Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7504
Gene name
LocationContig_96:6049..7579
Strand-
Gene length (bp)1530
Transcript length (bp)1125
Coding sequence length (bp)1125
Protein length (aa) 375

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14474 RTC4 RTC4-like domain 4.4E-32 257 368

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1906
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2858
Ophiocordyceps australis map64 (Brazil) OphauB2|2247
Ophiocordyceps camponoti-floridani Ophcf2|05106
Ophiocordyceps camponoti-rufipedis Ophun1|7504 (this protein)
Ophiocordyceps kimflemingae Ophio5|2777
Ophiocordyceps subramaniannii Hirsu2|2

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7504
MVKKLDRRVGMSRYGRHNAEPLLKTIAGSTSTRNAANRSKPLPKKEVADTDPPLSSDDEDCTDSAAGDEHRIPSS
SGDEEAPESDIRRTRFGASSKLGKRKREDQAKDTTNAPSESFKPVSLDFACELVDSSPPAKRASIRVPTDGDDHT
IDTILSDGEERKDGPSPVYQVDDIESSPQATVTVCPWCGAAVDKSSLDTFSKGRQMNVRLLKKFCHNHKKKTAEE
TWQAMKYPEVDWKGLVDRFKTHHSHLLGIIDGKESYYRNNLAAKIERGEARSMKKEGNLIPGYYGFRGFDLMCDY
LVEEFGELLKRRAVKDRVIAGRGAAAFIQCVLVAELAVRLIRDDMGVSENKAREIMEESKAVGEMLHDEAVGDE*
Coding >Ophun1|7504
ATGGTCAAGAAGTTAGATCGAAGAGTCGGCATGTCTCGTTATGGTCGTCACAACGCAGAACCACTTCTCAAGACT
ATAGCCGGTTCGACGTCAACGAGAAACGCCGCCAACCGCTCTAAACCACTGCCGAAGAAAGAGGTCGCCGACACC
GATCCTCCACTGTCCAGCGATGACGAAGACTGCACCGACAGCGCGGCCGGTGATGAACACCGCATTCCCAGCAGC
TCTGGCGACGAGGAGGCACCGGAATCTGACATTCGACGAACCAGGTTTGGTGCAAGCTCCAAGCTAGGGAAGCGG
AAGCGGGAGGATCAAGCCAAGGATACGACGAATGCGCCATCGGAAAGCTTCAAGCCAGTGTCTTTGGATTTCGCC
TGTGAGTTGGTGGACAGCTCGCCGCCTGCAAAACGGGCTTCTATCAGGGTCCCTACCGATGGCGATGACCATACG
ATAGACACGATACTCTCCGACGGGGAAGAGCGAAAAGACGGCCCTTCACCTGTGTACCAAGTCGACGATATCGAG
TCGAGTCCTCAAGCGACCGTGACAGTGTGTCCGTGGTGCGGAGCTGCCGTCGATAAGTCGTCACTGGATACTTTC
TCCAAGGGCAGACAGATGAATGTGCGGCTACTGAAAAAGTTTTGTCACAACCACAAGAAAAAGACGGCCGAGGAG
ACGTGGCAGGCCATGAAGTACCCCGAGGTGGATTGGAAGGGCCTGGTGGACCGCTTCAAGACGCATCACAGCCAT
CTCCTTGGCATCATCGACGGCAAGGAATCATATTATCGGAACAATCTCGCGGCCAAGATTGAGCGCGGAGAGGCA
AGGTCGATGAAGAAGGAAGGCAATTTGATCCCGGGATACTACGGGTTCCGGGGCTTTGATCTCATGTGCGACTAT
CTCGTCGAAGAGTTTGGCGAGCTGCTCAAGCGCAGGGCCGTCAAGGATCGCGTCATCGCCGGTCGGGGAGCGGCG
GCTTTTATCCAGTGCGTTCTGGTGGCTGAACTGGCCGTGAGGCTCATTCGCGACGACATGGGCGTTTCGGAGAAC
AAGGCCAGGGAGATTATGGAGGAGAGTAAGGCGGTGGGGGAGATGCTTCACGATGAGGCTGTGGGAGACGAGTGA
Transcript >Ophun1|7504
ATGGTCAAGAAGTTAGATCGAAGAGTCGGCATGTCTCGTTATGGTCGTCACAACGCAGAACCACTTCTCAAGACT
ATAGCCGGTTCGACGTCAACGAGAAACGCCGCCAACCGCTCTAAACCACTGCCGAAGAAAGAGGTCGCCGACACC
GATCCTCCACTGTCCAGCGATGACGAAGACTGCACCGACAGCGCGGCCGGTGATGAACACCGCATTCCCAGCAGC
TCTGGCGACGAGGAGGCACCGGAATCTGACATTCGACGAACCAGGTTTGGTGCAAGCTCCAAGCTAGGGAAGCGG
AAGCGGGAGGATCAAGCCAAGGATACGACGAATGCGCCATCGGAAAGCTTCAAGCCAGTGTCTTTGGATTTCGCC
TGTGAGTTGGTGGACAGCTCGCCGCCTGCAAAACGGGCTTCTATCAGGGTCCCTACCGATGGCGATGACCATACG
ATAGACACGATACTCTCCGACGGGGAAGAGCGAAAAGACGGCCCTTCACCTGTGTACCAAGTCGACGATATCGAG
TCGAGTCCTCAAGCGACCGTGACAGTGTGTCCGTGGTGCGGAGCTGCCGTCGATAAGTCGTCACTGGATACTTTC
TCCAAGGGCAGACAGATGAATGTGCGGCTACTGAAAAAGTTTTGTCACAACCACAAGAAAAAGACGGCCGAGGAG
ACGTGGCAGGCCATGAAGTACCCCGAGGTGGATTGGAAGGGCCTGGTGGACCGCTTCAAGACGCATCACAGCCAT
CTCCTTGGCATCATCGACGGCAAGGAATCATATTATCGGAACAATCTCGCGGCCAAGATTGAGCGCGGAGAGGCA
AGGTCGATGAAGAAGGAAGGCAATTTGATCCCGGGATACTACGGGTTCCGGGGCTTTGATCTCATGTGCGACTAT
CTCGTCGAAGAGTTTGGCGAGCTGCTCAAGCGCAGGGCCGTCAAGGATCGCGTCATCGCCGGTCGGGGAGCGGCG
GCTTTTATCCAGTGCGTTCTGGTGGCTGAACTGGCCGTGAGGCTCATTCGCGACGACATGGGCGTTTCGGAGAAC
AAGGCCAGGGAGATTATGGAGGAGAGTAAGGCGGTGGGGGAGATGCTTCACGATGAGGCTGTGGGAGACGAGTGA
Gene >Ophun1|7504
ATGGTCAAGAAGTTAGATCGAAGAGTCGGCATGTCTCGTTATGGTCGTCACAACGCAGAACCACTTCTCAAGACT
ATAGCCGGTTCGACGTCAACGAGAAACGCCGCCAACCGCTCTAAACCACTGCCGAAGAAAGAGGTCGCCGACACC
GATCCTCCACTGTCCAGCGATGACGAAGACTGCACCGACAGCGCGGCCGGTGATGGTACGCGCGGGACCCCCGAT
TCCAGACGTGGCTCTCGACTTGGCTCTCCGTCTCGGTCTTCTCAAGAACACCGCATTCCCAGCAGCTCTGGCGAC
GAGGAGGCACCGGAATCTGACATTCGACGAACCAGGTTTGGTGCAAGCTCCAAGCTAGGGAAGCGGAAGCGGGAG
GATCAAGCCAAGGATACGACGAATGCGCCATCGGAAAGCTTCAAGCCAGTGGGCAGTTCCGCCCAACGGCGTCAG
GAAGCATCCCAGGCTTCAATCGCGGGCAGAAATGAGCGCCAATTACTACTACCTCCAAAGCCAAAGACGTCCACA
CAAACATACGGGAAGAAAAAGGTGGCGAGATCAAGCAACCTTTCCGACAGGAGGAAAGGTGAAGTTGCCAAGCCA
CAGAAACCAACGGCTCGGACGGCTACGGAATCAATCGTTGAATTGCAGCCTCTCCCCGACTTGCCCTCGTGTGAT
CTTCTTTCCAGCCCCGAGCATAGCAAAGCCCGGTCCTCCAAACTAAATGTGCCTGCTTCACCACCACGATCCCCA
ACCGGTCTGCAGGTGTCTTTGGATTTCGCCTGTGAGTTGGTGGACAGCTCGCCGCCTGCAAAACGGGCTTCTATC
AGGGTCCCTACCGATGGCGATGACCATACGATAGACACGATACTCTCCGACGGGGAAGAGCGAAAAGACGGCCCT
TCACCTGTGTACCAAGTCGACGATATCGAGTCGAGTCCTCAAGCGACCGTGACAGTGTGTCCGTGGTGCGGAGCT
GCCGTCGATAAGTCGTCACTGGATACTTTCTCCAAGGGCAGACAGATGAATGTGCGGCTACTGAAAAAGTTTTGT
CACAACCACAAGAAAAAGACGGCCGAGGAGACGTGGCAGGCCATGAAGTACCCCGAGGTGGATTGGAAGGGCCTG
GTGGACCGCTTCAAGACGCATCACAGCCATCTCCTTGGCATCATCGACGGCAAGGAATCATATTATCGGAACAAT
CTCGCGGCCAAGATTGAGCGCGGAGAGGCAAGGTCGATGAAGAAGGAAGGCAATTTGATCCCGGGATACTACGGG
TTCCGGGGCTTTGATCTCATGTGCGACTATCTCGTCGAAGAGTTTGGCGAGCTGCTCAAGCGCAGGGCCGTCAAG
GATCGCGTCATCGCCGGTCGGGGAGCGGCGGCTTTTATCCAGTGCGTTCTGGTGGCTGAACTGGCCGTGAGGCTC
ATTCGCGACGACATGGGCGTTTCGGAGAACAAGGCCAGGGAGATTATGGAGGAGAGTAAGGCGGTGGGGGAGATG
CTTCACGATGAGGCTGTGGGAGACGAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail