Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7502
Gene name
LocationContig_959:4314..4920
Strand+
Gene length (bp)606
Transcript length (bp)546
Coding sequence length (bp)546
Protein length (aa) 182

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01565 FAD_binding_4 FAD binding domain 1.2E-20 66 175

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D7UQ40|SOL5_ALTSO Bifunctional solanapyrone synthase OS=Alternaria solani GN=sol5 PE=1 SV=1 28 157 6.0E-18
sp|D4B1P2|A2372_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02372 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02372 PE=1 SV=1 31 148 3.0E-10
sp|P58710|GGLO_MOUSE L-gulonolactone oxidase OS=Mus musculus GN=Gulo PE=1 SV=3 48 167 6.0E-08
sp|Q3ZC33|GGLO_BOVIN L-gulonolactone oxidase OS=Bos taurus GN=GULO PE=2 SV=3 48 167 2.0E-06
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 43 136 1.0E-05

GO

GO Term Description Terminal node
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0016491 oxidoreductase activity Yes
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0000166 nucleotide binding No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:1901363 heterocyclic compound binding No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7502
MLAPTALLTSLVVARVSAQQQPASTPWELACLHLGVVSSTATIFPWSRGYSAISEQNWSGTARAKPACIVRPENA
SQVQTVVRLLSRRRVPFAIRSGGHNPAPGAASIKDGVLLDLSRLDDLVYESGNKTVTVGTGNKWTAVYSLLDQHD
VTVVGGRILDVGVGGLLLGSKSSPRADIGCR*
Coding >Ophun1|7502
ATGCTGGCTCCAACAGCCCTCCTGACCTCCCTCGTCGTCGCCCGGGTCTCCGCCCAGCAACAGCCAGCCTCGACG
CCCTGGGAGCTCGCCTGCCTCCATCTCGGCGTCGTCTCGTCCACAGCCACCATCTTCCCCTGGAGCAGAGGCTAC
AGTGCCATCAGCGAGCAGAACTGGTCCGGAACCGCCAGGGCCAAGCCGGCATGCATCGTCCGGCCCGAGAACGCG
TCTCAGGTTCAGACGGTTGTTCGGCTTCTCTCCCGCAGACGCGTGCCCTTCGCCATCCGATCGGGGGGACATAAT
CCTGCCCCCGGGGCGGCCAGTATCAAGGACGGCGTCTTGCTGGATCTGAGTCGGTTGGATGACCTCGTCTATGAG
TCTGGTAACAAGACGGTGACTGTAGGGACGGGCAACAAGTGGACGGCTGTCTACTCTCTCCTTGATCAGCATGAC
GTGACCGTCGTAGGCGGTAGGATCCTCGACGTCGGCGTCGGCGGCCTCCTGCTGGGAAGCAAGTCATCTCCCCGT
GCAGATATTGGCTGCCGCTGA
Transcript >Ophun1|7502
ATGCTGGCTCCAACAGCCCTCCTGACCTCCCTCGTCGTCGCCCGGGTCTCCGCCCAGCAACAGCCAGCCTCGACG
CCCTGGGAGCTCGCCTGCCTCCATCTCGGCGTCGTCTCGTCCACAGCCACCATCTTCCCCTGGAGCAGAGGCTAC
AGTGCCATCAGCGAGCAGAACTGGTCCGGAACCGCCAGGGCCAAGCCGGCATGCATCGTCCGGCCCGAGAACGCG
TCTCAGGTTCAGACGGTTGTTCGGCTTCTCTCCCGCAGACGCGTGCCCTTCGCCATCCGATCGGGGGGACATAAT
CCTGCCCCCGGGGCGGCCAGTATCAAGGACGGCGTCTTGCTGGATCTGAGTCGGTTGGATGACCTCGTCTATGAG
TCTGGTAACAAGACGGTGACTGTAGGGACGGGCAACAAGTGGACGGCTGTCTACTCTCTCCTTGATCAGCATGAC
GTGACCGTCGTAGGCGGTAGGATCCTCGACGTCGGCGTCGGCGGCCTCCTGCTGGGAAGCAAGTCATCTCCCCGT
GCAGATATTGGCTGCCGCTGA
Gene >Ophun1|7502
ATGCTGGCTCCAACAGCCCTCCTGACCTCCCTCGTCGTCGCCCGGGTCTCCGCCCAGCAACAGCCAGCCTCGACG
CCCTGGGAGCTCGCCTGCCTCCATCTCGGCGTCGTCTCGTCCACAGCCACCATCTTCCCCTGGAGCAGAGGCTAC
AGTGCCATCAGCGAGCAGAACTGGTGCGTCTCCTACATACATACATACACGGCCAGGCCCGCCAATTCGGCCCCC
CGTTGCAGGTCCGGAACCGCCAGGGCCAAGCCGGCATGCATCGTCCGGCCCGAGAACGCGTCTCAGGTTCAGACG
GTTGTTCGGCTTCTCTCCCGCAGACGCGTGCCCTTCGCCATCCGATCGGGGGGACATAATCCTGCCCCCGGGGCG
GCCAGTATCAAGGACGGCGTCTTGCTGGATCTGAGTCGGTTGGATGACCTCGTCTATGAGTCTGGTAACAAGACG
GTGACTGTAGGGACGGGCAACAAGTGGACGGCTGTCTACTCTCTCCTTGATCAGCATGACGTGACCGTCGTAGGC
GGTAGGATCCTCGACGTCGGCGTCGGCGGCCTCCTGCTGGGAAGCAAGTCATCTCCCCGTGCAGATATTGGCTGC
CGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail