Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7516
Gene name
LocationContig_96:34269..36529
Strand+
Gene length (bp)2260
Transcript length (bp)1797
Coding sequence length (bp)1797
Protein length (aa) 599

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02492 cobW CobW/HypB/UreG, nucleotide-binding domain 2.9E-32 418 585

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q96WV0|UREG_SCHPO Uncharacterized urease accessory protein ureG-like OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCPB16A4.05c PE=3 SV=1 383 597 1.0E-104
sp|E0ZS47|UREG_ORYSI Urease accessory protein G OS=Oryza sativa subsp. indica GN=UREG PE=2 SV=1 387 596 1.0E-99
sp|O64700|UREG_ARATH Urease accessory protein G OS=Arabidopsis thaliana GN=UREG PE=2 SV=1 387 596 2.0E-99
sp|Q6AUF3|UREG_ORYSJ Urease accessory protein G OS=Oryza sativa subsp. japonica GN=UREG PE=2 SV=1 387 596 9.0E-99
sp|A9GP90|UREG_SORC5 Urease accessory protein UreG OS=Sorangium cellulosum (strain So ce56) GN=ureG PE=3 SV=1 395 592 4.0E-92
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q96WV0|UREG_SCHPO Uncharacterized urease accessory protein ureG-like OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCPB16A4.05c PE=3 SV=1 383 597 1.0E-104
sp|E0ZS47|UREG_ORYSI Urease accessory protein G OS=Oryza sativa subsp. indica GN=UREG PE=2 SV=1 387 596 1.0E-99
sp|O64700|UREG_ARATH Urease accessory protein G OS=Arabidopsis thaliana GN=UREG PE=2 SV=1 387 596 2.0E-99
sp|Q6AUF3|UREG_ORYSJ Urease accessory protein G OS=Oryza sativa subsp. japonica GN=UREG PE=2 SV=1 387 596 9.0E-99
sp|A9GP90|UREG_SORC5 Urease accessory protein UreG OS=Sorangium cellulosum (strain So ce56) GN=ureG PE=3 SV=1 395 592 4.0E-92
sp|A7HHN3|UREG_ANADF Urease accessory protein UreG OS=Anaeromyxobacter sp. (strain Fw109-5) GN=ureG PE=3 SV=1 386 596 1.0E-83
sp|Q11VN1|UREG_CYTH3 Urease accessory protein UreG OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=ureG PE=3 SV=1 392 596 1.0E-83
sp|P72955|UREG_SYNY3 Urease accessory protein UreG OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ureG PE=3 SV=1 418 597 6.0E-76
sp|Q1H0F5|UREG_METFK Urease accessory protein UreG OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=ureG PE=3 SV=1 418 597 4.0E-74
sp|Q8DMQ4|UREG_THEEB Urease accessory protein UreG OS=Thermosynechococcus elongatus (strain BP-1) GN=ureG PE=3 SV=1 418 597 6.0E-74
sp|Q9HUS0|UREG_PSEAE Urease accessory protein UreG OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=ureG PE=3 SV=1 411 597 7.0E-74
sp|Q02FC5|UREG_PSEAB Urease accessory protein UreG OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=ureG PE=3 SV=1 411 597 7.0E-74
sp|B7V1V6|UREG_PSEA8 Urease accessory protein UreG OS=Pseudomonas aeruginosa (strain LESB58) GN=ureG PE=3 SV=1 411 597 7.0E-74
sp|A1KBB1|UREG_AZOSB Urease accessory protein UreG OS=Azoarcus sp. (strain BH72) GN=ureG PE=3 SV=1 413 598 9.0E-74
sp|C1DMZ7|UREG_AZOVD Urease accessory protein UreG OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=ureG PE=3 SV=1 411 597 9.0E-74
sp|A4VQW0|UREG_PSEU5 Urease accessory protein UreG OS=Pseudomonas stutzeri (strain A1501) GN=ureG PE=3 SV=1 411 597 1.0E-73
sp|Q6FD79|UREG_ACIAD Urease accessory protein UreG OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=ureG PE=3 SV=1 418 592 2.0E-73
sp|B0V9P2|UREG_ACIBY Urease accessory protein UreG OS=Acinetobacter baumannii (strain AYE) GN=ureG PE=3 SV=1 418 592 3.0E-73
sp|A3M3F5|UREG_ACIBT Urease accessory protein UreG OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=ureG PE=3 SV=2 418 592 3.0E-73
sp|B0VSB5|UREG_ACIBS Urease accessory protein UreG OS=Acinetobacter baumannii (strain SDF) GN=ureG PE=3 SV=1 418 592 3.0E-73
sp|B2HVS4|UREG_ACIBC Urease accessory protein UreG OS=Acinetobacter baumannii (strain ACICU) GN=ureG PE=3 SV=1 418 592 3.0E-73
sp|B7I8T8|UREG_ACIB5 Urease accessory protein UreG OS=Acinetobacter baumannii (strain AB0057) GN=ureG PE=3 SV=1 418 592 3.0E-73
sp|B7GXU0|UREG_ACIB3 Urease accessory protein UreG OS=Acinetobacter baumannii (strain AB307-0294) GN=ureG PE=3 SV=1 418 592 3.0E-73
sp|B4RSY2|UREG_ALTMD Urease accessory protein UreG OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=ureG PE=3 SV=1 414 592 3.0E-73
sp|A1SYY4|UREG_PSYIN Urease accessory protein UreG OS=Psychromonas ingrahamii (strain 37) GN=ureG PE=3 SV=1 418 592 4.0E-73
sp|A4XQ16|UREG_PSEMY Urease accessory protein UreG OS=Pseudomonas mendocina (strain ymp) GN=ureG PE=3 SV=1 411 597 9.0E-73
sp|Q2SDP8|UREG_HAHCH Urease accessory protein UreG OS=Hahella chejuensis (strain KCTC 2396) GN=ureG PE=3 SV=1 411 597 1.0E-72
sp|A6VD02|UREG_PSEA7 Urease accessory protein UreG OS=Pseudomonas aeruginosa (strain PA7) GN=ureG PE=3 SV=1 411 597 2.0E-72
sp|B8EPU6|UREG_METSB Urease accessory protein UreG OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=ureG PE=3 SV=1 416 596 7.0E-72
sp|Q826R7|UREG_STRAW Urease accessory protein UreG OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ureG PE=3 SV=1 384 592 2.0E-71
sp|Q3AVR7|UREG_SYNS9 Urease accessory protein UreG OS=Synechococcus sp. (strain CC9902) GN=ureG PE=3 SV=1 418 597 4.0E-71
sp|B8IJ81|UREG_METNO Urease accessory protein UreG OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=ureG PE=3 SV=1 418 596 5.0E-71
sp|Q5YWQ4|UREG_NOCFA Urease accessory protein UreG OS=Nocardia farcinica (strain IFM 10152) GN=ureG PE=3 SV=1 418 588 6.0E-71
sp|Q0AC95|UREG_ALKEH Urease accessory protein UreG OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=ureG PE=3 SV=1 415 597 7.0E-71
sp|Q3J773|UREG_NITOC Urease accessory protein UreG OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=ureG PE=3 SV=1 411 597 2.0E-70
sp|Q7U3I9|UREG_SYNPX Urease accessory protein UreG OS=Synechococcus sp. (strain WH8102) GN=ureG PE=3 SV=1 413 597 2.0E-70
sp|B0UBI3|UREG_METS4 Urease accessory protein UreG OS=Methylobacterium sp. (strain 4-46) GN=ureG PE=3 SV=1 418 596 4.0E-70
sp|Q0S4S5|UREG_RHOJR Urease accessory protein UreG OS=Rhodococcus jostii (strain RHA1) GN=ureG PE=3 SV=1 418 588 1.0E-69
sp|Q0I662|UREG_SYNS3 Urease accessory protein UreG OS=Synechococcus sp. (strain CC9311) GN=ureG PE=3 SV=1 413 592 2.0E-69
sp|A3N2R0|UREG_ACTP2 Urease accessory protein UreG OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=ureG PE=3 SV=1 418 598 2.0E-69
sp|B1M3X4|UREG1_METRJ Urease accessory protein UreG 1 OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=ureG1 PE=3 SV=1 418 596 2.0E-69
sp|P44396|UREG_HAEIN Urease accessory protein UreG OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=ureG PE=3 SV=1 409 598 4.0E-69
sp|Q93PJ0|UREG_HELHP Urease accessory protein UreG OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=ureG PE=3 SV=1 418 596 5.0E-69
sp|O54424|UREG_ACTPL Urease accessory protein UreG OS=Actinobacillus pleuropneumoniae GN=ureG PE=3 SV=1 418 598 6.0E-69
sp|B0BRT8|UREG_ACTPJ Urease accessory protein UreG OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=ureG PE=3 SV=1 418 597 7.0E-69
sp|B3H2K9|UREG_ACTP7 Urease accessory protein UreG OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=ureG PE=3 SV=1 418 598 8.0E-69
sp|B1ZHN6|UREG1_METPB Urease accessory protein UreG 1 OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=ureG1 PE=3 SV=1 418 596 8.0E-69
sp|A2CDZ5|UREG_PROM3 Urease accessory protein UreG OS=Prochlorococcus marinus (strain MIT 9303) GN=ureG PE=3 SV=1 413 597 9.0E-69
sp|B1MB87|UREG_MYCA9 Urease accessory protein UreG OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=ureG PE=3 SV=1 418 588 1.0E-68
sp|Q3AGD6|UREG_SYNSC Urease accessory protein UreG OS=Synechococcus sp. (strain CC9605) GN=ureG PE=3 SV=1 413 597 1.0E-68
sp|C1AXZ4|UREG_RHOOB Urease accessory protein UreG OS=Rhodococcus opacus (strain B4) GN=ureG PE=3 SV=1 418 588 1.0E-68
sp|Q4QN12|UREG_HAEI8 Urease accessory protein UreG OS=Haemophilus influenzae (strain 86-028NP) GN=ureG PE=3 SV=1 409 598 1.0E-68
sp|B1W5H1|UREG1_STRGG Urease accessory protein UreG 1 OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=ureG1 PE=3 SV=1 386 596 2.0E-68
sp|Q47G58|UREG_DECAR Urease accessory protein UreG OS=Dechloromonas aromatica (strain RCB) GN=ureG PE=3 SV=1 411 597 2.0E-68
sp|Q07QT9|UREG_RHOP5 Urease accessory protein UreG OS=Rhodopseudomonas palustris (strain BisA53) GN=ureG PE=3 SV=1 418 597 2.0E-68
sp|Q7V3V8|UREG_PROMM Urease accessory protein UreG OS=Prochlorococcus marinus (strain MIT 9313) GN=ureG PE=3 SV=1 413 597 2.0E-68
sp|A9W6X0|UREG1_METEP Urease accessory protein UreG 1 OS=Methylobacterium extorquens (strain PA1) GN=ureG1 PE=3 SV=1 418 596 3.0E-68
sp|B2HSZ4|UREG_MYCMM Urease accessory protein UreG OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=ureG PE=3 SV=1 418 588 4.0E-68
sp|Q92MY5|UREG_RHIME Urease accessory protein UreG OS=Rhizobium meliloti (strain 1021) GN=ureG PE=3 SV=1 418 596 6.0E-68
sp|Q13BD7|UREG_RHOPS Urease accessory protein UreG OS=Rhodopseudomonas palustris (strain BisB5) GN=ureG PE=3 SV=1 418 592 8.0E-68
sp|A0PSG0|UREG_MYCUA Urease accessory protein UreG OS=Mycobacterium ulcerans (strain Agy99) GN=ureG PE=3 SV=1 418 588 9.0E-68
sp|Q09066|UREG_HELPY Urease accessory protein UreG OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=ureG PE=1 SV=2 418 597 2.0E-67
sp|Q1CV86|UREG_HELPH Urease accessory protein UreG OS=Helicobacter pylori (strain HPAG1) GN=ureG PE=3 SV=1 418 597 2.0E-67
sp|B5Z671|UREG_HELPG Urease accessory protein UreG OS=Helicobacter pylori (strain G27) GN=ureG PE=3 SV=1 418 597 2.0E-67
sp|Q9FAS2|UREG_VIBPH Urease accessory protein UreG OS=Vibrio parahaemolyticus GN=ureG PE=3 SV=1 418 597 2.0E-67
sp|B2UW65|UREG_HELPS Urease accessory protein UreG OS=Helicobacter pylori (strain Shi470) GN=ureG PE=3 SV=1 418 597 2.0E-67
sp|Q9ZMZ7|UREG_HELPJ Urease accessory protein UreG OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=ureG PE=3 SV=1 418 597 2.0E-67
sp|Q17VS2|UREG_HELAH Urease accessory protein UreG OS=Helicobacter acinonychis (strain Sheeba) GN=ureG PE=3 SV=1 418 597 2.0E-67
sp|B6JPH1|UREG_HELP2 Urease accessory protein UreG OS=Helicobacter pylori (strain P12) GN=ureG PE=3 SV=1 418 597 3.0E-67
sp|A6VTW1|UREG_MARMS Urease accessory protein UreG OS=Marinomonas sp. (strain MWYL1) GN=ureG PE=3 SV=1 418 597 3.0E-67
sp|B3Q6Q0|UREG_RHOPT Urease accessory protein UreG OS=Rhodopseudomonas palustris (strain TIE-1) GN=ureG PE=3 SV=1 418 592 5.0E-67
sp|Q6N223|UREG_RHOPA Urease accessory protein UreG OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=ureG PE=3 SV=1 418 592 5.0E-67
sp|A6UC29|UREG_SINMW Urease accessory protein UreG OS=Sinorhizobium medicae (strain WSM419) GN=ureG PE=3 SV=1 418 596 6.0E-67
sp|P9WFE3|UREG_MYCTU Urease accessory protein UreG OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ureG PE=1 SV=1 418 588 6.0E-67
sp|P9WFE2|UREG_MYCTO Urease accessory protein UreG OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ureG PE=3 SV=1 418 588 6.0E-67
sp|A5U3L9|UREG_MYCTA Urease accessory protein UreG OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=ureG PE=3 SV=1 418 588 6.0E-67
sp|C1APC9|UREG_MYCBT Urease accessory protein UreG OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=ureG PE=3 SV=1 418 588 6.0E-67
sp|A1KJR4|UREG_MYCBP Urease accessory protein UreG OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=ureG PE=3 SV=1 418 588 6.0E-67
sp|P0A665|UREG_MYCBO Urease accessory protein UreG OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ureG PE=3 SV=1 418 588 6.0E-67
sp|A2C4R6|UREG_PROM1 Urease accessory protein UreG OS=Prochlorococcus marinus (strain NATL1A) GN=ureG PE=3 SV=1 418 596 9.0E-67
sp|C3MGH8|UREG_RHISN Urease accessory protein UreG OS=Rhizobium sp. (strain NGR234) GN=ureG PE=3 SV=1 418 596 9.0E-67
sp|Q46IY9|UREG_PROMT Urease accessory protein UreG OS=Prochlorococcus marinus (strain NATL2A) GN=ureG PE=3 SV=1 418 596 9.0E-67
sp|A9BUC1|UREG_DELAS Urease accessory protein UreG OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=ureG PE=3 SV=1 418 597 2.0E-66
sp|B5FBC3|UREG_VIBFM Urease accessory protein UreG OS=Vibrio fischeri (strain MJ11) GN=ureG PE=3 SV=1 418 597 2.0E-66
sp|A6SZ10|UREG_JANMA Urease accessory protein UreG OS=Janthinobacterium sp. (strain Marseille) GN=ureG PE=3 SV=1 418 596 2.0E-66
sp|A4FCP1|UREG2_SACEN Urease accessory protein UreG 2 OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=ureG2 PE=3 SV=1 410 596 2.0E-66
sp|C3K4L3|UREG_PSEFS Urease accessory protein UreG OS=Pseudomonas fluorescens (strain SBW25) GN=ureG PE=3 SV=1 411 597 2.0E-66
sp|A3PCN5|UREG_PROM0 Urease accessory protein UreG OS=Prochlorococcus marinus (strain MIT 9301) GN=ureG PE=3 SV=1 413 596 3.0E-66
sp|Q9L638|UREG_PROS9 Urease accessory protein UreG OS=Prochlorococcus marinus subsp. pastoris (strain PCC 9511) GN=ureG PE=3 SV=1 413 596 3.0E-66
sp|Q7V1B0|UREG_PROMP Urease accessory protein UreG OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=ureG PE=3 SV=1 413 596 3.0E-66
sp|Q2J0B6|UREG_RHOP2 Urease accessory protein UreG OS=Rhodopseudomonas palustris (strain HaA2) GN=ureG PE=3 SV=1 418 592 4.0E-66
sp|A8G4K3|UREG_PROM2 Urease accessory protein UreG OS=Prochlorococcus marinus (strain MIT 9215) GN=ureG PE=3 SV=1 413 596 4.0E-66
sp|Q31B55|UREG_PROM9 Urease accessory protein UreG OS=Prochlorococcus marinus (strain MIT 9312) GN=ureG PE=3 SV=1 413 596 4.0E-66
sp|Q20Z78|UREG_RHOPB Urease accessory protein UreG OS=Rhodopseudomonas palustris (strain BisB18) GN=ureG PE=3 SV=1 418 592 5.0E-66
sp|Q5E731|UREG_VIBF1 Urease accessory protein UreG OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=ureG PE=3 SV=1 418 597 6.0E-66
sp|B0TT74|UREG_SHEHH Urease accessory protein UreG OS=Shewanella halifaxensis (strain HAW-EB4) GN=ureG PE=3 SV=1 418 596 7.0E-66
sp|Q06206|UREG_PROMH Urease accessory protein UreG OS=Proteus mirabilis (strain HI4320) GN=ureG PE=1 SV=2 418 597 8.0E-66
sp|A8LRR5|UREG_DINSH Urease accessory protein UreG OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=ureG PE=3 SV=1 418 596 9.0E-66
sp|Q63RL0|UREG_BURPS Urease accessory protein UreG OS=Burkholderia pseudomallei (strain K96243) GN=ureG PE=3 SV=1 418 592 9.0E-66
sp|A3NCM0|UREG_BURP6 Urease accessory protein UreG OS=Burkholderia pseudomallei (strain 668) GN=ureG PE=3 SV=1 418 592 9.0E-66
sp|A3NYD2|UREG_BURP0 Urease accessory protein UreG OS=Burkholderia pseudomallei (strain 1106a) GN=ureG PE=3 SV=1 418 592 9.0E-66
sp|A1V1G3|UREG_BURMS Urease accessory protein UreG OS=Burkholderia mallei (strain SAVP1) GN=ureG PE=3 SV=1 418 592 9.0E-66
sp|Q62HR7|UREG_BURMA Urease accessory protein UreG OS=Burkholderia mallei (strain ATCC 23344) GN=ureG PE=3 SV=1 418 592 9.0E-66
sp|A2S993|UREG_BURM9 Urease accessory protein UreG OS=Burkholderia mallei (strain NCTC 10229) GN=ureG PE=3 SV=1 418 592 9.0E-66
sp|A3MMV5|UREG_BURM7 Urease accessory protein UreG OS=Burkholderia mallei (strain NCTC 10247) GN=ureG PE=3 SV=1 418 592 9.0E-66
sp|Q3KIV1|UREG_PSEPF Urease accessory protein UreG OS=Pseudomonas fluorescens (strain Pf0-1) GN=ureG PE=3 SV=1 411 597 9.0E-66
sp|Q0VKY5|UREG_ALCBS Urease accessory protein UreG OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=ureG PE=3 SV=1 418 595 1.0E-65
sp|A2BQW2|UREG_PROMS Urease accessory protein UreG OS=Prochlorococcus marinus (strain AS9601) GN=ureG PE=3 SV=1 413 596 2.0E-65
sp|Q2Y9M4|UREG_NITMU Urease accessory protein UreG OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=ureG PE=3 SV=1 413 596 2.0E-65
sp|Q2SYG0|UREG_BURTA Urease accessory protein UreG OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=ureG PE=3 SV=1 418 592 2.0E-65
sp|A4SY41|UREG_POLSQ Urease accessory protein UreG OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=ureG PE=3 SV=1 418 597 2.0E-65
sp|Q3JPJ3|UREG_BURP1 Urease accessory protein UreG OS=Burkholderia pseudomallei (strain 1710b) GN=ureG PE=3 SV=1 418 592 3.0E-65
sp|B1JX26|UREG_BURCC Urease accessory protein UreG OS=Burkholderia cenocepacia (strain MC0-3) GN=ureG PE=3 SV=1 418 593 3.0E-65
sp|A0K573|UREG_BURCH Urease accessory protein UreG OS=Burkholderia cenocepacia (strain HI2424) GN=ureG PE=3 SV=1 418 593 4.0E-65
sp|Q1BYH5|UREG_BURCA Urease accessory protein UreG OS=Burkholderia cenocepacia (strain AU 1054) GN=ureG PE=3 SV=1 418 593 4.0E-65
sp|Q03287|UREG_ECOLX Urease accessory protein UreG OS=Escherichia coli GN=ureG PE=2 SV=1 418 597 4.0E-65
sp|B1YUF6|UREG_BURA4 Urease accessory protein UreG OS=Burkholderia ambifaria (strain MC40-6) GN=ureG PE=3 SV=1 418 593 5.0E-65
sp|Q4KJ34|UREG_PSEF5 Urease accessory protein UreG OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=ureG PE=3 SV=1 411 598 5.0E-65
sp|Q0BHN8|UREG_BURCM Urease accessory protein UreG OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=ureG PE=3 SV=1 418 593 7.0E-65
sp|Q4ZMY9|UREG_PSEU2 Urease accessory protein UreG OS=Pseudomonas syringae pv. syringae (strain B728a) GN=ureG PE=3 SV=1 411 597 2.0E-64
sp|Q48DC7|UREG_PSE14 Urease accessory protein UreG OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=ureG PE=3 SV=1 411 597 2.0E-64
sp|Q39IW6|UREG_BURL3 Urease accessory protein UreG OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=ureG PE=3 SV=1 418 593 2.0E-64
sp|Q9FCD5|UREG_STRCO Urease accessory protein UreG OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=ureG PE=3 SV=1 410 593 3.0E-64
sp|B3PXA8|UREG_RHIE6 Urease accessory protein UreG OS=Rhizobium etli (strain CIAT 652) GN=ureG PE=3 SV=1 418 596 3.0E-64
sp|C5CY05|UREG_VARPS Urease accessory protein UreG OS=Variovorax paradoxus (strain S110) GN=ureG PE=3 SV=1 418 596 3.0E-64
sp|Q1B874|UREG_MYCSS Urease accessory protein UreG OS=Mycobacterium sp. (strain MCS) GN=ureG PE=3 SV=1 418 588 3.0E-64
sp|A1UGT3|UREG_MYCSK Urease accessory protein UreG OS=Mycobacterium sp. (strain KMS) GN=ureG PE=3 SV=1 418 588 3.0E-64
sp|A3Q0D3|UREG_MYCSJ Urease accessory protein UreG OS=Mycobacterium sp. (strain JLS) GN=ureG PE=3 SV=1 418 588 3.0E-64
sp|Q2JWN7|UREG_SYNJA Urease accessory protein UreG OS=Synechococcus sp. (strain JA-3-3Ab) GN=ureG PE=3 SV=1 418 596 3.0E-64
sp|Q0RM12|UREG_FRAAA Urease accessory protein UreG OS=Frankia alni (strain ACN14a) GN=ureG PE=3 SV=1 414 592 3.0E-64
sp|A4JC39|UREG_BURVG Urease accessory protein UreG OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=ureG PE=3 SV=1 418 593 4.0E-64
sp|Q2J9L7|UREG_FRASC Urease accessory protein UreG OS=Frankia sp. (strain CcI3) GN=ureG PE=3 SV=1 404 592 4.0E-64
sp|B5ZMN5|UREG_RHILW Urease accessory protein UreG OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=ureG PE=3 SV=1 418 596 5.0E-64
sp|Q7CX57|UREG_AGRFC Urease accessory protein UreG OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=ureG PE=3 SV=2 418 596 6.0E-64
sp|A1T9N2|UREG_MYCVP Urease accessory protein UreG OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=ureG PE=3 SV=1 418 581 7.0E-64
sp|Q2K522|UREG_RHIEC Urease accessory protein UreG OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=ureG PE=3 SV=1 418 596 9.0E-64
sp|Q7VRS8|UREG_BLOFL Urease accessory protein UreG OS=Blochmannia floridanus GN=ureG PE=3 SV=1 409 596 2.0E-63
sp|B1ZNZ7|UREG_OPITP Urease accessory protein UreG OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=ureG PE=3 SV=1 409 597 3.0E-63
sp|Q8RPX7|UREG_RHILV Urease accessory protein UreG OS=Rhizobium leguminosarum bv. viciae GN=ureG PE=3 SV=1 418 596 9.0E-63
sp|Q9RYK0|UREG_DEIRA Urease accessory protein UreG OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=ureG PE=3 SV=1 418 596 1.0E-62
sp|Q473Q6|UREG_CUPPJ Urease accessory protein UreG OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=ureG PE=3 SV=1 428 597 1.0E-62
sp|Q1MCW4|UREG_RHIL3 Urease accessory protein UreG OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=ureG PE=3 SV=1 418 596 1.0E-62
sp|Q492F1|UREG_BLOPB Urease accessory protein UreG OS=Blochmannia pennsylvanicus (strain BPEN) GN=ureG PE=3 SV=1 418 596 2.0E-62
sp|A1VKW0|UREG_POLNA Urease accessory protein UreG OS=Polaromonas naphthalenivorans (strain CJ2) GN=ureG PE=3 SV=1 418 598 2.0E-62
sp|B9JR74|UREG_AGRVS Urease accessory protein UreG OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=ureG PE=3 SV=1 418 596 3.0E-62
sp|A3PL34|UREG_RHOS1 Urease accessory protein UreG OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=ureG PE=3 SV=1 418 596 4.0E-62
sp|B9J8L8|UREG_AGRRK Urease accessory protein UreG OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=ureG PE=3 SV=1 418 596 4.0E-62
sp|Q12DU6|UREG_POLSJ Urease accessory protein UreG OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=ureG PE=3 SV=1 418 598 5.0E-62
sp|A0L6F5|UREG_MAGMM Urease accessory protein UreG OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=ureG PE=3 SV=1 428 596 7.0E-62
sp|A4WR79|UREG_RHOS5 Urease accessory protein UreG OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=ureG PE=3 SV=1 418 596 1.0E-61
sp|A1B1B6|UREG_PARDP Urease accessory protein UreG OS=Paracoccus denitrificans (strain Pd 1222) GN=ureG PE=3 SV=1 411 596 2.0E-61
sp|Q21SY6|UREG_RHOFT Urease accessory protein UreG OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=ureG PE=3 SV=1 418 581 3.0E-61
sp|Q3J158|UREG_RHOS4 Urease accessory protein UreG OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=ureG PE=3 SV=1 418 596 3.0E-61
sp|Q89UF7|UREG_BRADU Urease accessory protein UreG OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=ureG PE=3 SV=1 428 592 3.0E-61
sp|Q0KCP3|UREG_CUPNH Urease accessory protein UreG OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=ureG PE=3 SV=1 428 597 4.0E-61
sp|B9KK42|UREG_RHOSK Urease accessory protein UreG OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=ureG PE=3 SV=1 418 596 9.0E-61
sp|Q1LPS6|UREG_CUPMC Urease accessory protein UreG OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=ureG PE=3 SV=1 428 597 1.0E-60
sp|Q9AQT0|UREG_RHOCA Urease accessory protein UreG OS=Rhodobacter capsulatus GN=ureG PE=3 SV=1 418 597 1.0E-60
sp|Q5LSP9|UREG_RUEPO Urease accessory protein UreG OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=ureG PE=3 SV=1 418 592 1.0E-60
sp|Q11EW1|UREG_CHESB Urease accessory protein UreG OS=Chelativorans sp. (strain BNC1) GN=ureG PE=3 SV=1 418 592 1.0E-60
sp|A4WEJ8|UREG_ENT38 Urease accessory protein UreG OS=Enterobacter sp. (strain 638) GN=ureG PE=3 SV=1 428 596 6.0E-60
sp|Q9RP19|UREG_SPOPA Urease accessory protein UreG OS=Sporosarcina pasteurii GN=ureG PE=1 SV=1 414 592 9.0E-60
sp|Q733J9|UREG_BACC1 Urease accessory protein UreG OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=ureG PE=3 SV=1 418 592 3.0E-59
sp|B1HZE7|UREG_LYSSC Urease accessory protein UreG OS=Lysinibacillus sphaericus (strain C3-41) GN=ureG PE=3 SV=1 418 592 4.0E-59
sp|A8APV3|UREG_CITK8 Urease accessory protein UreG OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=ureG PE=3 SV=1 428 598 4.0E-59
sp|C5C8U6|UREG_MICLC Urease accessory protein UreG OS=Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230) GN=ureG PE=3 SV=1 418 592 6.0E-59
sp|A9KJR6|UREG_CLOPH Urease accessory protein UreG OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=ureG PE=3 SV=1 418 592 6.0E-59
sp|Q8XXT4|UREG_RALSO Urease accessory protein UreG OS=Ralstonia solanacearum (strain GMI1000) GN=ureG PE=3 SV=1 428 597 6.0E-59
sp|Q9KG56|UREG_BACHD Urease accessory protein UreG OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=ureG PE=3 SV=1 418 596 7.0E-59
sp|Q98CZ5|UREG_RHILO Urease accessory protein UreG OS=Rhizobium loti (strain MAFF303099) GN=ureG PE=3 SV=1 418 597 9.0E-59
sp|A4F7F9|UREG1_SACEN Urease accessory protein UreG 1 OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=ureG1 PE=3 SV=1 414 587 9.0E-59
sp|A5W4B2|UREG_PSEP1 Urease accessory protein UreG OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=ureG PE=3 SV=1 428 596 1.0E-58
sp|B2U7M8|UREG_RALPJ Urease accessory protein UreG OS=Ralstonia pickettii (strain 12J) GN=ureG PE=3 SV=1 428 597 1.0E-58
sp|Q88J00|UREG_PSEPK Urease accessory protein UreG OS=Pseudomonas putida (strain KT2440) GN=ureG PE=3 SV=1 428 596 1.0E-58
sp|B0KUZ3|UREG_PSEPG Urease accessory protein UreG OS=Pseudomonas putida (strain GB-1) GN=ureG PE=3 SV=1 428 596 1.0E-58
sp|Q1IBN6|UREG_PSEE4 Urease accessory protein UreG OS=Pseudomonas entomophila (strain L48) GN=ureG PE=3 SV=1 428 596 1.0E-58
sp|B0CJQ0|UREG_BRUSI Urease accessory protein UreG OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=ureG PE=3 SV=1 418 596 3.0E-58
sp|Q8G2P5|UREG1_BRUSU Urease accessory protein UreG 1 OS=Brucella suis biovar 1 (strain 1330) GN=ureG1 PE=3 SV=1 418 596 3.0E-58
sp|Q7CNT4|UREG1_BRUME Urease accessory protein UreG 1 OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=ureG1 PE=3 SV=1 418 596 3.0E-58
sp|A9M7V8|UREG1_BRUC2 Urease accessory protein UreG 1 OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=ureG1 PE=3 SV=1 418 596 3.0E-58
sp|P0C856|UREG1_BRUAB Urease accessory protein UreG 1 OS=Brucella abortus biovar 1 (strain 9-941) GN=ureG1 PE=3 SV=1 418 596 3.0E-58
sp|Q2YPD2|UREG1_BRUA2 Urease accessory protein UreG 1 OS=Brucella abortus (strain 2308) GN=ureG1 PE=3 SV=1 418 596 3.0E-58
sp|B2GI03|UREG_KOCRD Urease accessory protein UreG OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=ureG PE=3 SV=1 418 592 3.0E-58
sp|A5VNL6|UREG1_BRUO2 Urease accessory protein UreG 1 OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=ureG1 PE=3 SV=1 418 596 4.0E-58
sp|A6WVR5|UREG_OCHA4 Urease accessory protein UreG OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=ureG PE=3 SV=1 418 596 6.0E-58
sp|Q144E7|UREG_BURXL Urease accessory protein UreG OS=Burkholderia xenovorans (strain LB400) GN=ureG PE=3 SV=1 428 593 7.0E-58
sp|B1J819|UREG_PSEPW Urease accessory protein UreG OS=Pseudomonas putida (strain W619) GN=ureG PE=3 SV=1 428 596 9.0E-58
sp|B5YUX6|UREG_ECO5E Urease accessory protein UreG OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=ureG PE=3 SV=1 428 596 1.0E-57
sp|Q8X9U4|UREG_ECO57 Urease accessory protein UreG OS=Escherichia coli O157:H7 GN=ureG1 PE=3 SV=1 428 596 1.0E-57
sp|A6TE45|UREG_KLEP7 Urease accessory protein UreG OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=ureG PE=3 SV=1 428 596 2.0E-57
sp|B5XU24|UREG_KLEP3 Urease accessory protein UreG OS=Klebsiella pneumoniae (strain 342) GN=ureG PE=3 SV=1 428 596 2.0E-57
sp|P18319|UREG_ENTAE Urease accessory protein UreG OS=Enterobacter aerogenes GN=ureG PE=1 SV=1 428 596 2.0E-57
sp|B2JF70|UREG_BURP8 Urease accessory protein UreG OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=ureG PE=3 SV=1 428 593 1.0E-56
sp|P0A4R8|UREG_BORPA Urease accessory protein UreG OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=ureG PE=3 SV=1 428 597 2.0E-56
sp|P0A4R7|UREG_BORBR Urease accessory protein UreG OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=ureG PE=3 SV=1 428 597 2.0E-56
sp|Q7VUD5|UREG_BORPE Urease accessory protein UreG OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=ureG PE=3 SV=1 428 597 3.0E-56
sp|B1XYX6|UREG_LEPCP Urease accessory protein UreG OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=ureG PE=3 SV=1 428 592 4.0E-56
sp|C4LF59|UREG_TOLAT Urease accessory protein UreG OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=ureG PE=3 SV=1 428 596 4.0E-56
sp|Q28RI9|UREG_JANSC Urease accessory protein UreG OS=Jannaschia sp. (strain CCS1) GN=ureG PE=3 SV=1 418 581 1.0E-55
sp|A2SDI6|UREG_METPP Urease accessory protein UreG OS=Methylibium petroleiphilum (strain PM1) GN=ureG PE=3 SV=1 428 598 1.0E-55
sp|A5VRB1|UREG2_BRUO2 Urease accessory protein UreG 2 OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=ureG2 PE=3 SV=1 418 597 2.0E-55
sp|Q8YI01|UREG2_BRUME Urease accessory protein UreG 2 OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=ureG2 PE=3 SV=1 418 597 2.0E-55
sp|A9M617|UREG2_BRUC2 Urease accessory protein UreG 2 OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=ureG2 PE=3 SV=1 418 597 2.0E-55
sp|Q57CE5|UREG2_BRUAB Urease accessory protein UreG 2 OS=Brucella abortus biovar 1 (strain 9-941) GN=ureG2 PE=3 SV=1 418 597 2.0E-55
sp|Q2YQD6|UREG2_BRUA2 Urease accessory protein UreG 2 OS=Brucella abortus (strain 2308) GN=ureG2 PE=3 SV=1 418 597 2.0E-55
sp|B1VNP0|UREG3_STRGG Urease accessory protein UreG 3 OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=ureG3 PE=3 SV=1 414 587 3.0E-55
sp|A8ET01|UREG_ARCB4 Urease accessory protein UreG OS=Arcobacter butzleri (strain RM4018) GN=ureG PE=3 SV=1 415 592 5.0E-55
sp|A8L7B6|UREG_FRASN Urease accessory protein UreG OS=Frankia sp. (strain EAN1pec) GN=ureG PE=3 SV=1 428 596 7.0E-55
sp|Q07403|UREG_BACSB Urease accessory protein UreG OS=Bacillus sp. (strain TB-90) GN=ureG PE=3 SV=1 418 598 7.0E-55
sp|C1D603|UREG_LARHH Urease accessory protein UreG OS=Laribacter hongkongensis (strain HLHK9) GN=ureG PE=3 SV=1 418 597 4.0E-54
sp|A4QA26|UREG_CORGB Urease accessory protein UreG OS=Corynebacterium glutamicum (strain R) GN=ureG PE=3 SV=1 418 592 5.0E-54
sp|Q79VJ1|UREG_CORGL Urease accessory protein UreG OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=ureG PE=2 SV=1 418 592 5.0E-54
sp|B1VHT5|UREG_CORU7 Urease accessory protein UreG OS=Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109) GN=ureG PE=3 SV=1 418 592 1.0E-53
sp|Q8FZV9|UREG2_BRUSU Urease accessory protein UreG 2 OS=Brucella suis biovar 1 (strain 1330) GN=ureG2 PE=3 SV=1 418 597 2.0E-53
sp|Q03ME0|UREG_STRTD Urease accessory protein UreG OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=ureG PE=3 SV=1 412 593 4.0E-52
sp|Q5M604|UREG_STRT2 Urease accessory protein UreG OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=ureG PE=3 SV=1 412 593 4.0E-52
sp|Q5M1G3|UREG_STRT1 Urease accessory protein UreG OS=Streptococcus thermophilus (strain CNRZ 1066) GN=ureG PE=3 SV=1 412 593 4.0E-52
sp|Q55057|UREG_STRE5 Urease accessory protein UreG OS=Streptococcus salivarius (strain 57.I) GN=ureG PE=3 SV=1 412 593 4.0E-52
sp|A4T7D7|UREG_MYCGI Urease accessory protein UreG OS=Mycobacterium gilvum (strain PYR-GCK) GN=ureG PE=3 SV=1 415 597 4.0E-52
sp|Q2YYV2|UREG_STAAB Urease accessory protein UreG OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=ureG PE=3 SV=1 418 592 5.0E-52
sp|Q5HLV8|UREG_STAEQ Urease accessory protein UreG OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=ureG PE=3 SV=1 413 592 1.0E-51
sp|Q56561|UREG_UREPA Urease accessory protein UreG OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=ureG PE=3 SV=1 414 581 2.0E-51
sp|A8Z390|UREG_STAAT Urease accessory protein UreG OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=ureG PE=3 SV=1 418 592 2.0E-51
sp|Q6GEE1|UREG_STAAR Urease accessory protein UreG OS=Staphylococcus aureus (strain MRSA252) GN=ureG PE=3 SV=1 418 592 2.0E-51
sp|Q7A427|UREG_STAAN Urease accessory protein UreG OS=Staphylococcus aureus (strain N315) GN=ureG PE=1 SV=1 418 592 2.0E-51
sp|Q99RX9|UREG_STAAM Urease accessory protein UreG OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=ureG PE=3 SV=1 418 592 2.0E-51
sp|A6QJD3|UREG_STAAE Urease accessory protein UreG OS=Staphylococcus aureus (strain Newman) GN=ureG PE=3 SV=1 418 592 2.0E-51
sp|Q5HDR5|UREG_STAAC Urease accessory protein UreG OS=Staphylococcus aureus (strain COL) GN=ureG PE=3 SV=1 418 592 2.0E-51
sp|A5IV74|UREG_STAA9 Urease accessory protein UreG OS=Staphylococcus aureus (strain JH9) GN=ureG PE=3 SV=1 418 592 2.0E-51
sp|Q2G273|UREG_STAA8 Urease accessory protein UreG OS=Staphylococcus aureus (strain NCTC 8325) GN=ureG PE=3 SV=1 418 592 2.0E-51
sp|Q2FEK0|UREG_STAA3 Urease accessory protein UreG OS=Staphylococcus aureus (strain USA300) GN=ureG PE=3 SV=1 418 592 2.0E-51
sp|A6U417|UREG_STAA2 Urease accessory protein UreG OS=Staphylococcus aureus (strain JH1) GN=ureG PE=3 SV=1 418 592 2.0E-51
sp|A7X5M7|UREG_STAA1 Urease accessory protein UreG OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=ureG PE=3 SV=1 418 592 2.0E-51
sp|Q8NV88|UREG_STAAW Urease accessory protein UreG OS=Staphylococcus aureus (strain MW2) GN=ureG PE=3 SV=1 418 592 3.0E-51
sp|Q6G729|UREG_STAAS Urease accessory protein UreG OS=Staphylococcus aureus (strain MSSA476) GN=ureG PE=3 SV=1 418 592 3.0E-51
sp|Q8CNC6|UREG_STAES Urease accessory protein UreG OS=Staphylococcus epidermidis (strain ATCC 12228) GN=ureG PE=3 SV=1 413 592 5.0E-51
sp|A5EDB2|UREG1_BRASB Urease accessory protein UreG 1 OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=ureG1 PE=3 SV=1 412 596 5.0E-51
sp|Q4A0J8|UREG_STAS1 Urease accessory protein UreG OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=ureG PE=3 SV=1 418 592 9.0E-51
sp|Q3IRZ3|UREG_NATPD Urease accessory protein UreG OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=ureG PE=3 SV=1 417 592 3.0E-50
sp|C5BBR3|UREG_EDWI9 Urease accessory protein UreG OS=Edwardsiella ictaluri (strain 93-146) GN=ureG PE=3 SV=1 418 596 3.0E-50
sp|A5EJY3|UREG2_BRASB Urease accessory protein UreG 2 OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=ureG2 PE=3 SV=1 415 596 4.0E-50
sp|B1VSW9|UREG2_STRGG Urease accessory protein UreG 2 OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=ureG2 PE=3 SV=1 405 596 9.0E-50
sp|P42877|UREG_STAXY Urease accessory protein UreG OS=Staphylococcus xylosus GN=ureG PE=3 SV=1 418 592 1.0E-49
sp|Q75ZQ3|UREG_HALMA Urease accessory protein UreG OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=ureG PE=3 SV=1 417 592 4.0E-49
sp|B1Z8R3|UREG2_METPB Urease accessory protein UreG 2 OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=ureG2 PE=3 SV=1 418 597 8.0E-49
sp|Q117Z7|UREG_TRIEI Urease accessory protein UreG OS=Trichodesmium erythraeum (strain IMS101) GN=ureG PE=3 SV=1 413 597 2.0E-48
sp|Q7N4Y4|UREG_PHOLL Urease accessory protein UreG OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=ureG PE=3 SV=1 418 596 5.0E-48
sp|P69993|UREG_YERPS Urease accessory protein UreG OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=ureG PE=3 SV=1 418 597 5.0E-48
sp|P69992|UREG_YERPE Urease accessory protein UreG OS=Yersinia pestis GN=ureG PE=3 SV=1 418 597 5.0E-48
sp|A1JKE2|UREG_YERE8 Urease accessory protein UreG OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=ureG PE=3 SV=2 406 597 1.0E-47
sp|B1M9D7|UREG2_METRJ Urease accessory protein UreG 2 OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=ureG2 PE=3 SV=1 413 596 1.0E-47
sp|A9W297|UREG2_METEP Urease accessory protein UreG 2 OS=Methylobacterium extorquens (strain PA1) GN=ureG2 PE=3 SV=1 418 596 3.0E-47
sp|Q972W3|UREG_SULTO Urease accessory protein UreG OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=ureG PE=3 SV=1 418 596 3.0E-47
sp|P42871|UREG_YEREN Urease accessory protein UreG OS=Yersinia enterocolitica GN=ureG PE=3 SV=1 406 597 4.0E-47
sp|A4YF54|UREG_METS5 Urease accessory protein UreG OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=ureG PE=3 SV=1 418 596 5.0E-47
sp|Q18EB7|UREG_HALWD Urease accessory protein UreG OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=ureG PE=3 SV=1 418 596 1.0E-46
sp|A0RUR8|UREG_CENSY Urease accessory protein UreG OS=Cenarchaeum symbiosum (strain A) GN=ureG PE=3 SV=1 418 590 1.0E-45
sp|Q57884|HYPB_METJA Probable hydrogenase nickel incorporation protein HypB OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=hypB PE=1 SV=1 422 597 9.0E-15
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1160
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4703
Ophiocordyceps australis map64 (Brazil) OphauB2|6287
Ophiocordyceps camponoti-floridani Ophcf2|05121
Ophiocordyceps camponoti-rufipedis Ophun1|7516 (this protein)
Ophiocordyceps kimflemingae Ophio5|2965
Ophiocordyceps subramaniannii Hirsu2|10249

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7516
MQKLLKRTAQAERQVARRMKKRNKEEERAELRRERPRIVDALRSIAKDNKTARRTWIENWELGPLAPKRDLGCNN
YGVIWENYRRTPPRPSPQVLEQRCGWAGGPHQLCLAPGDRVLIMDGPDKGKIDCIKDIQHEHGTVKLETRHKGLF
GTPMGGGGAAMDFPLSVGSIRLVYPLPHPQTGQIRDVVIQRLKAVLPNMKSEHMSYDRWEFGRKWDRMIPGISVV
IPWPDGSAPHYESHKSDTLRDKVEERTFLFNLTSPPMPPSVLDELRNRYSKFRTRHEAWYVQKKEAEEAAKKAKA
SRDVLSMRTPMDEFAEKRKQLRLARPEPLLTDEMLERIGRIMLMEQRRASEWKEGEPPRVTGGPDVGKPGVGRPV
TEPPVSDKEHGHSHEILDGPGSYTGRELPITQGRDWSSRAFTVGIGGPVGSGKTALMLALCLSLREKYSLAAVTN
DIFTREDAEFLTRNRALPPSRIRAIETGGCPHAAVREDISANLAALEDLHASFSPDLLLIESGGDNLAANYSREL
ADFIIYVIDVSGGDKIPRKGGPGITQSDLLVVNKTDLAGIIGADLGVMERDARKMREGGPTVFAQVKGGVGWC*
Coding >Ophun1|7516
ATGCAGAAGCTCCTCAAGCGGACGGCTCAGGCGGAGCGACAAGTCGCCCGACGCATGAAGAAGAGGAACAAGGAG
GAAGAACGGGCGGAACTCCGAAGGGAGAGACCCCGGATCGTTGACGCGCTGCGATCCATCGCCAAGGACAACAAG
ACTGCGCGTCGGACGTGGATCGAGAATTGGGAGCTGGGACCGCTCGCTCCGAAGCGTGATCTCGGCTGCAACAAC
TACGGAGTCATCTGGGAGAATTACCGGCGCACTCCCCCGAGGCCGTCTCCTCAGGTGCTCGAGCAGCGATGCGGC
TGGGCTGGTGGACCGCATCAGCTCTGTCTGGCCCCTGGCGATCGCGTGCTCATCATGGACGGTCCGGACAAGGGC
AAGATTGACTGCATCAAGGATATCCAGCACGAACATGGCACCGTCAAGCTGGAGACGCGCCACAAGGGCCTCTTT
GGGACTCCGATGGGCGGGGGCGGCGCTGCCATGGATTTCCCCTTGTCGGTTGGGTCCATCCGTCTCGTCTATCCG
CTGCCGCACCCGCAGACGGGCCAGATTCGAGACGTCGTCATCCAGAGGCTCAAGGCGGTGCTGCCCAACATGAAG
TCGGAACACATGTCATATGACCGCTGGGAATTCGGAAGAAAATGGGATCGCATGATTCCTGGCATCAGCGTCGTC
ATCCCTTGGCCCGATGGATCGGCGCCGCATTATGAATCCCACAAGAGCGACACTCTGCGCGACAAGGTCGAGGAG
CGGACTTTTCTCTTCAACCTCACGTCGCCGCCCATGCCGCCGTCGGTCCTGGACGAGCTTCGGAACAGGTACTCC
AAGTTCCGGACCCGGCACGAGGCCTGGTACGTGCAGAAGAAGGAGGCCGAGGAGGCGGCCAAGAAGGCCAAGGCG
TCCCGGGACGTGCTGTCGATGCGGACTCCCATGGACGAGTTTGCCGAGAAGCGGAAGCAGCTCCGGCTGGCGAGG
CCCGAGCCGTTGCTTACCGATGAGATGCTTGAGCGTATCGGTCGCATCATGTTGATGGAGCAGCGGCGGGCGTCG
GAGTGGAAAGAGGGCGAGCCGCCGCGGGTGACCGGGGGTCCGGACGTGGGGAAGCCGGGAGTGGGCCGGCCGGTG
ACGGAGCCGCCAGTTTCGGACAAGGAACATGGCCACTCGCACGAAATCCTCGACGGCCCTGGCAGCTACACCGGC
CGCGAGCTGCCCATCACCCAAGGCCGCGACTGGAGCAGCCGGGCCTTTACCGTGGGGATAGGAGGACCCGTTGGC
TCGGGCAAGACGGCGCTCATGTTGGCCCTCTGCCTGTCCCTCCGCGAGAAATACTCCCTCGCAGCCGTGACCAAC
GACATCTTCACCCGCGAAGACGCCGAGTTCCTCACCCGCAACCGCGCCCTACCCCCATCCCGCATCCGCGCCATC
GAAACAGGAGGGTGTCCGCACGCGGCCGTCCGCGAAGACATATCCGCCAACCTGGCGGCCCTGGAAGACCTACAC
GCCAGCTTCAGCCCGGACCTCCTCCTGATCGAATCCGGGGGCGACAACCTGGCGGCCAACTACTCGCGCGAGCTG
GCCGACTTCATCATCTACGTCATCGACGTGAGCGGGGGCGACAAGATCCCGCGGAAGGGGGGGCCGGGCATCACG
CAGAGCGACCTGCTGGTGGTGAACAAGACGGACTTGGCGGGGATTATCGGCGCGGATTTGGGGGTTATGGAGAGG
GATGCGAGGAAGATGAGGGAGGGGGGGCCGACGGTTTTTGCGCAGGTCAAGGGGGGGGTTGGGTGGTGCTGA
Transcript >Ophun1|7516
ATGCAGAAGCTCCTCAAGCGGACGGCTCAGGCGGAGCGACAAGTCGCCCGACGCATGAAGAAGAGGAACAAGGAG
GAAGAACGGGCGGAACTCCGAAGGGAGAGACCCCGGATCGTTGACGCGCTGCGATCCATCGCCAAGGACAACAAG
ACTGCGCGTCGGACGTGGATCGAGAATTGGGAGCTGGGACCGCTCGCTCCGAAGCGTGATCTCGGCTGCAACAAC
TACGGAGTCATCTGGGAGAATTACCGGCGCACTCCCCCGAGGCCGTCTCCTCAGGTGCTCGAGCAGCGATGCGGC
TGGGCTGGTGGACCGCATCAGCTCTGTCTGGCCCCTGGCGATCGCGTGCTCATCATGGACGGTCCGGACAAGGGC
AAGATTGACTGCATCAAGGATATCCAGCACGAACATGGCACCGTCAAGCTGGAGACGCGCCACAAGGGCCTCTTT
GGGACTCCGATGGGCGGGGGCGGCGCTGCCATGGATTTCCCCTTGTCGGTTGGGTCCATCCGTCTCGTCTATCCG
CTGCCGCACCCGCAGACGGGCCAGATTCGAGACGTCGTCATCCAGAGGCTCAAGGCGGTGCTGCCCAACATGAAG
TCGGAACACATGTCATATGACCGCTGGGAATTCGGAAGAAAATGGGATCGCATGATTCCTGGCATCAGCGTCGTC
ATCCCTTGGCCCGATGGATCGGCGCCGCATTATGAATCCCACAAGAGCGACACTCTGCGCGACAAGGTCGAGGAG
CGGACTTTTCTCTTCAACCTCACGTCGCCGCCCATGCCGCCGTCGGTCCTGGACGAGCTTCGGAACAGGTACTCC
AAGTTCCGGACCCGGCACGAGGCCTGGTACGTGCAGAAGAAGGAGGCCGAGGAGGCGGCCAAGAAGGCCAAGGCG
TCCCGGGACGTGCTGTCGATGCGGACTCCCATGGACGAGTTTGCCGAGAAGCGGAAGCAGCTCCGGCTGGCGAGG
CCCGAGCCGTTGCTTACCGATGAGATGCTTGAGCGTATCGGTCGCATCATGTTGATGGAGCAGCGGCGGGCGTCG
GAGTGGAAAGAGGGCGAGCCGCCGCGGGTGACCGGGGGTCCGGACGTGGGGAAGCCGGGAGTGGGCCGGCCGGTG
ACGGAGCCGCCAGTTTCGGACAAGGAACATGGCCACTCGCACGAAATCCTCGACGGCCCTGGCAGCTACACCGGC
CGCGAGCTGCCCATCACCCAAGGCCGCGACTGGAGCAGCCGGGCCTTTACCGTGGGGATAGGAGGACCCGTTGGC
TCGGGCAAGACGGCGCTCATGTTGGCCCTCTGCCTGTCCCTCCGCGAGAAATACTCCCTCGCAGCCGTGACCAAC
GACATCTTCACCCGCGAAGACGCCGAGTTCCTCACCCGCAACCGCGCCCTACCCCCATCCCGCATCCGCGCCATC
GAAACAGGAGGGTGTCCGCACGCGGCCGTCCGCGAAGACATATCCGCCAACCTGGCGGCCCTGGAAGACCTACAC
GCCAGCTTCAGCCCGGACCTCCTCCTGATCGAATCCGGGGGCGACAACCTGGCGGCCAACTACTCGCGCGAGCTG
GCCGACTTCATCATCTACGTCATCGACGTGAGCGGGGGCGACAAGATCCCGCGGAAGGGGGGGCCGGGCATCACG
CAGAGCGACCTGCTGGTGGTGAACAAGACGGACTTGGCGGGGATTATCGGCGCGGATTTGGGGGTTATGGAGAGG
GATGCGAGGAAGATGAGGGAGGGGGGGCCGACGGTTTTTGCGCAGGTCAAGGGGGGGGTTGGGTGGTGCTGA
Gene >Ophun1|7516
ATGCAGAAGCTCCTCAAGCGGACGGCTCAGGCGGAGCGACAAGTCGCCCGACGCATGAAGAAGAGGAACAAGGAG
GAAGAACGGGCGGAACTCCGAAGGGAGAGACCCCGGATCGTTGACGCGCTGCGATCCATCGCCAAGGACAACAAG
ACTGCGCGTCGGACGTGGATCGAGAATTGGGAGCTGGGACCGCTCGCTCCGAAGCGTGATCTCGGCTGCAACAAC
TACGGAGTCATCTGGGAGAATTACCGGCGCACTCCCCCGAGGCCGTCTCCTCAGGTGCTCGAGCAGCGATGCGGC
TGGGCTGGTGGACCGCATCAGCTCTGTCTGGCCCCTGGCGATCGCGTGCTCATCATGGACGGTCCGGACAAGGGC
AAGATTGACTGCATCAAGGATATCCAGCACGAACATGGCACCGTCAAGCTGGAGACGCGCCACAAGGTGAGTGTC
GACTCTCTGCGTCTCGCCCGGCTGGTCAACGCTCAACTCCTCGGCAGGGCCTCTTTGGGACTCCGATGGGCGGGG
GCGGCGCTGCCATGGATTTCCCCTTGTCGGTTGGGTCCATCCGTCTCGTCTATCCGCTGCCGCACCCGCAGACGG
GCCAGATTCGAGACGTCGTCATCCAGAGGCTCAAGGCGGTGCTGCCCAACATGAAGTCGGAACACATGTCATATG
ACCGCTGGGAATTCGGAAGAAAATGGGATCGCATGATTCCTGGCATCAGCGTCGTCATCCCTTGGCCCGATGGAT
CGGCGCCGCATTATGAATCCCACAAGAGCGACACTCTGCGCGACAAGGTCGAGGAGCGGACTTTTCTCTTCAACC
TCACGTCGCCGCCCATGCCGCCGTCGGTCCTGGACGAGCTTCGGAACAGGTACTCCAAGTTCCGGACCCGGCACG
AGGCCTGGTACGTGCAGAAGAAGGAGGCCGAGGAGGCGGCCAAGAAGGCCAAGGCGTCCCGGGACGTGCTGTCGA
TGCGGACTCCCATGGACGAGTTTGCCGAGAAGCGGAAGCAGCTCCGGCTGGCGAGGCCCGAGCCGTTGCTTACCG
ATGAGATGCTTGAGCGTATCGGTCGCATCATGTTGATGGAGCAGCGGCGGGCGTCGGAGTGGAAAGAGGGCGAGC
CGCCGCGGGTGACCGGGGGTCCGGACGTGGGGAAGCCGGGAGTGGGCCGGCCGGTGACGGAGCCGCCAGTTTCGG
ACAAGGTATCGAAGCCGGGGGTTGTCGGTCCGCCGTGAGGGAGACGGGGGCATTCCGGCTGGGGAGAAAAGATGA
TCTGTACCTAGGCTTCACCCTTACACATACGCCGCAGCTGGAGCGAGCCGAGTCTCTGTCAATGACACGGTATAA
GCTATAAGCCGCCGGTGTTATCCGCACTTGGCCGCGGCCCCTCCCCGCACTGACTGAACCTCTCCTCTCTTCTAC
TGACCAACCTCCAGCCCTCTATCGAGATTCGGATACGAATCCACGTGCAACCATGGCATCCTCGCACACGCACTC
GCACGACTTCAACGCCCAGGAACATGGCCACTCGCACGAAATCCTCGACGGCCCTGGCAGCTACACCGGCCGCGA
GCTGCCCATCACCCAAGGCCGCGACTGGAGCAGCCGGGCCTTTACCGTGGGGATAGGAGGGTGAGTCCTCAACAT
GATGAACCATGGACATGTGCTCAATAGGTTCCAGACCCGTTGGCTCGGGCAAGACGGCGCTCATGTTGGCCCTCT
GCCTGTCCCTCCGCGAGAAATACTCCCTCGCAGCCGTGACCAACGACATCTTCACCCGCGAAGACGCCGAGTTCC
TCACCCGCAACCGCGCCCTACCCCCATCCCGCATCCGCGCCATCGAAACAGGAGGGTGTCCGCACGCGGCCGTCC
GCGAAGACATATCCGCCAACCTGGCGGCCCTGGAAGACCTACACGCCAGCTTCAGCCCGGACCTCCTCCTGATCG
AATCCGGGGGCGACAACCTGGCGGCCAACTACTCGCGCGAGCTGGCCGACTTCATCATCTACGTCATCGACGTGA
GCGGGGGCGACAAGATCCCGCGGAAGGGGGGGCCGGGCATCACGCAGAGCGACCTGCTGGTGGTGAACAAGACGG
ACTTGGCGGGGATTATCGGCGCGGATTTGGGGGTTATGGAGAGGGATGCGAGGAAGATGAGGGAGGGGGGGCCGA
CGGTTTTTGCGCAGGTCAAGGGGGGGGTTGGGGTTGAGCATATTGTTGGCTTGGTGTTGAGTGCTTGGAGGGCTA
GTGGTGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail