Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7495
Gene name
LocationContig_957:74..1524
Strand-
Gene length (bp)1450
Transcript length (bp)1182
Coding sequence length (bp)1182
Protein length (aa) 394

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03223 V-ATPase_C V-ATPase subunit C 8.8E-123 5 386

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HDW6|VATC_SCHPO V-type proton ATPase subunit C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vma5 PE=1 SV=1 36 388 2.0E-77
sp|P31412|VATC_YEAST V-type proton ATPase subunit C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VMA5 PE=1 SV=4 2 392 6.0E-75
sp|Q5RDQ7|VATC1_PONAB V-type proton ATPase subunit C 1 OS=Pongo abelii GN=ATP6V1C1 PE=2 SV=1 27 391 3.0E-68
sp|Q4R5H9|VATC1_MACFA V-type proton ATPase subunit C 1 OS=Macaca fascicularis GN=ATP6V1C1 PE=2 SV=1 27 391 3.0E-68
sp|P21283|VATC1_HUMAN V-type proton ATPase subunit C 1 OS=Homo sapiens GN=ATP6V1C1 PE=1 SV=4 27 391 3.0E-68
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HDW6|VATC_SCHPO V-type proton ATPase subunit C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vma5 PE=1 SV=1 36 388 2.0E-77
sp|P31412|VATC_YEAST V-type proton ATPase subunit C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VMA5 PE=1 SV=4 2 392 6.0E-75
sp|Q5RDQ7|VATC1_PONAB V-type proton ATPase subunit C 1 OS=Pongo abelii GN=ATP6V1C1 PE=2 SV=1 27 391 3.0E-68
sp|Q4R5H9|VATC1_MACFA V-type proton ATPase subunit C 1 OS=Macaca fascicularis GN=ATP6V1C1 PE=2 SV=1 27 391 3.0E-68
sp|P21283|VATC1_HUMAN V-type proton ATPase subunit C 1 OS=Homo sapiens GN=ATP6V1C1 PE=1 SV=4 27 391 3.0E-68
sp|Q7T385|VTC1A_DANRE V-type proton ATPase subunit C 1-A OS=Danio rerio GN=atp6v1c1a PE=2 SV=1 27 391 1.0E-67
sp|P21282|VATC1_BOVIN V-type proton ATPase subunit C 1 OS=Bos taurus GN=ATP6V1C1 PE=1 SV=3 27 391 2.0E-67
sp|Q5XH14|VATC1_XENLA V-type proton ATPase subunit C 1 OS=Xenopus laevis GN=atp6v1c1 PE=2 SV=1 27 391 3.0E-67
sp|Q5FVI6|VATC1_RAT V-type proton ATPase subunit C 1 OS=Rattus norvegicus GN=Atp6v1c1 PE=2 SV=1 27 391 5.0E-67
sp|Q9Z1G3|VATC1_MOUSE V-type proton ATPase subunit C 1 OS=Mus musculus GN=Atp6v1c1 PE=1 SV=4 27 391 3.0E-66
sp|Q6P4Y9|VATC1_XENTR V-type proton ATPase subunit C 1 OS=Xenopus tropicalis GN=atp6v1c1 PE=2 SV=1 27 391 4.0E-66
sp|Q9U5N1|VATC_MANSE V-type proton ATPase subunit C OS=Manduca sexta PE=2 SV=1 41 392 4.0E-65
sp|Q9NDR5|VATC_ASCSS V-type proton ATPase subunit C 2 OS=Ascidia sydneiensis samea GN=VATC PE=2 SV=1 41 392 1.0E-64
sp|Q5XIY6|VTC1B_DANRE V-type proton ATPase subunit C 1-B OS=Danio rerio GN=atp6v1c1b PE=2 SV=1 41 392 6.0E-64
sp|Q612A4|VATC_CAEBR V-type proton ATPase subunit C OS=Caenorhabditis briggsae GN=vha-11 PE=3 SV=1 4 392 7.0E-58
sp|Q8NEY4|VATC2_HUMAN V-type proton ATPase subunit C 2 OS=Homo sapiens GN=ATP6V1C2 PE=1 SV=2 41 392 1.0E-56
sp|Q9XXU9|VATC_CAEEL V-type proton ATPase subunit C OS=Caenorhabditis elegans GN=vha-11 PE=2 SV=1 4 392 5.0E-56
sp|Q6AYE4|VATC2_RAT V-type proton ATPase subunit C 2 OS=Rattus norvegicus GN=Atp6v1c2 PE=2 SV=1 41 392 6.0E-56
sp|Q99L60|VATC2_MOUSE V-type proton ATPase subunit C 2 OS=Mus musculus GN=Atp6v1c2 PE=1 SV=1 41 392 7.0E-56
sp|Q9SDS7|VATC_ARATH V-type proton ATPase subunit C OS=Arabidopsis thaliana GN=VHA-C PE=1 SV=1 1 385 3.0E-49
sp|Q9V7N5|VATC_DROME V-type proton ATPase subunit C OS=Drosophila melanogaster GN=Vha44 PE=2 SV=5 104 392 1.0E-46
sp|P54648|VATC_DICDI V-type proton ATPase subunit C OS=Dictyostelium discoideum GN=vatC PE=2 SV=1 41 347 2.0E-45
sp|Q9SCB9|VATC_HORVU V-type proton ATPase subunit C OS=Hordeum vulgare GN=VATC PE=1 SV=1 1 314 8.0E-42
sp|Q9V7N5|VATC_DROME V-type proton ATPase subunit C OS=Drosophila melanogaster GN=Vha44 PE=2 SV=5 41 100 2.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0046961 proton-transporting ATPase activity, rotational mechanism Yes
GO:0033180 proton-transporting V-type ATPase, V1 domain Yes
GO:1902600 proton transmembrane transport Yes
GO:0098796 membrane protein complex No
GO:0051179 localization No
GO:0009678 pyrophosphate hydrolysis-driven proton transmembrane transporter activity No
GO:0098660 inorganic ion transmembrane transport No
GO:0006812 cation transport No
GO:0006811 ion transport No
GO:0032991 protein-containing complex No
GO:0042625 ATPase-coupled ion transmembrane transporter activity No
GO:0022804 active transmembrane transporter activity No
GO:0051234 establishment of localization No
GO:0034220 ion transmembrane transport No
GO:0098655 cation transmembrane transport No
GO:0008324 cation transmembrane transporter activity No
GO:0009987 cellular process No
GO:0006810 transport No
GO:0098662 inorganic cation transmembrane transport No
GO:0019829 ATPase-coupled cation transmembrane transporter activity No
GO:0140657 ATP-dependent activity No
GO:0042626 ATPase-coupled transmembrane transporter activity No
GO:0055085 transmembrane transport No
GO:0005575 cellular_component No
GO:0044769 ATPase activity, coupled to transmembrane movement of ions, rotational mechanism No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0003674 molecular_function No
GO:0022853 active ion transmembrane transporter activity No
GO:0008150 biological_process No
GO:0033178 proton-transporting two-sector ATPase complex, catalytic domain No
GO:0015078 proton transmembrane transporter activity No
GO:0005215 transporter activity No
GO:0015399 primary active transmembrane transporter activity No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0015075 ion transmembrane transporter activity No
GO:0022857 transmembrane transporter activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1249
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3220
Ophiocordyceps australis map64 (Brazil) OphauB2|2658
Ophiocordyceps camponoti-floridani Ophcf2|00125
Ophiocordyceps camponoti-rufipedis Ophun1|7495 (this protein)
Ophiocordyceps kimflemingae Ophio5|3817
Ophiocordyceps subramaniannii Hirsu2|10464

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7495
MATKYALLSLPLGVFDSSNREDAISSLSATISPDNGSVVPFRIPDFKIGTLDALVQQADDLAKLEASCQAVVAKV
GDSLRQVLNDDEDRLASYKMVNDKPTDHYLRGFTWNKIRYRADKPLGELVDTLRKELVTVDNDVKQKFNHYNSVK
TNLAALQRRQTGNLSTKSLTPIIDPRLLVQDSEYIETHLIAVPKAASKEFLKTYETLSQMVVPRSAVEIDRDDEF
TLFAAATFKKFSADFVHKCREQKWTPRQYEYVEGGREEEQRELDKVTHEERKVCGEALRMGRTGWSESVMVWAHV
LTLRVFVEAVLRYGLPLEYVTVLIKTTPKLATKIKTALDSNYSYLGGNAFGRDKRGRVTKDDAAMTSEMAAAGLG
TGEGHEYTAYVYYELELP*
Coding >Ophun1|7495
ATGGCGACGAAATACGCCCTCCTCTCGCTGCCCCTCGGCGTCTTCGACTCAAGCAATCGCGAAGACGCCATCTCG
TCTCTGAGCGCCACCATCTCCCCAGACAACGGATCCGTCGTGCCCTTTCGGATTCCCGACTTCAAAATTGGCACT
CTCGATGCCCTCGTTCAGCAGGCCGACGACCTGGCTAAGCTCGAGGCTTCTTGCCAGGCCGTCGTGGCCAAGGTC
GGCGACTCTCTGCGCCAAGTCCTCAACGACGATGAAGATCGCCTGGCCTCGTACAAGATGGTCAACGACAAGCCG
ACGGACCACTACCTCCGCGGCTTCACCTGGAACAAGATTCGATATCGAGCAGATAAGCCTCTGGGTGAGCTTGTA
GACACGCTTCGAAAGGAGCTCGTCACCGTGGACAACGACGTCAAGCAAAAGTTCAACCACTACAATTCAGTCAAG
ACGAATCTCGCCGCCTTACAAAGACGTCAGACCGGCAACCTCTCCACCAAATCCTTGACCCCCATCATCGACCCC
CGACTGTTGGTACAGGACTCGGAATACATAGAGACGCACTTGATCGCCGTACCCAAAGCCGCCAGCAAAGAGTTC
CTCAAGACATACGAGACGCTGTCCCAAATGGTGGTGCCGCGATCGGCCGTCGAGATTGATCGCGACGACGAATTC
ACCCTATTCGCGGCGGCGACGTTCAAGAAGTTCAGCGCCGATTTTGTCCACAAGTGTCGCGAGCAAAAATGGACG
CCTCGGCAGTACGAGTACGTCGAGGGAGGGCGAGAGGAGGAGCAGCGCGAGCTGGACAAGGTCACACACGAAGAG
CGCAAGGTCTGCGGCGAGGCTCTCCGCATGGGGAGGACAGGATGGAGCGAGAGCGTCATGGTCTGGGCCCACGTC
CTGACGCTGAGAGTCTTTGTCGAAGCCGTTCTGCGCTACGGCCTGCCGCTGGAGTACGTGACGGTCTTGATCAAG
ACGACGCCCAAGCTGGCCACCAAGATCAAGACGGCCCTCGACTCCAACTATTCGTACCTTGGAGGCAACGCCTTC
GGCCGCGACAAACGGGGCCGGGTAACCAAAGACGACGCCGCCATGACCTCGGAGATGGCCGCGGCTGGGCTGGGC
ACTGGCGAAGGCCACGAGTACACGGCCTATGTCTACTACGAGCTGGAACTTCCTTGA
Transcript >Ophun1|7495
ATGGCGACGAAATACGCCCTCCTCTCGCTGCCCCTCGGCGTCTTCGACTCAAGCAATCGCGAAGACGCCATCTCG
TCTCTGAGCGCCACCATCTCCCCAGACAACGGATCCGTCGTGCCCTTTCGGATTCCCGACTTCAAAATTGGCACT
CTCGATGCCCTCGTTCAGCAGGCCGACGACCTGGCTAAGCTCGAGGCTTCTTGCCAGGCCGTCGTGGCCAAGGTC
GGCGACTCTCTGCGCCAAGTCCTCAACGACGATGAAGATCGCCTGGCCTCGTACAAGATGGTCAACGACAAGCCG
ACGGACCACTACCTCCGCGGCTTCACCTGGAACAAGATTCGATATCGAGCAGATAAGCCTCTGGGTGAGCTTGTA
GACACGCTTCGAAAGGAGCTCGTCACCGTGGACAACGACGTCAAGCAAAAGTTCAACCACTACAATTCAGTCAAG
ACGAATCTCGCCGCCTTACAAAGACGTCAGACCGGCAACCTCTCCACCAAATCCTTGACCCCCATCATCGACCCC
CGACTGTTGGTACAGGACTCGGAATACATAGAGACGCACTTGATCGCCGTACCCAAAGCCGCCAGCAAAGAGTTC
CTCAAGACATACGAGACGCTGTCCCAAATGGTGGTGCCGCGATCGGCCGTCGAGATTGATCGCGACGACGAATTC
ACCCTATTCGCGGCGGCGACGTTCAAGAAGTTCAGCGCCGATTTTGTCCACAAGTGTCGCGAGCAAAAATGGACG
CCTCGGCAGTACGAGTACGTCGAGGGAGGGCGAGAGGAGGAGCAGCGCGAGCTGGACAAGGTCACACACGAAGAG
CGCAAGGTCTGCGGCGAGGCTCTCCGCATGGGGAGGACAGGATGGAGCGAGAGCGTCATGGTCTGGGCCCACGTC
CTGACGCTGAGAGTCTTTGTCGAAGCCGTTCTGCGCTACGGCCTGCCGCTGGAGTACGTGACGGTCTTGATCAAG
ACGACGCCCAAGCTGGCCACCAAGATCAAGACGGCCCTCGACTCCAACTATTCGTACCTTGGAGGCAACGCCTTC
GGCCGCGACAAACGGGGCCGGGTAACCAAAGACGACGCCGCCATGACCTCGGAGATGGCCGCGGCTGGGCTGGGC
ACTGGCGAAGGCCACGAGTACACGGCCTATGTCTACTACGAGCTGGAACTTCCTTGA
Gene >Ophun1|7495
ATGGCGACGAAATACGCCCTCCTCTCGCTGCCCCTCGGCGTCTTCGACTCAAGCAATCGCGAAGACGCCATCTCG
TCTCTGAGCGCCACCATCTCCCCAGACAACGGATCCGTCGTGCCCTTTCGGATTCCCGACTTCAAAATTGGCACT
CTCGATGCCCTCGTTCAGCAGGCCGACGACCTGGCTAAGCTCGAGGCTTCTTGCCAGGCCGTCGTGGCCAAGGTC
GGCGACTCTCTGCGCCAAGTCCTCAACGACGATGAAGATCGCCTGGCCTCGTACAAGATGGTCAACGACAGTCGG
TGTCGATGGTTCCTCCCTCGCTCCGAGTATGTTGCTGACGAGTATGTGCAGAGCCGACGGACCACTACCTCCGCG
GCTTCACCTGGAACAAGATTCGATATCGAGCAGATAAGCCTCTGGGTGAGCTTGTAGACACGCTTCGAAAGGTTG
GCACCCTTTTGTCTTCACGGTGGGTTCGCACTGGCTGACCCATGAGGTGCCCAGGAGCTCGTCACCGTGGACAAC
GACGTCAAGCAAAAGTTCAACCACTACAATTCAGTCAAGACGAATCTCGCCGCCTTACAAAGACGTCAGACGTGA
GTAATGACGGCCCCTGCGAGGAGAGAATCAGAATCGCCTGAGGACACTGGCTGACATGTCGCCATGTTCGAGCCT
TGAAGCGGCAACCTCTCCACCAAATCCTTGACCCCCATCATCGACCCCCGACTGTTGGTACAGGACTCGGAATAC
ATAGAGACGCACTTGATCGCCGTACCCAAAGCCGCCAGCAAAGAGTTCCTCAAGACATACGAGACGCTGTCCCAA
ATGGTGGTGCCGCGATCGGCCGTCGAGATTGATCGCGACGACGAATTCACCCTATTCGCGGCGGCGACGTTCAAG
AAGTTCAGCGCCGATTTTGTCCACAAGTGTCGCGAGCAAAAATGGACGCCTCGGCAGTACGAGTACGTCGAGGGA
GGGCGAGAGGAGGAGCAGCGCGAGCTGGACAAGGTCACACACGAAGAGCGCAAGGTCTGCGGCGAGGCTCTCCGC
ATGGGGAGGACAGGATGGAGCGAGAGCGTCATGGTCTGGGCCCACGTCCTGACGCTGAGAGTCTTTGTCGAAGCC
GTTCTGCGCTACGGCCTGCCGCTGGAGTACGTGACGGTCTTGATCAAGGTTCGTCTTCCTGCTGCTCATCATGTT
TCCCGGGCCTGGACTGTTCAGCTGACGCGCCCGCCAACGCCAGACGACGCCCAAGCTGGCCACCAAGATCAAGAC
GGCCCTCGACTCCAACTATTCGTACCTTGGAGGCAACGCCTTCGGCCGCGACAAACGGGGCCGGGTAACCAAAGA
CGACGCCGCCATGACCTCGGAGATGGCCGCGGCTGGGCTGGGCACTGGCGAAGGCCACGAGTACACGGCCTATGT
CTACTACGAGCTGGAACTTCCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail