Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7507
Gene name
LocationContig_96:12196..13027
Strand+
Gene length (bp)831
Transcript length (bp)831
Coding sequence length (bp)831
Protein length (aa) 277

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01674 Lipase_2 Lipase (class 2) 2.0E-05 30 213

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q79F14|ESTB_BACSU Extracellular esterase EstB OS=Bacillus subtilis (strain 168) GN=estB PE=1 SV=1 31 137 4.0E-06

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0016042 lipid catabolic process Yes
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:1901575 organic substance catabolic process No
GO:0071704 organic substance metabolic process No
GO:0003824 catalytic activity No
GO:0006629 lipid metabolic process No
GO:0009056 catabolic process No
GO:0008150 biological_process No
GO:0044238 primary metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3279
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2863
Ophiocordyceps australis map64 (Brazil) OphauB2|2250
Ophiocordyceps camponoti-floridani Ophcf2|05110
Ophiocordyceps camponoti-rufipedis Ophun1|7507 (this protein)
Ophiocordyceps kimflemingae Ophio5|2037
Ophiocordyceps subramaniannii Hirsu2|6

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7507
MQQIARDASAQSPSLTIGRSDNFACKSPGKNPIVLLHGLFGSPQIELNEFEAWMRRQGYCTFAPFYGSYAPNIPI
LGGLKPISQSSKEIAAYIRDVLRRTGAAKIDLVGHSEGAFQVLYGPKFGGYASNVDNIVAIASPTHGTDLSRIYN
LVNIIPGLNRQILRRILQTVGCGACADLVPQGEAVTRLNDGRPIVQPGNTVTIITSRRDEIITPVETAFVNEPGV
RNLFVQEYCPNDISGHVGEAYDYSVWQLARNAIERNYNRPIDCSSFVLPIR*
Coding >Ophun1|7507
ATGCAGCAAATCGCCCGCGACGCCTCCGCCCAATCCCCCTCGCTAACAATCGGCCGCTCCGACAACTTCGCCTGC
AAATCCCCCGGCAAGAACCCCATCGTCCTGCTCCACGGCCTCTTCGGCAGCCCGCAGATCGAACTCAACGAGTTT
GAAGCCTGGATGCGCAGGCAGGGGTACTGCACCTTTGCCCCCTTTTACGGGAGCTATGCCCCCAACATCCCCATC
CTCGGCGGCTTGAAGCCCATCTCGCAGTCGTCCAAGGAGATTGCTGCTTATATACGGGATGTGCTTCGCCGGACG
GGGGCTGCAAAGATTGATCTTGTGGGACATTCTGAGGGGGCCTTTCAGGTCTTGTACGGACCCAAGTTCGGAGGG
TATGCCAGCAACGTTGACAACATCGTCGCCATCGCATCGCCTACACACGGAACCGACTTATCACGCATCTACAAC
CTCGTCAACATCATCCCCGGCCTCAACCGCCAGATCCTACGCCGTATCCTCCAGACTGTTGGTTGCGGTGCTTGC
GCCGATCTCGTCCCCCAGGGCGAGGCCGTCACGCGCCTCAACGATGGCCGGCCCATCGTCCAGCCCGGAAACACC
GTCACCATCATCACCTCACGACGGGATGAGATCATCACGCCCGTTGAGACGGCCTTTGTCAACGAGCCCGGTGTT
CGCAACCTGTTTGTTCAGGAATACTGCCCCAACGACATTTCAGGCCATGTGGGCGAGGCCTACGACTACAGCGTC
TGGCAACTTGCTCGCAATGCCATCGAGAGGAACTACAACCGCCCCATCGATTGTTCCAGCTTCGTGCTTCCTATC
CGTTGA
Transcript >Ophun1|7507
ATGCAGCAAATCGCCCGCGACGCCTCCGCCCAATCCCCCTCGCTAACAATCGGCCGCTCCGACAACTTCGCCTGC
AAATCCCCCGGCAAGAACCCCATCGTCCTGCTCCACGGCCTCTTCGGCAGCCCGCAGATCGAACTCAACGAGTTT
GAAGCCTGGATGCGCAGGCAGGGGTACTGCACCTTTGCCCCCTTTTACGGGAGCTATGCCCCCAACATCCCCATC
CTCGGCGGCTTGAAGCCCATCTCGCAGTCGTCCAAGGAGATTGCTGCTTATATACGGGATGTGCTTCGCCGGACG
GGGGCTGCAAAGATTGATCTTGTGGGACATTCTGAGGGGGCCTTTCAGGTCTTGTACGGACCCAAGTTCGGAGGG
TATGCCAGCAACGTTGACAACATCGTCGCCATCGCATCGCCTACACACGGAACCGACTTATCACGCATCTACAAC
CTCGTCAACATCATCCCCGGCCTCAACCGCCAGATCCTACGCCGTATCCTCCAGACTGTTGGTTGCGGTGCTTGC
GCCGATCTCGTCCCCCAGGGCGAGGCCGTCACGCGCCTCAACGATGGCCGGCCCATCGTCCAGCCCGGAAACACC
GTCACCATCATCACCTCACGACGGGATGAGATCATCACGCCCGTTGAGACGGCCTTTGTCAACGAGCCCGGTGTT
CGCAACCTGTTTGTTCAGGAATACTGCCCCAACGACATTTCAGGCCATGTGGGCGAGGCCTACGACTACAGCGTC
TGGCAACTTGCTCGCAATGCCATCGAGAGGAACTACAACCGCCCCATCGATTGTTCCAGCTTCGTGCTTCCTATC
CGTTGA
Gene >Ophun1|7507
ATGCAGCAAATCGCCCGCGACGCCTCCGCCCAATCCCCCTCGCTAACAATCGGCCGCTCCGACAACTTCGCCTGC
AAATCCCCCGGCAAGAACCCCATCGTCCTGCTCCACGGCCTCTTCGGCAGCCCGCAGATCGAACTCAACGAGTTT
GAAGCCTGGATGCGCAGGCAGGGGTACTGCACCTTTGCCCCCTTTTACGGGAGCTATGCCCCCAACATCCCCATC
CTCGGCGGCTTGAAGCCCATCTCGCAGTCGTCCAAGGAGATTGCTGCTTATATACGGGATGTGCTTCGCCGGACG
GGGGCTGCAAAGATTGATCTTGTGGGACATTCTGAGGGGGCCTTTCAGGTCTTGTACGGACCCAAGTTCGGAGGG
TATGCCAGCAACGTTGACAACATCGTCGCCATCGCATCGCCTACACACGGAACCGACTTATCACGCATCTACAAC
CTCGTCAACATCATCCCCGGCCTCAACCGCCAGATCCTACGCCGTATCCTCCAGACTGTTGGTTGCGGTGCTTGC
GCCGATCTCGTCCCCCAGGGCGAGGCCGTCACGCGCCTCAACGATGGCCGGCCCATCGTCCAGCCCGGAAACACC
GTCACCATCATCACCTCACGACGGGATGAGATCATCACGCCCGTTGAGACGGCCTTTGTCAACGAGCCCGGTGTT
CGCAACCTGTTTGTTCAGGAATACTGCCCCAACGACATTTCAGGCCATGTGGGCGAGGCCTACGACTACAGCGTC
TGGCAACTTGCTCGCAATGCCATCGAGAGGAACTACAACCGCCCCATCGATTGTTCCAGCTTCGTGCTTCCTATC
CGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail