Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7510
Gene name
LocationContig_96:17886..19186
Strand+
Gene length (bp)1300
Transcript length (bp)1080
Coding sequence length (bp)1080
Protein length (aa) 360

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01207 Dus Dihydrouridine synthase (Dus) 1.0E-33 31 307

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q06063|DUS4_YEAST tRNA-dihydrouridine(20a/20b) synthase [NAD(P)+] OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DUS4 PE=1 SV=1 6 346 2.0E-51
sp|O95620|DUS4L_HUMAN tRNA-dihydrouridine(20a/20b) synthase [NAD(P)+]-like OS=Homo sapiens GN=DUS4L PE=2 SV=2 10 341 6.0E-50
sp|O74553|DUS4_SCHPO tRNA-dihydrouridine(20a/20b) synthase [NAD(P)+] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dus4 PE=3 SV=1 10 342 1.0E-49
sp|Q32M08|DUS4L_MOUSE tRNA-dihydrouridine(20a/20b) synthase [NAD(P)+]-like OS=Mus musculus GN=Dus4l PE=2 SV=1 10 307 3.0E-49
sp|Q09504|YQI2_CAEEL Uncharacterized tRNA-dihydrouridine synthase-like protein C45G9.2 OS=Caenorhabditis elegans GN=C45G9.2 PE=3 SV=2 31 337 3.0E-39
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q06063|DUS4_YEAST tRNA-dihydrouridine(20a/20b) synthase [NAD(P)+] OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DUS4 PE=1 SV=1 6 346 2.0E-51
sp|O95620|DUS4L_HUMAN tRNA-dihydrouridine(20a/20b) synthase [NAD(P)+]-like OS=Homo sapiens GN=DUS4L PE=2 SV=2 10 341 6.0E-50
sp|O74553|DUS4_SCHPO tRNA-dihydrouridine(20a/20b) synthase [NAD(P)+] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dus4 PE=3 SV=1 10 342 1.0E-49
sp|Q32M08|DUS4L_MOUSE tRNA-dihydrouridine(20a/20b) synthase [NAD(P)+]-like OS=Mus musculus GN=Dus4l PE=2 SV=1 10 307 3.0E-49
sp|Q09504|YQI2_CAEEL Uncharacterized tRNA-dihydrouridine synthase-like protein C45G9.2 OS=Caenorhabditis elegans GN=C45G9.2 PE=3 SV=2 31 337 3.0E-39
sp|Q6P1R4|DUS1L_HUMAN tRNA-dihydrouridine(16/17) synthase [NAD(P)(+)]-like OS=Homo sapiens GN=DUS1L PE=1 SV=1 25 356 2.0E-27
sp|Q8C2P3|DUS1L_MOUSE tRNA-dihydrouridine(16/17) synthase [NAD(P)(+)]-like OS=Mus musculus GN=Dus1l PE=2 SV=1 25 351 1.0E-26
sp|Q8K582|DUS1L_RAT tRNA-dihydrouridine(16/17) synthase [NAD(P)(+)]-like OS=Rattus norvegicus GN=Dus1l PE=2 SV=1 25 351 2.0E-26
sp|Q9HGN6|DUS1_SCHPO tRNA-dihydrouridine(16/17) synthase [NAD(P)(+)] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dus1 PE=3 SV=1 15 272 1.0E-17
sp|P53759|DUS1_YEAST tRNA-dihydrouridine(16/17) synthase [NAD(P)(+)] OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DUS1 PE=1 SV=1 12 272 3.0E-13
sp|O74731|DUS2_SCHPO tRNA-dihydrouridine(20) synthase [NAD(P)+] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dus2 PE=3 SV=1 28 272 9.0E-09
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 53 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7510
MASTPENPHPLKLFDTAKKQNRFLHACAPMLAFRQTVHKYGVDLCWSPMILAKEFNRNDTARASDLTVSTLGPQP
PTILQFGANSPLELSRAASLAAPFVAGVDLNCGCPQSWACAETLGAALMDRRELVRDMVVETRRRLGCDGWHVGL
EDDVESLRGRSVSVKIRVHGDLRKTMDFLDTVIGHPQNRLVDWITIHPRTRSTPSTAPIRTEALDILTEKYASTL
PILLSGDVFALSPLPFSAPSDAEPRPGNTHISGFMSARGLLANPALFAGYTACPWEALETFMCNVARCPLPFKLV
AHHVSQMCGPGMGTDKSALLPKKERAELAHLDNMIDLVDFLDARIEEHTGRAGGMRRNL*
Coding >Ophun1|7510
ATGGCCTCCACGCCAGAAAATCCCCACCCCCTCAAGCTCTTCGACACAGCCAAGAAGCAGAATCGCTTTCTCCAC
GCATGCGCCCCCATGCTCGCCTTCCGCCAAACCGTACACAAATACGGTGTCGACCTCTGCTGGTCCCCCATGATC
CTCGCCAAGGAATTCAACCGCAACGACACCGCCCGAGCCAGCGACCTCACCGTCTCAACCCTCGGTCCCCAACCG
CCCACCATCCTCCAATTCGGCGCCAACTCGCCGCTTGAGCTCTCGCGCGCAGCGTCTCTGGCAGCCCCCTTTGTC
GCAGGCGTGGATCTCAACTGCGGGTGTCCCCAGTCGTGGGCCTGCGCTGAGACGCTTGGTGCCGCGCTCATGGAT
CGTCGGGAGCTTGTGCGGGACATGGTGGTTGAGACGCGGAGGCGTCTTGGCTGCGATGGGTGGCACGTTGGGCTG
GAGGATGACGTCGAGAGCCTTCGTGGCCGGAGCGTCAGCGTCAAGATTAGGGTGCATGGTGATTTGCGCAAGACA
ATGGACTTCTTGGATACGGTTATAGGACACCCGCAGAACCGGCTCGTCGACTGGATCACCATCCATCCGCGCACA
CGAAGCACCCCGTCCACGGCACCCATCCGAACCGAAGCCCTCGATATCCTCACGGAAAAGTACGCCAGTACGCTT
CCCATCCTCCTCTCCGGCGACGTCTTTGCCCTCTCCCCCCTGCCCTTCAGCGCCCCCTCCGACGCCGAACCACGG
CCCGGCAACACGCACATCAGCGGCTTCATGTCCGCGCGTGGCCTCCTCGCCAACCCGGCCCTCTTCGCCGGATAT
ACAGCCTGTCCGTGGGAAGCCCTGGAGACCTTCATGTGCAACGTCGCTCGCTGTCCACTTCCCTTCAAGCTCGTC
GCTCACCACGTGTCGCAAATGTGCGGGCCCGGTATGGGTACCGACAAGTCCGCGCTGCTGCCCAAGAAGGAGAGG
GCCGAGCTCGCCCATTTGGATAACATGATCGATCTCGTCGACTTTCTCGACGCCAGAATAGAGGAGCACACCGGT
AGGGCGGGCGGCATGCGACGCAATCTGTGA
Transcript >Ophun1|7510
ATGGCCTCCACGCCAGAAAATCCCCACCCCCTCAAGCTCTTCGACACAGCCAAGAAGCAGAATCGCTTTCTCCAC
GCATGCGCCCCCATGCTCGCCTTCCGCCAAACCGTACACAAATACGGTGTCGACCTCTGCTGGTCCCCCATGATC
CTCGCCAAGGAATTCAACCGCAACGACACCGCCCGAGCCAGCGACCTCACCGTCTCAACCCTCGGTCCCCAACCG
CCCACCATCCTCCAATTCGGCGCCAACTCGCCGCTTGAGCTCTCGCGCGCAGCGTCTCTGGCAGCCCCCTTTGTC
GCAGGCGTGGATCTCAACTGCGGGTGTCCCCAGTCGTGGGCCTGCGCTGAGACGCTTGGTGCCGCGCTCATGGAT
CGTCGGGAGCTTGTGCGGGACATGGTGGTTGAGACGCGGAGGCGTCTTGGCTGCGATGGGTGGCACGTTGGGCTG
GAGGATGACGTCGAGAGCCTTCGTGGCCGGAGCGTCAGCGTCAAGATTAGGGTGCATGGTGATTTGCGCAAGACA
ATGGACTTCTTGGATACGGTTATAGGACACCCGCAGAACCGGCTCGTCGACTGGATCACCATCCATCCGCGCACA
CGAAGCACCCCGTCCACGGCACCCATCCGAACCGAAGCCCTCGATATCCTCACGGAAAAGTACGCCAGTACGCTT
CCCATCCTCCTCTCCGGCGACGTCTTTGCCCTCTCCCCCCTGCCCTTCAGCGCCCCCTCCGACGCCGAACCACGG
CCCGGCAACACGCACATCAGCGGCTTCATGTCCGCGCGTGGCCTCCTCGCCAACCCGGCCCTCTTCGCCGGATAT
ACAGCCTGTCCGTGGGAAGCCCTGGAGACCTTCATGTGCAACGTCGCTCGCTGTCCACTTCCCTTCAAGCTCGTC
GCTCACCACGTGTCGCAAATGTGCGGGCCCGGTATGGGTACCGACAAGTCCGCGCTGCTGCCCAAGAAGGAGAGG
GCCGAGCTCGCCCATTTGGATAACATGATCGATCTCGTCGACTTTCTCGACGCCAGAATAGAGGAGCACACCGGT
AGGGCGGGCGGCATGCGACGCAATCTGTGA
Gene >Ophun1|7510
ATGGCCTCCACGCCAGAAAATCCCCAGTACGACACCCCCCCCCATTAAAGAGCCCCAACTCTAACCCCCAAAGCC
CCCTCAAGCTCTTCGACACAGCCAAGAAGCAGAATCGCTTTCTCCACGCATGCGCCCCCATGGTCCGCTACAGCA
AGGCTCGTCCCCTTCAGCCCTCCCGATAACCAAGACTGACATCTTCTAGCTCGCCTTCCGCCAAACCGTACACAA
ATACGGTGTCGACCTCTGCTGGTCCCCCATGATCCTCGCCAAGGAATTCAACCGCAACGACACCGCCCGAGCCAG
CGGTATGCTCCCTCCCAAAGGAAACAGGGCAAGGATACCTATCTAACAGCACGGCAGACCTCACCGTCTCAACCC
TCGGTCCCCAACCGCCCACCATCCTCCAATTCGGCGCCAACTCGCCGCTTGAGCTCTCGCGCGCAGCGTCTCTGG
CAGCCCCCTTTGTCGCAGGCGTGGATCTCAACTGCGGGTGTCCCCAGTCGTGGGCCTGCGCTGAGACGCTTGGTG
CCGCGCTCATGGATCGTCGGGAGCTTGTGCGGGACATGGTGGTTGAGACGCGGAGGCGTCTTGGCTGCGATGGGT
GGCACGTTGGGCTGGAGGATGACGTCGAGAGCCTTCGTGGCCGGAGCGTCAGCGTCAAGATTAGGGTGCATGGTG
ATTTGCGGTCCGTTGTCACGCAGTTGAGAAGAATCTCTTTTCGTGTTTCTGACGCTGAGGCAGCAAGACAATGGA
CTTCTTGGATACGGTTATAGGACACCCGCAGAACCGGCTCGTCGACTGGATCACCATCCATCCGCGCACACGAAG
CACCCCGTCCACGGCACCCATCCGAACCGAAGCCCTCGATATCCTCACGGAAAAGTACGCCAGTACGCTTCCCAT
CCTCCTCTCCGGCGACGTCTTTGCCCTCTCCCCCCTGCCCTTCAGCGCCCCCTCCGACGCCGAACCACGGCCCGG
CAACACGCACATCAGCGGCTTCATGTCCGCGCGTGGCCTCCTCGCCAACCCGGCCCTCTTCGCCGGATATACAGC
CTGTCCGTGGGAAGCCCTGGAGACCTTCATGTGCAACGTCGCTCGCTGTCCACTTCCCTTCAAGCTCGTCGCTCA
CCACGTGTCGCAAATGTGCGGGCCCGGTATGGGTACCGACAAGTCCGCGCTGCTGCCCAAGAAGGAGAGGGCCGA
GCTCGCCCATTTGGATAACATGATCGATCTCGTCGACTTTCTCGACGCCAGAATAGAGGAGCACACCGGTAGGGC
GGGCGGCATGCGACGCAATCTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail