Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7502
Gene name
LocationContig_959:4314..4920
Strand+
Gene length (bp)606
Transcript length (bp)546
Coding sequence length (bp)546
Protein length (aa) 182

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01565 FAD_binding_4 FAD binding domain 1.2E-20 66 175

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D7UQ40|SOL5_ALTSO Bifunctional solanapyrone synthase OS=Alternaria solani GN=sol5 PE=1 SV=1 28 157 6.0E-18
sp|D4B1P2|A2372_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02372 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02372 PE=1 SV=1 31 148 3.0E-10
sp|P58710|GGLO_MOUSE L-gulonolactone oxidase OS=Mus musculus GN=Gulo PE=1 SV=3 48 167 6.0E-08
sp|Q3ZC33|GGLO_BOVIN L-gulonolactone oxidase OS=Bos taurus GN=GULO PE=2 SV=3 48 167 2.0E-06
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 43 136 1.0E-05

GO

GO Term Description Terminal node
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0016491 oxidoreductase activity Yes
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0000166 nucleotide binding No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:1901363 heterocyclic compound binding No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 18 0.99887

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup23
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1466
Ophiocordyceps australis 1348a (Ghana) OphauG2|2796
Ophiocordyceps australis map64 (Brazil) OphauB2|3994
Ophiocordyceps australis map64 (Brazil) OphauB2|591
Ophiocordyceps australis map64 (Brazil) OphauB2|6458
Ophiocordyceps camponoti-floridani Ophcf2|06420
Ophiocordyceps camponoti-floridani Ophcf2|02533
Ophiocordyceps camponoti-floridani Ophcf2|04590
Ophiocordyceps camponoti-floridani Ophcf2|06808
Ophiocordyceps camponoti-rufipedis Ophun1|3755
Ophiocordyceps camponoti-rufipedis Ophun1|2002
Ophiocordyceps camponoti-rufipedis Ophun1|1119
Ophiocordyceps camponoti-rufipedis Ophun1|7502 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4159
Ophiocordyceps kimflemingae Ophio5|2066
Ophiocordyceps kimflemingae Ophio5|3352
Ophiocordyceps kimflemingae Ophio5|360
Ophiocordyceps kimflemingae Ophio5|4122
Ophiocordyceps kimflemingae Ophio5|5606
Ophiocordyceps subramaniannii Hirsu2|7822
Ophiocordyceps subramaniannii Hirsu2|6429
Ophiocordyceps subramaniannii Hirsu2|16
Ophiocordyceps subramaniannii Hirsu2|10639

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7502
MLAPTALLTSLVVARVSAQQQPASTPWELACLHLGVVSSTATIFPWSRGYSAISEQNWSGTARAKPACIVRPENA
SQVQTVVRLLSRRRVPFAIRSGGHNPAPGAASIKDGVLLDLSRLDDLVYESGNKTVTVGTGNKWTAVYSLLDQHD
VTVVGGRILDVGVGGLLLGSKSSPRADIGCR*
Coding >Ophun1|7502
ATGCTGGCTCCAACAGCCCTCCTGACCTCCCTCGTCGTCGCCCGGGTCTCCGCCCAGCAACAGCCAGCCTCGACG
CCCTGGGAGCTCGCCTGCCTCCATCTCGGCGTCGTCTCGTCCACAGCCACCATCTTCCCCTGGAGCAGAGGCTAC
AGTGCCATCAGCGAGCAGAACTGGTCCGGAACCGCCAGGGCCAAGCCGGCATGCATCGTCCGGCCCGAGAACGCG
TCTCAGGTTCAGACGGTTGTTCGGCTTCTCTCCCGCAGACGCGTGCCCTTCGCCATCCGATCGGGGGGACATAAT
CCTGCCCCCGGGGCGGCCAGTATCAAGGACGGCGTCTTGCTGGATCTGAGTCGGTTGGATGACCTCGTCTATGAG
TCTGGTAACAAGACGGTGACTGTAGGGACGGGCAACAAGTGGACGGCTGTCTACTCTCTCCTTGATCAGCATGAC
GTGACCGTCGTAGGCGGTAGGATCCTCGACGTCGGCGTCGGCGGCCTCCTGCTGGGAAGCAAGTCATCTCCCCGT
GCAGATATTGGCTGCCGCTGA
Transcript >Ophun1|7502
ATGCTGGCTCCAACAGCCCTCCTGACCTCCCTCGTCGTCGCCCGGGTCTCCGCCCAGCAACAGCCAGCCTCGACG
CCCTGGGAGCTCGCCTGCCTCCATCTCGGCGTCGTCTCGTCCACAGCCACCATCTTCCCCTGGAGCAGAGGCTAC
AGTGCCATCAGCGAGCAGAACTGGTCCGGAACCGCCAGGGCCAAGCCGGCATGCATCGTCCGGCCCGAGAACGCG
TCTCAGGTTCAGACGGTTGTTCGGCTTCTCTCCCGCAGACGCGTGCCCTTCGCCATCCGATCGGGGGGACATAAT
CCTGCCCCCGGGGCGGCCAGTATCAAGGACGGCGTCTTGCTGGATCTGAGTCGGTTGGATGACCTCGTCTATGAG
TCTGGTAACAAGACGGTGACTGTAGGGACGGGCAACAAGTGGACGGCTGTCTACTCTCTCCTTGATCAGCATGAC
GTGACCGTCGTAGGCGGTAGGATCCTCGACGTCGGCGTCGGCGGCCTCCTGCTGGGAAGCAAGTCATCTCCCCGT
GCAGATATTGGCTGCCGCTGA
Gene >Ophun1|7502
ATGCTGGCTCCAACAGCCCTCCTGACCTCCCTCGTCGTCGCCCGGGTCTCCGCCCAGCAACAGCCAGCCTCGACG
CCCTGGGAGCTCGCCTGCCTCCATCTCGGCGTCGTCTCGTCCACAGCCACCATCTTCCCCTGGAGCAGAGGCTAC
AGTGCCATCAGCGAGCAGAACTGGTGCGTCTCCTACATACATACATACACGGCCAGGCCCGCCAATTCGGCCCCC
CGTTGCAGGTCCGGAACCGCCAGGGCCAAGCCGGCATGCATCGTCCGGCCCGAGAACGCGTCTCAGGTTCAGACG
GTTGTTCGGCTTCTCTCCCGCAGACGCGTGCCCTTCGCCATCCGATCGGGGGGACATAATCCTGCCCCCGGGGCG
GCCAGTATCAAGGACGGCGTCTTGCTGGATCTGAGTCGGTTGGATGACCTCGTCTATGAGTCTGGTAACAAGACG
GTGACTGTAGGGACGGGCAACAAGTGGACGGCTGTCTACTCTCTCCTTGATCAGCATGACGTGACCGTCGTAGGC
GGTAGGATCCTCGACGTCGGCGTCGGCGGCCTCCTGCTGGGAAGCAAGTCATCTCCCCGTGCAGATATTGGCTGC
CGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail