA-processing protein TSR1 homolog OS=Caenorhabditis elegans GN=tag-151 PE=3 SV=1 51 792 7.0E-73
sp|Q54YA7|TSR1_DICDI Pre-rRNA-processing protein TSR1 homolog OS=Dictyostelium discoideum GN=tsr1 PE=3 SV=1 505 793 2.0E-40
sp|O94653|BMS1_SCHPO Ribosome biogenesis protein bms1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bms1 PE=1 SV=2 578 797 2.0E-13
sp|Q08965|BMS1_YEAST Ribosome biogenesis protein BMS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BMS1 PE=1 SV=1 508 797 5.0E-13
sp|Q14692|BMS1_HUMAN Ribosome biogenesis protein BMS1 homolog OS=Homo sapiens GN=BMS1 PE=1 SV=1 582 797 8.0E-13
[Show less]

GO

GO Term Description Terminal node
GO:0005634 nucleus Yes
GO:0042254 ribosome biogenesis Yes
GO:0022613 ribonucleoprotein complex biogenesis No
GO:0043226 organelle No
GO:0043229 intracellular organelle No
GO:0044085 cellular component biogenesis No
GO:0071840 cellular component organization or biogenesis No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0043227 membrane-bounded organelle No
GO:0110165 cellular anatomical entity No
GO:0008150 biological_process No
GO:0043231 intracellular membrane-bounded organelle No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.45

Transmembrane Domains

Domain # Start End Length
1 684 703 19
2 832 854 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7517
MESYLFKAQRPASPSPLALASLPFRFKAGGEGKMPVAVTPHSHRPTTKVAHKPFKSKAASKHELRDRAKGRVPNE
RGQRKTPQQQVMSKLDRRNQAKQLRLSKHKEHVKETSIFSGRDGAPRIVSVIPLCADGDAKAAIHRLNDSLNIEA
SISDGSTRVSVDRFKQKIQYLPLTRELGSCLDAARVSDFVVVILSASEEVDALGELILRSVEGQGLSTLFTVVQG
IENVESAKQKHAVLGSLKSFITHFHPEQDKVYSLDSRQECSNLMRSLCSTTPKGVRWRDERSWMLADDVDVARDD
SDCTIITGVVRGRALNPDRLVQVGDWGAFRIRKIVAAPLQQHTKQGEAMVEDGDEEAVLAEPSGDQDDLEELAPD
DVLMDSHDGAESSVASTKKGVLLDDHHYFSDEVEEEAKRQMAKRRLPKGTSSYQAAWYLDDVSDSGSDLDDVEMG
EGDRSDEVIGAEDGIEGYAAPEPTEAGPSEYPQSVNMEVPDEADDAQQLARYRARKRDETDDKEFPDELELHPNV
VARERLARYRGLKSVRTSPWQEDEDRAHEPTWWRRLLQIPDYQASRSRATREALVGGVAAGTRVRVYVERVPAEA
RASWRPDRPLTVVGLLRHEHKKTAVNYLVNLSADSDSDESLKSKDEVIVQCGARRMTIRPILSQSGSTANDVHKY
CRFLHPGQSAIATFVGPVTWGAVPVLFFRRTSSGPDLKLIGTGTALPPSTCRVVAKRVILTGHPFHIHKKMVTVR
YMFFSREDVEWFKALPLWTRRGRSGFIKEALGTHGYFKATFDGRSTMGLDSTELSKLIPLFDKSHGLQLIPRTNL
NRILFNLLFNLLFNLLFNLLFNLLFNLLFNRILLNPFFTPPTPPTHP*
Coding >Ophun1|7517
ATGGAATCATACCTGTTCAAAGCACAAAGACCAGCATCGCCGTCGCCTCTCGCCCTGGCTTCTCTTCCTTTCAGG
TTCAAGGCAGGCGGAGAGGGAAAGATGCCTGTCGCCGTGACGCCTCACTCGCACCGCCCTACCACAAAGGTGGCG
CATAAGCCGTTCAAGTCCAAGGCTGCGTCTAAGCACGAGCTGAGGGACCGGGCCAAAGGCCGAGTCCCCAATGAG
CGCGGTCAGCGAAAGACGCCGCAGCAGCAGGTCATGTCCAAGCTCGATAGGCGCAACCAGGCCAAGCAGCTCCGG
CTGTCCAAGCACAAGGAGCACGTCAAAGAGACGTCCATATTCTCTGGTCGTGACGGGGCGCCTCGTATTGTCAGC
GTCATTCCTCTGTGCGCCGATGGCGATGCCAAGGCTGCTATTCACCGTCTGAACGACAGCCTGAATATCGAAGCC
AGTATCTCCGACGGCAGCACGCGAGTCTCGGTCGACCGCTTCAAGCAGAAGATACAATATCTACCGCTTACTCGA
GAGCTCGGCTCATGTCTAGACGCTGCGCGAGTGTCTGATTTCGTCGTCGTCATTCTGTCCGCCAGTGAAGAAGTC
GATGCCCTTGGAGAGCTCATCCTCCGCAGTGTCGAGGGCCAGGGGCTTTCGACTCTCTTCACCGTGGTTCAGGGC
ATTGAAAACGTCGAGTCTGCGAAGCAGAAGCACGCCGTTCTCGGCTCCCTCAAGTCCTTCATCACACACTTTCAC
CCAGAGCAGGATAAAGTGTACAGCTTGGACAGCCGACAAGAGTGCTCCAACCTGATGCGTTCCCTCTGCAGCACG
ACGCCCAAGGGAGTGAGGTGGAGGGACGAAAGGAGCTGGATGCTGGCCGATGACGTTGACGTCGCCCGCGACGAT
TCTGATTGTACAATCATAACGGGCGTGGTTCGAGGCCGTGCGCTGAATCCGGATCGCTTGGTCCAAGTCGGCGAC
TGGGGCGCCTTTAGGATTCGCAAGATTGTCGCCGCCCCTTTGCAGCAGCACACGAAGCAGGGCGAGGCCATGGTT
GAGGACGGAGACGAGGAGGCTGTTCTGGCCGAACCGTCCGGAGATCAGGATGATCTGGAAGAGCTGGCGCCTGAC
GACGTCTTGATGGATTCGCACGATGGTGCTGAATCGTCTGTCGCTTCAACAAAGAAGGGCGTGCTTCTCGATGAT
CACCATTACTTCTCCGACGAGGTGGAAGAGGAGGCCAAGAGACAGATGGCCAAGAGGCGGCTGCCCAAGGGTACG
TCAAGCTACCAGGCAGCGTGGTATCTCGACGACGTTTCGGATTCCGGCTCCGACCTGGACGATGTCGAGATGGGC
GAAGGCGATAGATCCGACGAGGTGATTGGCGCCGAGGACGGCATCGAAGGCTACGCGGCGCCCGAGCCTACAGAA
GCCGGCCCATCGGAGTATCCCCAGTCGGTCAACATGGAGGTGCCAGACGAGGCCGACGACGCCCAGCAGCTGGCC
CGATACCGAGCCCGCAAGCGAGACGAGACGGACGACAAGGAGTTTCCTGACGAACTGGAACTGCACCCCAACGTG
GTGGCGCGGGAGCGGCTGGCGCGGTATCGAGGCCTCAAGAGCGTGCGGACGAGCCCCTGGCAAGAGGACGAAGAC
CGGGCGCACGAGCCGACGTGGTGGAGGCGACTTCTCCAGATCCCCGACTATCAGGCATCGCGGTCGCGGGCGACT
CGCGAGGCCTTGGTCGGGGGCGTCGCGGCCGGCACCCGGGTCCGGGTCTACGTCGAGCGGGTGCCGGCCGAGGCG
CGGGCATCGTGGCGTCCGGACCGTCCGCTGACCGTGGTCGGGCTGCTCCGGCACGAGCACAAGAAGACGGCCGTC
AACTACCTCGTCAACCTGTCCGCCGATTCCGACTCGGACGAATCGCTCAAGTCCAAAGACGAGGTCATTGTGCAG
TGCGGCGCGCGACGAATGACGATCCGACCCATCCTCTCGCAATCCGGCTCGACAGCCAACGACGTGCACAAATAC
TGCCGCTTCCTCCACCCAGGCCAATCAGCCATAGCAACCTTCGTCGGCCCCGTAACATGGGGCGCCGTCCCCGTC
CTCTTCTTCCGGCGGACGTCGTCAGGCCCGGACTTGAAGCTGATAGGCACCGGCACCGCTCTCCCGCCTTCGACA
TGCCGCGTGGTGGCCAAGCGCGTCATCCTGACGGGCCACCCCTTTCACATCCATAAGAAGATGGTGACGGTGCGG
TACATGTTCTTTAGCCGCGAGGATGTGGAGTGGTTCAAGGCGCTGCCGCTTTGGACGAGGAGGGGGAGGTCTGGC
TTTATCAAGGAGGCGCTGGGGACGCATGGGTATTTCAAGGCTACGTTTGATGGGAGGAGTACGATGGGCCTAGAC
TCGACAGAGCTATCCAAGTTGATCCCCCTATTCGATAAGAGCCATGGTCTACAACTCATCCCTCGAACCAACTTG
AACCGCATCCTCTTCAACCTCCTCTTCAACCTCCTCTTCAACCTCCTCTTCAACCTCCTCTTCAACCTCCTCTTC
AACCTCCTCTTCAACCGTATCCTCCTCAACCCATTCTTCACCCCCCCAACCCCTCCAACCCATCCGTAG
Transcript >Ophun1|7517
ATGGAATCATACCTGTTCAAAGCACAAAGACCAGCATCGCCGTCGCCTCTCGCCCTGGCTTCTCTTCCTTTCAGG
TTCAAGGCAGGCGGAGAGGGAAAGATGCCTGTCGCCGTGACGCCTCACTCGCACCGCCCTACCACAAAGGTGGCG
CATAAGCCGTTCAAGTCCAAGGCTGCGTCTAAGCACGAGCTGAGGGACCGGGCCAAAGGCCGAGTCCCCAATGAG
CGCGGTCAGCGAAAGACGCCGCAGCAGCAGGTCATGTCCAAGCTCGATAGGCGCAACCAGGCCAAGCAGCTCCGG
CTGTCCAAGCACAAGGAGCACGTCAAAGAGACGTCCATATTCTCTGGTCGTGACGGGGCGCCTCGTATTGTCAGC
GTCATTCCTCTGTGCGCCGATGGCGATGCCAAGGCTGCTATTCACCGTCTGAACGACAGCCTGAATATCGAAGCC
AGTATCTCCGACGGCAGCACGCGAGTCTCGGTCGACCGCTTCAAGCAGAAGATACAATATCTACCGCTTACTCGA
GAGCTCGGCTCATGTCTAGACGCTGCGCGAGTGTCTGATTTCGTCGTCGTCATTCTGTCCGCCAGTGAAGAAGTC
GATGCCCTTGGAGAGCTCATCCTCCGCAGTGTCGAGGGCCAGGGGCTTTCGACTCTCTTCACCGTGGTTCAGGGC
ATTGAAAACGTCGAGTCTGCGAAGCAGAAGCACGCCGTTCTCGGCTCCCTCAAGTCCTTCATCACACACTTTCAC
CCAGAGCAGGATAAAGTGTACAGCTTGGACAGCCGACAAGAGTGCTCCAACCTGATGCGTTCCCTCTGCAGCACG
ACGCCCAAGGGAGTGAGGTGGAGGGACGAAAGGAGCTGGATGCTGGCCGATGACGTTGACGTCGCCCGCGACGAT
TCTGATTGTACAATCATAACGGGCGTGGTTCGAGGCCGTGCGCTGAATCCGGATCGCTTGGTCCAAGTCGGCGAC
TGGGGCGCCTTTAGGATTCGCAAGATTGTCGCCGCCCCTTTGCAGCAGCACACGAAGCAGGGCGAGGCCATGGTT
GAGGACGGAGACGAGGAGGCTGTTCTGGCCGAACCGTCCGGAGATCAGGATGATCTGGAAGAGCTGGCGCCTGAC
GACGTCTTGATGGATTCGCACGATGGTGCTGAATCGTCTGTCGCTTCAACAAAGAAGGGCGTGCTTCTCGATGAT
CACCATTACTTCTCCGACGAGGTGGAAGAGGAGGCCAAGAGACAGATGGCCAAGAGGCGGCTGCCCAAGGGTACG
TCAAGCTACCAGGCAGCGTGGTATCTCGACGACGTTTCGGATTCCGGCTCCGACCTGGACGATGTCGAGATGGGC
GAAGGCGATAGATCCGACGAGGTGATTGGCGCCGAGGACGGCATCGAAGGCTACGCGGCGCCCGAGCCTACAGAA
GCCGGCCCATCGGAGTATCCCCAGTCGGTCAACATGGAGGTGCCAGACGAGGCCGACGACGCCCAGCAGCTGGCC
CGATACCGAGCCCGCAAGCGAGACGAGACGGACGACAAGGAGTTTCCTGACGAACTGGAACTGCACCCCAACGTG
GTGGCGCGGGAGCGGCTGGCGCGGTATCGAGGCCTCAAGAGCGTGCGGACGAGCCCCTGGCAAGAGGACGAAGAC
CGGGCGCACGAGCCGACGTGGTGGAGGCGACTTCTCCAGATCCCCGACTATCAGGCATCGCGGTCGCGGGCGACT
CGCGAGGCCTTGGTCGGGGGCGTCGCGGCCGGCACCCGGGTCCGGGTCTACGTCGAGCGGGTGCCGGCCGAGGCG
CGGGCATCGTGGCGTCCGGACCGTCCGCTGACCGTGGTCGGGCTGCTCCGGCACGAGCACAAGAAGACGGCCGTC
AACTACCTCGTCAACCTGTCCGCCGATTCCGACTCGGACGAATCGCTCAAGTCCAAAGACGAGGTCATTGTGCAG
TGCGGCGCGCGACGAATGACGATCCGACCCATCCTCTCGCAATCCGGCTCGACAGCCAACGACGTGCACAAATAC
TGCCGCTTCCTCCACCCAGGCCAATCAGCCATAGCAACCTTCGTCGGCCCCGTAACATGGGGCGCCGTCCCCGTC
CTCTTCTTCCGGCGGACGTCGTCAGGCCCGGACTTGAAGCTGATAGGCACCGGCACCGCTCTCCCGCCTTCGACA
TGCCGCGTGGTGGCCAAGCGCGTCATCCTGACGGGCCACCCCTTTCACATCCATAAGAAGATGGTGACGGTGCGG
TACATGTTCTTTAGCCGCGAGGATGTGGAGTGGTTCAAGGCGCTGCCGCTTTGGACGAGGAGGGGGAGGTCTGGC
TTTATCAAGGAGGCGCTGGGGACGCATGGGTATTTCAAGGCTACGTTTGATGGGAGGAGTACGATGGGCCTAGAC
TCGACAGAGCTATCCAAGTTGATCCCCCTATTCGATAAGAGCCATGGTCTACAACTCATCCCTCGAACCAACTTG
AACCGCATCCTCTTCAACCTCCTCTTCAACCTCCTCTTCAACCTCCTCTTCAACCTCCTCTTCAACCTCCTCTTC
AACCTCCTCTTCAACCGTATCCTCCTCAACCCATTCTTCACCCCCCCAACCCCTCCAACCCATCCGTAG
Gene >Ophun1|7517
ATGGAATCATACCTGTTCAAAGCACAAAGACCAGCATCGCCGTCGCCTCTCGCCCTGGCTTCTCTTCCTTTCAGG
TTCAAGGCAGGCGGAGAGGGAAAGATGCCTGTCGCCGTGACGCCTCACTCGCACCGCCCTACCACAAAGGTGGCG
CATAAGCCGTTCAAGTCCAAGGCTGCGTCTAAGCACGAGCTGAGGGACCGGGCCAAAGGTTCATGATGCTGCCTG
GTTGCGCTTCCGCGGGACTCGGCTAACATCAGCTCGATTCTCGCAGGCCGAGTCCCCAATGAGCGCGGTCAGCGA
AAGACGCCGCAGCAGCAGGTCATGTCCAAGCTCGATAGGCGCAACCAGGCCAAGCAGCTCCGGCTGTCCAAGCAC
AAGGAGCACGTCAAAGAGACGTCCATATTCTCTGGTCGTGACGGGGCGCCTCGTATTGTCAGCGTCATTCCTCTG
TGCGCCGATGGCGATGCCAAGGCTGCTATTCACCGTCTGAACGACAGCCTGAATATCGAAGCCAGTATCTCCGAC
GGCAGCACGCGAGTCTCGGTCGACCGCTTCAAGCAGAAGATACAATATCTACCGCTTACTCGAGAGCTCGGCTCA
TGTCTAGACGCTGCGCGAGTGTCTGATTTCGTCGTCGTCATTCTGTCCGCCAGTGAAGAAGTCGATGCCCTTGGA
GAGCTCATCCTCCGCAGTGTCGAGGGCCAGGGGCTTTCGACTCTCTTCACCGTGGTTCAGGGCATTGAAAACGTC
GAGTCTGCGAAGCAGAAGCACGCCGTTCTCGGCTCCCTCAAGTCCTTCATCACACACTTTCACCCAGAGCAGGAT
AAAGTGTACAGCTTGGACAGCCGACAAGAGTGCTCCAACCTGATGCGTTCCCTCTGCAGCACGACGCCCAAGGGA
GTGAGGTGGAGGGACGAAAGGAGCTGGATGCTGGCCGATGACGTTGACGTCGCCCGCGACGATTCTGATTGTACA
ATCATAACGGGCGTGGTTCGAGGCCGTGCGCTGAATCCGGATCGCTTGGTCCAAGTCGGCGACTGGGGCGCCTTT
AGGATTCGCAAGATTGTCGCCGCCCCTTTGCAGCAGCACACGAAGCAGGGCGAGGCCATGGTTGAGGACGGAGAC
GAGGAGGCTGTTCTGGCCGAACCGTCCGGAGATCAGGATGATCTGGAAGAGCTGGCGCCTGACGACGTCTTGATG
GATTCGCACGATGGTGCTGAATCGTCTGTCGCTTCAACAAAGAAGGGCGTGCTTCTCGATGATCACCATTACTTC
TCCGACGAGGTGGAAGAGGAGGCCAAGAGACAGATGGCCAAGAGGCGGCTGCCCAAGGGTACGTCAAGCTACCAG
GCAGCGTGGTATCTCGACGACGTTTCGGATTCCGGCTCCGACCTGGACGATGTCGAGATGGGCGAAGGCGATAGA
TCCGACGAGGTGATTGGCGCCGAGGACGGCATCGAAGGCTACGCGGCGCCCGAGCCTACAGAAGCCGGCCCATCG
GAGTATCCCCAGTCGGTCAACATGGAGGTGCCAGACGAGGCCGACGACGCCCAGCAGCTGGCCCGATACCGAGCC
CGCAAGCGAGACGAGACGGACGACAAGGAGTTTCCTGACGAACTGGAACTGCACCCCAACGTGGTGGCGCGGGAG
CGGCTGGCGCGGTATCGAGGCCTCAAGAGCGTGCGGACGAGCCCCTGGCAAGAGGACGAAGACCGGGCGCACGAG
CCGACGTGGTGGAGGCGACTTCTCCAGATCCCCGACTATCAGGCATCGCGGTCGCGGGCGACTCGCGAGGCCTTG
GTCGGGGGCGTCGCGGCCGGCACCCGGGTCCGGGTCTACGTCGAGCGGGTGCCGGCCGAGGCGCGGGCATCGTGG
CGTCCGGACCGTCCGCTGACCGTGGTCGGGCTGCTCCGGCACGAGCACAAGAAGACGGCCGTCAACTACCTCGTC
AACCTGTCCGCCGATTCCGACTCGGACGAATCGCTCAAGTCCAAAGACGAGGTCATTGTGCAGTGCGGCGCGCGA
CGAATGACGATCCGACCCATCCTCTCGCAATCCGGCTCGACAGCCAACGACGTGCACAAATACTGCCGCTTCCTC
CACCCAGGCCAATCAGCCATAGCAACCTTCGTCGGCCCCGTAACATGGGGCGCCGTCCCCGTCCTCTTCTTCCGG
CGGACGTCGTCAGGCCCGGACTTGAAGCTGATAGGCACCGGCACCGCTCTCCCGCCTTCGACATGCCGCGTGGTG
GCCAAGCGCGTCATCCTGACGGGCCACCCCTTTCACATCCATAAGAAGATGGTGACGGTGCGGTACATGTTCTTT
AGCCGCGAGGATGTGGAGTGGTTCAAGGCGCTGCCGCTTTGGACGAGGAGGGGGAGGTCTGGCTTTATCAAGGAG
GCGCTGGGGACGCATGGGTATTTCAAGGCTACGTTTGATGGGAGGGTGAATCCTCAGGACGCGGTGGGGGTTAGT
CTGTATAAGCGGGTTTGGCCGCGGGAGGCGGTCATGGGAGGGATGTCTTTGATGGGTTGACGAGACTGCAACTAA
GCCAGAGCTGTCAAGTTGAAACCCCTGTTCGAGATAAACCCCTGTTCGAGAAAGGCCACAGAGTACGATGGGCCT
AGACTCGACAGAGCTATCCAAGTTGATCCCCCTATTCGATAAGAGCCATGGTCTACAACTCATCCCTCGAACCAA
CTTGAACCGCATCCTCTTCAACCTCCTCTTCAACCTCCTCTTCAACCTCCTCTTCAACCTCCTCTTCAACCTCCT
CTTCAACCTCCTCTTCAACCGTATCCTCCTCAACCCATTCTTCACCCCCCCAACCCCTCCAACCCATCCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail