Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7483
Gene name
LocationContig_95:21136..28084
Strand+
Gene length (bp)6948
Transcript length (bp)6678
Coding sequence length (bp)6678
Protein length (aa) 2226

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00109 ketoacyl-synt Beta-ketoacyl synthase, N-terminal domain 4.7E-73 11 261
PF08659 KR KR domain 1.8E-67 1856 2034
PF00698 Acyl_transf_1 Acyl transferase domain 5.4E-60 538 862
PF14765 PS-DH Polyketide synthase dehydratase 3.4E-45 919 1232
PF02801 Ketoacyl-synt_C Beta-ketoacyl synthase, C-terminal domain 4.0E-36 271 387
PF16197 KAsynt_C_assoc Ketoacyl-synthetase C-terminal extension 4.3E-19 390 504
PF00106 adh_short short chain dehydrogenase 5.4E-19 1858 2016
PF00107 ADH_zinc_N Zinc-binding dehydrogenase 1.0E-16 1658 1771
PF13602 ADH_zinc_N_2 Zinc-binding dehydrogenase 3.1E-13 1698 1833
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 4.7E-13 1865 2017
PF08240 ADH_N Alcohol dehydrogenase GroES-like domain 1.7E-08 1541 1614
PF00550 PP-binding Phosphopantetheine attachment site 1.6E-05 2147 2210
PF02719 Polysacc_synt_2 Polysaccharide biosynthesis protein 1.2E-04 1859 1991

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 10 1272 0.0E+00
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 11 1175 4.0E-180
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 11 1172 9.0E-171
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 11 1186 6.0E-169
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 11 1031 4.0E-168
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 10 1272 0.0E+00
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 11 1175 4.0E-180
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 11 1172 9.0E-171
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 11 1186 6.0E-169
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 11 1031 4.0E-168
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 1318 2217 4.0E-146
sp|Q55E72|PKS1_DICDI Probable polyketide synthase 1 OS=Dictyostelium discoideum GN=stlA PE=1 SV=1 12 1147 3.0E-139
sp|Q02251|MCAS_MYCBO Mycocerosic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mas PE=1 SV=2 8 1024 1.0E-136
sp|P9WQE9|PHAS_MYCTU Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks2 PE=1 SV=1 8 1001 4.0E-136
sp|P9WQE8|PHAS_MYCTO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pks2 PE=3 SV=1 8 1001 4.0E-136
sp|A5U9F4|PHAS_MYCTA Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=pks2 PE=3 SV=1 8 1001 4.0E-136
sp|Q7TVK8|PHAS_MYCBO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks2 PE=3 SV=1 8 1001 4.0E-136
sp|A1KQG0|PHAS_MYCBP Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=pks2 PE=3 SV=1 8 1001 2.0E-135
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 11 1102 9.0E-135
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 11 902 7.0E-132
sp|P9WQE3|PPSD_MYCTU Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsD PE=1 SV=1 11 1141 9.0E-130
sp|P9WQE2|PPSD_MYCTO Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsD PE=3 SV=1 11 1141 9.0E-130
sp|Q7TXL7|PPSD_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsD PE=3 SV=1 11 1141 1.0E-129
sp|Q869W9|PKS16_DICDI Probable polyketide synthase 16 OS=Dictyostelium discoideum GN=pks16 PE=2 SV=1 12 1191 2.0E-129
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 12 902 5.0E-129
sp|Q869X2|PKS17_DICDI Probable polyketide synthase 17 OS=Dictyostelium discoideum GN=pks17 PE=3 SV=1 12 1191 5.0E-126
sp|Q7TXK8|MSL7_MYCBO Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks15/1 PE=1 SV=1 7 1102 2.0E-125
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 11 906 8.0E-125
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 11 902 1.0E-124
sp|P9WQE6|PPSA_MYCTO Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsA PE=3 SV=1 11 985 9.0E-123
sp|B2HIL7|MSL7_MYCMM Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=pks15/1 PE=1 SV=1 7 1102 1.0E-122
sp|P9WQE7|PPSA_MYCTU Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsA PE=1 SV=1 11 985 2.0E-122
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 7 830 3.0E-122
sp|Q7TXM0|PPSA_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsA PE=1 SV=1 11 985 3.0E-122
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 7 902 2.0E-121
sp|B0G100|PKS7_DICDI Probable polyketide synthase 7 OS=Dictyostelium discoideum GN=pks7 PE=3 SV=1 12 1002 1.0E-120
sp|Q7TXL9|PPSB_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsB PE=1 SV=1 11 905 6.0E-119
sp|P9WQE5|PPSB_MYCTU Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsB PE=1 SV=1 11 905 8.0E-119
sp|P9WQE4|PPSB_MYCTO Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsB PE=3 SV=1 11 905 8.0E-119
sp|Q54QD3|PKS22_DICDI Probable polyketide synthase 22 OS=Dictyostelium discoideum GN=pks22 PE=3 SV=1 12 1147 2.0E-118
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 11 902 3.0E-118
sp|Q86AE3|PKS9_DICDI Probable polyketide synthase 9/36 OS=Dictyostelium discoideum GN=pks9 PE=2 SV=1 12 1002 1.0E-116
sp|B4XYB8|AZIB_STREG 5-methyl-1-naphthoate synthase OS=Streptomyces sahachiroi GN=aziB PE=1 SV=1 11 1009 3.0E-116
sp|Q86JI5|PKS5_DICDI Probable polyketide synthase 5 OS=Dictyostelium discoideum GN=pks5 PE=2 SV=1 7 1002 1.0E-115
sp|B0G0Z9|PKS6_DICDI Probable polyketide synthase 6 OS=Dictyostelium discoideum GN=pks6 PE=3 SV=1 12 1002 3.0E-115
sp|Q54QD1|PKS23_DICDI Probable polyketide synthase 23 OS=Dictyostelium discoideum GN=pks23 PE=3 SV=1 12 1147 8.0E-115
sp|B0G101|PKS8_DICDI Probable polyketide synthase 8/35 OS=Dictyostelium discoideum GN=pks8 PE=3 SV=1 12 1002 4.0E-111
sp|Q55DM7|PKS2_DICDI Probable polyketide synthase 2 OS=Dictyostelium discoideum GN=pks2 PE=3 SV=1 1 1179 4.0E-110
sp|Q54KU3|PKS25_DICDI Probable polyketide synthase 25 OS=Dictyostelium discoideum GN=pks25 PE=3 SV=1 12 1147 8.0E-110
sp|Q54B49|PKS45_DICDI Probable polyketide synthase 45 OS=Dictyostelium discoideum GN=pks45 PE=3 SV=2 12 1147 2.0E-109
sp|Q55CN6|PKS3_DICDI Probable polyketide synthase 3 OS=Dictyostelium discoideum GN=pks3 PE=3 SV=1 20 1147 2.0E-109
sp|Q71SP7|FAS_BOVIN Fatty acid synthase OS=Bos taurus GN=FASN PE=2 SV=1 12 993 2.0E-109
sp|Q54B51|PKS44_DICDI Probable polyketide synthase 44 OS=Dictyostelium discoideum GN=pks44 PE=3 SV=1 12 1147 2.0E-108
sp|P19096|FAS_MOUSE Fatty acid synthase OS=Mus musculus GN=Fasn PE=1 SV=2 12 968 2.0E-107
sp|Q558Y6|PKS14_DICDI Probable polyketide synthase 14 OS=Dictyostelium discoideum GN=pks14 PE=3 SV=2 12 1002 2.0E-107
sp|P12785|FAS_RAT Fatty acid synthase OS=Rattus norvegicus GN=Fasn PE=1 SV=3 12 968 3.0E-107
sp|P49327|FAS_HUMAN Fatty acid synthase OS=Homo sapiens GN=FASN PE=1 SV=3 12 968 4.0E-107
sp|P96202|PPSC_MYCTU Phthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsC PE=1 SV=2 11 1102 6.0E-107
sp|Q7TXL8|PPSC_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsC PE=1 SV=1 11 1102 6.0E-107
sp|Q559A9|PKS13_DICDI Probable polyketide synthase 13 OS=Dictyostelium discoideum GN=pks13 PE=3 SV=1 12 1002 4.0E-106
sp|P22367|MSAS_PENPA 6-methylsalicylic acid synthase OS=Penicillium patulum PE=1 SV=1 12 965 3.0E-104
sp|Q54ED6|PKS41_DICDI Probable polyketide synthase 41 OS=Dictyostelium discoideum GN=pks41 PE=3 SV=1 12 1035 4.0E-104
sp|Q54ED7|PKS40_DICDI Probable polyketide synthase 40 OS=Dictyostelium discoideum GN=pks40 PE=3 SV=1 12 1035 1.0E-103
sp|Q03149|WA_EMENI Conidial yellow pigment biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=wA PE=1 SV=2 1 906 2.0E-103
sp|Q54TW0|PKS18_DICDI Probable polyketide synthase 18 OS=Dictyostelium discoideum GN=pks18 PE=2 SV=1 12 1002 9.0E-103
sp|P12276|FAS_CHICK Fatty acid synthase OS=Gallus gallus GN=FASN PE=1 SV=5 12 902 2.0E-102
sp|B0G103|PKS10_DICDI Probable polyketide synthase 10 OS=Dictyostelium discoideum GN=pks10 PE=3 SV=1 12 1147 9.0E-102
sp|Q54T36|PKS19_DICDI Probable polyketide synthase 19 OS=Dictyostelium discoideum GN=pks19 PE=3 SV=1 12 1050 2.0E-101
sp|B0G138|PKS21_DICDI Probable polyketide synthase 21 OS=Dictyostelium discoideum GN=pks21 PE=3 SV=1 12 1052 2.0E-101
sp|Q54IX3|PKS26_DICDI Probable polyketide synthase 26 OS=Dictyostelium discoideum GN=pks26 PE=3 SV=1 1 1002 3.0E-100
sp|Q12397|STCA_EMENI Putative sterigmatocystin biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcA PE=3 SV=2 3 920 2.0E-99
sp|Q12053|PKSL1_ASPPA Noranthrone synthase OS=Aspergillus parasiticus GN=pksL1 PE=1 SV=1 12 902 3.0E-96
sp|Q54D44|PKS42_DICDI Probable polyketide synthase 42 OS=Dictyostelium discoideum GN=pks42 PE=3 SV=2 12 1147 5.0E-94
sp|Q54FQ2|PKS30_DICDI Probable polyketide synthase 30 OS=Dictyostelium discoideum GN=pks30 PE=3 SV=1 12 1003 2.0E-90
sp|B0G170|PKS28_DICDI Probable polyketide synthase 28 OS=Dictyostelium discoideum GN=pks28 PE=3 SV=1 5 866 7.0E-89
sp|Q54FQ3|PKS29_DICDI Probable polyketide synthase 29 OS=Dictyostelium discoideum GN=pks29 PE=3 SV=1 12 1147 7.0E-89
sp|Q54FN7|PKS33_DICDI Probable polyketide synthase 33 OS=Dictyostelium discoideum GN=pks33 PE=3 SV=2 4 1147 1.0E-88
sp|Q54G30|PKS27_DICDI Probable polyketide synthase 27 OS=Dictyostelium discoideum GN=pks27 PE=3 SV=1 81 1147 1.0E-88
sp|Q54FN2|PKS34_DICDI Probable polyketide synthase 34 OS=Dictyostelium discoideum GN=pks34 PE=3 SV=1 12 1147 6.0E-88
sp|P96284|PKS15_MYCTU Putative inactive phenolphthiocerol synthesis polyketide synthase type I Pks15 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks15 PE=1 SV=2 7 432 7.0E-88
sp|P96202|PPSC_MYCTU Phthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsC PE=1 SV=2 1514 2209 2.0E-87
sp|Q7TXL8|PPSC_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsC PE=1 SV=1 1514 2209 2.0E-87
sp|Q54FD2|PKS38_DICDI Probable polyketide synthase 38 OS=Dictyostelium discoideum GN=pks38 PE=3 SV=1 12 1147 1.0E-86
sp|Q02251|MCAS_MYCBO Mycocerosic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mas PE=1 SV=2 1417 2189 6.0E-86
sp|Q54FP8|PKS32_DICDI Probable polyketide synthase 32 OS=Dictyostelium discoideum GN=pks32 PE=3 SV=1 12 1003 8.0E-86
sp|Q54FQ1|PKS31_DICDI Probable polyketide synthase 31 OS=Dictyostelium discoideum GN=pks31 PE=3 SV=1 13 1003 3.0E-85
sp|Q54FC8|PKS39_DICDI Probable polyketide synthase 39 OS=Dictyostelium discoideum GN=pks39 PE=3 SV=1 12 866 3.0E-85
sp|P9WQE9|PHAS_MYCTU Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks2 PE=1 SV=1 1417 2189 5.0E-85
sp|P9WQE8|PHAS_MYCTO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pks2 PE=3 SV=1 1417 2189 5.0E-85
sp|A5U9F4|PHAS_MYCTA Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=pks2 PE=3 SV=1 1417 2189 5.0E-85
sp|Q7TVK8|PHAS_MYCBO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks2 PE=3 SV=1 1417 2189 5.0E-85
sp|A1KQG0|PHAS_MYCBP Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=pks2 PE=3 SV=1 1417 2189 5.0E-85
sp|P9WQE1|PPSE_MYCTU Phthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsE PE=1 SV=1 12 824 1.0E-84
sp|P9WQE0|PPSE_MYCTO Phthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsE PE=3 SV=1 12 824 1.0E-84
sp|Q7TXL6|PPSE_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsE PE=1 SV=1 12 824 1.0E-84
sp|P96285|PKS1_MYCTU Putative inactive phenolphthiocerol synthesis polyketide synthase type I Pks1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks1 PE=1 SV=4 1516 2184 1.0E-79
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 12 520 3.0E-79
sp|Q7TXK8|MSL7_MYCBO Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks15/1 PE=1 SV=1 1516 2184 5.0E-79
sp|B2HIL7|MSL7_MYCMM Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=pks15/1 PE=1 SV=1 1516 2184 7.0E-76
sp|Q55E72|PKS1_DICDI Probable polyketide synthase 1 OS=Dictyostelium discoideum GN=stlA PE=1 SV=1 1418 2196 2.0E-75
sp|Q54FI3|PKS37_DICDI Probable polyketide synthase 37 OS=Dictyostelium discoideum GN=stlB PE=2 SV=1 8 425 4.0E-75
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 12 522 4.0E-75
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 1523 2187 6.0E-75
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 12 520 1.0E-72
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 1 520 1.0E-72
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 11 525 4.0E-72
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 12 519 3.0E-69
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 9 525 1.0E-68
sp|Q54FI3|PKS37_DICDI Probable polyketide synthase 37 OS=Dictyostelium discoideum GN=stlB PE=2 SV=1 1542 2076 6.0E-68
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 12 522 5.0E-67
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 11 520 5.0E-67
sp|P19096|FAS_MOUSE Fatty acid synthase OS=Mus musculus GN=Fasn PE=1 SV=2 1517 2050 6.0E-67
sp|P12785|FAS_RAT Fatty acid synthase OS=Rattus norvegicus GN=Fasn PE=1 SV=3 1517 2041 9.0E-66
sp|Q869W9|PKS16_DICDI Probable polyketide synthase 16 OS=Dictyostelium discoideum GN=pks16 PE=2 SV=1 1505 2196 1.0E-65
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 12 546 1.0E-65
sp|Q869X2|PKS17_DICDI Probable polyketide synthase 17 OS=Dictyostelium discoideum GN=pks17 PE=3 SV=1 1527 2196 1.0E-64
sp|P49327|FAS_HUMAN Fatty acid synthase OS=Homo sapiens GN=FASN PE=1 SV=3 1552 2050 5.0E-64
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 12 433 1.0E-63
sp|Q558W4|PKS15_DICDI Probable polyketide synthase 15 OS=Dictyostelium discoideum GN=pks15 PE=3 SV=2 12 434 2.0E-63
sp|P12276|FAS_CHICK Fatty acid synthase OS=Gallus gallus GN=FASN PE=1 SV=5 1517 2050 7.0E-63
sp|Q71SP7|FAS_BOVIN Fatty acid synthase OS=Bos taurus GN=FASN PE=2 SV=1 1615 2067 1.0E-62
sp|P36189|FAS_ANSAN Fatty acid synthase (Fragment) OS=Anser anser anser GN=FASN PE=1 SV=1 12 379 1.0E-60
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 12 433 5.0E-59
sp|O31784|PKSR_BACSU Polyketide synthase PksR OS=Bacillus subtilis (strain 168) GN=pksR PE=1 SV=2 12 521 7.0E-58
sp|Q54KU5|PKS24_DICDI Probable polyketide synthase 24 OS=Dictyostelium discoideum GN=pks24 PE=3 SV=1 12 434 1.0E-56
sp|Q55CN6|PKS3_DICDI Probable polyketide synthase 3 OS=Dictyostelium discoideum GN=pks3 PE=3 SV=1 1536 2206 3.0E-54
sp|O31784|PKSR_BACSU Polyketide synthase PksR OS=Bacillus subtilis (strain 168) GN=pksR PE=1 SV=2 12 519 9.0E-54
sp|Q54FN7|PKS33_DICDI Probable polyketide synthase 33 OS=Dictyostelium discoideum GN=pks33 PE=3 SV=2 1538 2206 3.0E-53
sp|Q54FN2|PKS34_DICDI Probable polyketide synthase 34 OS=Dictyostelium discoideum GN=pks34 PE=3 SV=1 1538 2206 2.0E-52
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 12 519 4.0E-52
sp|Q55DM7|PKS2_DICDI Probable polyketide synthase 2 OS=Dictyostelium discoideum GN=pks2 PE=3 SV=1 1543 2225 3.0E-51
sp|Q54FQ1|PKS31_DICDI Probable polyketide synthase 31 OS=Dictyostelium discoideum GN=pks31 PE=3 SV=1 1538 2206 3.0E-51
sp|Q54FQ3|PKS29_DICDI Probable polyketide synthase 29 OS=Dictyostelium discoideum GN=pks29 PE=3 SV=1 1538 2206 4.0E-51
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 12 526 1.0E-50
sp|Q54QD3|PKS22_DICDI Probable polyketide synthase 22 OS=Dictyostelium discoideum GN=pks22 PE=3 SV=1 1528 2215 3.0E-50
sp|Q558Y6|PKS14_DICDI Probable polyketide synthase 14 OS=Dictyostelium discoideum GN=pks14 PE=3 SV=2 1527 2219 3.0E-50
sp|Q54KU3|PKS25_DICDI Probable polyketide synthase 25 OS=Dictyostelium discoideum GN=pks25 PE=3 SV=1 1538 2205 2.0E-49
sp|Q54FQ2|PKS30_DICDI Probable polyketide synthase 30 OS=Dictyostelium discoideum GN=pks30 PE=3 SV=1 1538 2206 4.0E-49
sp|Q54QD1|PKS23_DICDI Probable polyketide synthase 23 OS=Dictyostelium discoideum GN=pks23 PE=3 SV=1 1528 2185 1.0E-48
sp|Q54FD2|PKS38_DICDI Probable polyketide synthase 38 OS=Dictyostelium discoideum GN=pks38 PE=3 SV=1 1538 2206 1.0E-48
sp|Q54IX3|PKS26_DICDI Probable polyketide synthase 26 OS=Dictyostelium discoideum GN=pks26 PE=3 SV=1 1538 2207 2.0E-48
sp|Q54FP8|PKS32_DICDI Probable polyketide synthase 32 OS=Dictyostelium discoideum GN=pks32 PE=3 SV=1 1538 2206 7.0E-48
sp|Q54G30|PKS27_DICDI Probable polyketide synthase 27 OS=Dictyostelium discoideum GN=pks27 PE=3 SV=1 1538 2193 9.0E-48
sp|Q54FC8|PKS39_DICDI Probable polyketide synthase 39 OS=Dictyostelium discoideum GN=pks39 PE=3 SV=1 1538 2206 1.0E-47
sp|Q54KU5|PKS24_DICDI Probable polyketide synthase 24 OS=Dictyostelium discoideum GN=pks24 PE=3 SV=1 1542 2205 1.0E-47
sp|Q54ED6|PKS41_DICDI Probable polyketide synthase 41 OS=Dictyostelium discoideum GN=pks41 PE=3 SV=1 1533 2190 5.0E-47
sp|Q54D44|PKS42_DICDI Probable polyketide synthase 42 OS=Dictyostelium discoideum GN=pks42 PE=3 SV=2 1533 2214 9.0E-47
sp|Q54ED7|PKS40_DICDI Probable polyketide synthase 40 OS=Dictyostelium discoideum GN=pks40 PE=3 SV=1 1533 2190 6.0E-46
sp|Q54TW0|PKS18_DICDI Probable polyketide synthase 18 OS=Dictyostelium discoideum GN=pks18 PE=2 SV=1 1527 2206 1.0E-45
sp|B0G170|PKS28_DICDI Probable polyketide synthase 28 OS=Dictyostelium discoideum GN=pks28 PE=3 SV=1 1542 2193 4.0E-45
sp|Q54B49|PKS45_DICDI Probable polyketide synthase 45 OS=Dictyostelium discoideum GN=pks45 PE=3 SV=2 1538 2208 5.0E-45
sp|Q54B51|PKS44_DICDI Probable polyketide synthase 44 OS=Dictyostelium discoideum GN=pks44 PE=3 SV=1 1538 2208 5.0E-45
sp|B0G138|PKS21_DICDI Probable polyketide synthase 21 OS=Dictyostelium discoideum GN=pks21 PE=3 SV=1 1536 2205 4.0E-43
sp|Q54T36|PKS19_DICDI Probable polyketide synthase 19 OS=Dictyostelium discoideum GN=pks19 PE=3 SV=1 1536 2205 5.0E-43
sp|Q86AE3|PKS9_DICDI Probable polyketide synthase 9/36 OS=Dictyostelium discoideum GN=pks9 PE=2 SV=1 1538 2206 6.0E-43
sp|B0G0Z9|PKS6_DICDI Probable polyketide synthase 6 OS=Dictyostelium discoideum GN=pks6 PE=3 SV=1 1538 2206 7.0E-43
sp|Q86JI5|PKS5_DICDI Probable polyketide synthase 5 OS=Dictyostelium discoideum GN=pks5 PE=2 SV=1 1538 2206 1.0E-42
sp|B0G100|PKS7_DICDI Probable polyketide synthase 7 OS=Dictyostelium discoideum GN=pks7 PE=3 SV=1 1538 2206 5.0E-42
sp|Q559A9|PKS13_DICDI Probable polyketide synthase 13 OS=Dictyostelium discoideum GN=pks13 PE=3 SV=1 1533 2219 9.0E-42
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 1839 2221 8.0E-41
sp|B0G101|PKS8_DICDI Probable polyketide synthase 8/35 OS=Dictyostelium discoideum GN=pks8 PE=3 SV=1 1538 2206 3.0E-40
sp|Q558W4|PKS15_DICDI Probable polyketide synthase 15 OS=Dictyostelium discoideum GN=pks15 PE=3 SV=2 1538 2206 9.0E-40
sp|Q558W4|PKS15_DICDI Probable polyketide synthase 15 OS=Dictyostelium discoideum GN=pks15 PE=3 SV=2 516 1002 1.0E-38
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 1831 2209 1.0E-36
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 1831 2209 7.0E-36
sp|P96285|PKS1_MYCTU Putative inactive phenolphthiocerol synthesis polyketide synthase type I Pks1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks1 PE=1 SV=4 531 1102 1.0E-35
sp|Q54FI3|PKS37_DICDI Probable polyketide synthase 37 OS=Dictyostelium discoideum GN=stlB PE=2 SV=1 536 968 6.0E-33
sp|Q83E37|FABF_COXBU 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=fabF PE=1 SV=1 12 434 5.0E-30
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 1875 2208 2.0E-29
sp|Q9KQH9|FABF_VIBCH 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=fabF PE=1 SV=3 12 434 1.0E-28
sp|Q8JFV8|VAT1_DANRE Synaptic vesicle membrane protein VAT-1 homolog OS=Danio rerio GN=vat1 PE=2 SV=1 1509 1837 2.0E-27
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 1857 2184 3.0E-27
sp|P56902|FABF_RHIME 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Rhizobium meliloti (strain 1021) GN=fabF PE=3 SV=2 116 434 1.0E-26
sp|Q80TB8|VAT1L_MOUSE Synaptic vesicle membrane protein VAT-1 homolog-like OS=Mus musculus GN=Vat1l PE=1 SV=2 1517 1837 2.0E-26
sp|P72331|NODE_RHIS3 Nodulation protein E OS=Rhizobium sp. (strain N33) GN=nodE PE=3 SV=1 84 428 3.0E-26
sp|Q9HCJ6|VAT1L_HUMAN Synaptic vesicle membrane protein VAT-1 homolog-like OS=Homo sapiens GN=VAT1L PE=1 SV=2 1517 1837 3.0E-26
sp|P55338|FABF_VIBHA 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Vibrio harveyi GN=fabF PE=3 SV=2 12 434 4.0E-26
sp|Q8NXE1|FABF_STAAW 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain MW2) GN=fabF PE=1 SV=1 87 434 2.0E-25
sp|Q6GAU2|FABF_STAAS 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain MSSA476) GN=fabF PE=3 SV=1 87 434 2.0E-25
sp|Q5HHA1|FABF_STAAC 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain COL) GN=fabF PE=1 SV=1 87 434 2.0E-25
sp|Q7A6F8|FABF_STAAN 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain N315) GN=fabF PE=1 SV=1 87 434 2.0E-25
sp|Q99VA6|FABF_STAAM 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=fabF PE=3 SV=1 87 434 2.0E-25
sp|Q6GIA3|FABF_STAAR 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain MRSA252) GN=fabF PE=3 SV=1 87 434 2.0E-25
sp|O97764|QOR_BOVIN Zeta-crystallin OS=Bos taurus GN=CRYZ PE=2 SV=2 1512 1833 2.0E-25
sp|Q5TKS0|FABF_STAAU 3-oxoacyl-[acyl-carrier-protein] synthase 2 (Fragment) OS=Staphylococcus aureus GN=fabF PE=3 SV=1 87 433 3.0E-25
sp|P39525|CEM1_YEAST 3-oxoacyl-[acyl-carrier-protein] synthase homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CEM1 PE=1 SV=1 104 434 4.0E-25
sp|B4XYB8|AZIB_STREG 5-methyl-1-naphthoate synthase OS=Streptomyces sahachiroi GN=aziB PE=1 SV=1 1776 2183 5.0E-25
sp|O34340|FABF_BACSU 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Bacillus subtilis (strain 168) GN=fabF PE=1 SV=1 90 434 5.0E-25
sp|Q0MVN8|QOR_PIG Quinone oxidoreductase OS=Sus scrofa GN=CRYZ PE=2 SV=1 1512 1833 6.0E-25
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 497 868 8.0E-25
sp|P06231|NOE4_RHIML Nodulation protein E OS=Rhizobium meliloti GN=nodE PE=3 SV=1 84 428 1.0E-24
sp|P06230|NODE_RHIME Nodulation protein E OS=Rhizobium meliloti (strain 1021) GN=nodE PE=3 SV=1 84 428 8.0E-24
sp|P28304|QOR1_ECOLI Quinone oxidoreductase 1 OS=Escherichia coli (strain K12) GN=qorA PE=1 SV=1 1534 1736 8.0E-24
sp|Q9NWU1|OXSM_HUMAN 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Homo sapiens GN=OXSM PE=1 SV=1 159 431 1.0E-23
sp|P11415|QOR_CAVPO Quinone oxidoreductase OS=Cavia porcellus GN=CRYZ PE=1 SV=1 1512 1795 1.0E-23
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 1858 2209 2.0E-23
sp|P40783|QOR_SALTY Quinone oxidoreductase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=qor PE=3 SV=2 1534 1748 2.0E-23
sp|Q08257|QOR_HUMAN Quinone oxidoreductase OS=Homo sapiens GN=CRYZ PE=1 SV=1 1512 1795 2.0E-23
sp|A7Z4X9|BAED_BACMF Polyketide biosynthesis acyltransferase homolog BaeD OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=baeD PE=1 SV=1 536 830 3.0E-23
sp|P22367|MSAS_PENPA 6-methylsalicylic acid synthase OS=Penicillium patulum PE=1 SV=1 1857 2183 4.0E-23
sp|P0AAI8|FABF_SHIFL 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Shigella flexneri GN=fabF PE=3 SV=2 145 434 4.0E-23
sp|P0AAI5|FABF_ECOLI 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Escherichia coli (strain K12) GN=fabF PE=1 SV=2 145 434 4.0E-23
sp|P0AAI6|FABF_ECOL6 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fabF PE=3 SV=2 145 434 4.0E-23
sp|P0AAI7|FABF_ECO57 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Escherichia coli O157:H7 GN=fabF PE=3 SV=2 145 434 4.0E-23
sp|P9WQE3|PPSD_MYCTU Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsD PE=1 SV=1 1872 2215 5.0E-23
sp|P9WQE2|PPSD_MYCTO Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsD PE=3 SV=1 1872 2215 5.0E-23
sp|Q7TXL7|PPSD_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsD PE=3 SV=1 1872 2215 5.0E-23
sp|Q5R4S7|QOR_PONAB Quinone oxidoreductase OS=Pongo abelii GN=CRYZ PE=2 SV=1 1512 1762 7.0E-23
sp|Q9D404|OXSM_MOUSE 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Mus musculus GN=Oxsm PE=1 SV=1 12 431 1.0E-22
sp|P04684|NODE_RHILT Nodulation protein E OS=Rhizobium leguminosarum bv. trifolii GN=nodE PE=3 SV=2 84 428 2.0E-22
sp|P16540|KAS1_STRVN Granaticin polyketide putative beta-ketoacyl synthase 1 OS=Streptomyces violaceoruber GN=gra-orf1 PE=3 SV=1 12 436 4.0E-22
sp|A7RK30|QORL2_NEMVE Quinone oxidoreductase-like protein 2 homolog OS=Nematostella vectensis GN=v1g238856 PE=3 SV=1 1538 1836 6.0E-22
sp|Q02059|KASA_STRCO Actinorhodin polyketide putative beta-ketoacyl synthase 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO5087 PE=1 SV=2 12 433 6.0E-22
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 1872 2184 1.0E-21
sp|P47199|QOR_MOUSE Quinone oxidoreductase OS=Mus musculus GN=Cryz PE=1 SV=1 1512 1762 1.0E-21
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 1872 2184 2.0E-21
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 1776 2189 2.0E-21
sp|P04683|NODE_RHILV Nodulation protein E OS=Rhizobium leguminosarum bv. viciae GN=nodE PE=3 SV=2 84 428 2.0E-21
sp|P41175|KAS1_STRCM Putative polyketide beta-ketoacyl synthase 1 OS=Streptomyces cinnamonensis PE=3 SV=1 12 432 2.0E-21
sp|Q6AYT0|QOR_RAT Quinone oxidoreductase OS=Rattus norvegicus GN=Cryz PE=2 SV=1 1539 1762 3.0E-21
sp|Q28452|QOR_LAMGU Quinone oxidoreductase OS=Lama guanicoe GN=CRYZ PE=2 SV=1 1512 1795 5.0E-21
sp|P19333|VAT1_TORCA Synaptic vesicle membrane protein VAT-1 OS=Torpedo californica PE=1 SV=1 1538 1748 6.0E-21
sp|O94297|OXSM_SCHPO Putative 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC887.13c PE=3 SV=1 162 434 9.0E-21
sp|Q0VCA7|OXSM_BOVIN 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Bos taurus GN=OXSM PE=2 SV=1 12 431 1.0E-20
sp|O34877|PKSD_BACSU Polyketide biosynthesis acyltransferase homolog PksD OS=Bacillus subtilis (strain 168) GN=pksD PE=1 SV=2 536 830 1.0E-20
sp|P73283|FABF_SYNY3 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fabF PE=1 SV=1 12 434 2.0E-20
sp|P71019|FABD_BACSU Malonyl CoA-acyl carrier protein transacylase OS=Bacillus subtilis (strain 168) GN=fabD PE=3 SV=2 535 833 3.0E-20
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 1826 2028 5.0E-20
sp|P9WQE6|PPSA_MYCTO Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsA PE=3 SV=1 1856 2051 6.0E-20
sp|P9WQE7|PPSA_MYCTU Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsA PE=1 SV=1 1856 2051 6.0E-20
sp|Q7TXM0|PPSA_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsA PE=1 SV=1 1856 2051 6.0E-20
sp|Q99536|VAT1_HUMAN Synaptic vesicle membrane protein VAT-1 homolog OS=Homo sapiens GN=VAT1 PE=1 SV=2 1542 1837 1.0E-19
sp|A6QQF5|QORL2_BOVIN Quinone oxidoreductase-like protein 2 OS=Bos taurus PE=2 SV=2 1536 1834 1.0E-19
sp|Q05356|KAS1_STRHA Putative polyketide beta-ketoacyl synthase 1 OS=Streptomyces halstedii GN=sch1 PE=3 SV=1 12 436 1.0E-19
sp|P43710|FABB_HAEIN 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fabB PE=3 SV=1 109 434 2.0E-19
sp|Q53FA7|QORX_HUMAN Quinone oxidoreductase PIG3 OS=Homo sapiens GN=TP53I3 PE=1 SV=2 1523 1833 3.0E-19
sp|Q02K94|FABB_PSEAB 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=fabB PE=1 SV=1 109 434 6.0E-19
sp|P43903|QOR_PSEAE Quinone oxidoreductase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=qor PE=3 SV=2 1513 1748 7.0E-19
sp|P16538|KAS1_STRGA Tetracenomycin C polyketide putative beta-ketoacyl synthase 1 OS=Streptomyces glaucescens GN=tcmK PE=3 SV=1 12 435 8.0E-19
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 1855 2194 1.0E-18
sp|B0BNC9|QORL2_RAT Quinone oxidoreductase-like protein 2 OS=Rattus norvegicus PE=2 SV=1 1536 1748 4.0E-18
sp|P9WQD7|FAB2_MYCTU 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=kasB PE=1 SV=1 180 434 7.0E-18
sp|P9WQD6|FAB2_MYCTO 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=kasB PE=3 SV=1 180 434 7.0E-18
sp|P63457|FAB2_MYCBO 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=kasB PE=3 SV=1 180 434 7.0E-18
sp|P23155|KAS1_STRCO Putative polyketide beta-ketoacyl synthase 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO5318 PE=3 SV=1 12 432 9.0E-18
sp|Q7TXL9|PPSB_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsB PE=1 SV=1 1852 2029 1.0E-17
sp|P9WQE5|PPSB_MYCTU Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsB PE=1 SV=1 1852 2029 1.0E-17
sp|P9WQE4|PPSB_MYCTO Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsB PE=3 SV=1 1852 2029 1.0E-17
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 1871 2028 2.0E-17
sp|Q59I44|CAA43_BURSP 2-haloacrylate reductase OS=Burkholderia sp. GN=caa43 PE=1 SV=1 1542 1738 2.0E-17
sp|Q02578|KAS1_STRCN Putative polyketide beta-ketoacyl synthase 1 OS=Streptomyces cyaneus GN=curA PE=3 SV=1 12 435 2.0E-17
sp|A7Z4Y0|BAEE_BACMF Polyketide biosynthesis protein BaeE OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=baeE PE=1 SV=1 536 756 3.0E-17
sp|Q89AY4|FABB_BUCBP 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=fabB PE=3 SV=1 147 434 3.0E-17
sp|Q3UNZ8|QORL2_MOUSE Quinone oxidoreductase-like protein 2 OS=Mus musculus PE=1 SV=1 1536 1834 4.0E-17
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 1850 2077 8.0E-17
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 1839 2019 2.0E-16
sp|O69473|FAB2_MYCLE 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Mycobacterium leprae (strain TN) GN=kasB PE=3 SV=2 180 427 2.0E-16
sp|Q8L3X9|KASM_ARATH 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Arabidopsis thaliana GN=KAS PE=1 SV=1 159 432 2.0E-16
sp|P57193|FABB_BUCAI 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=fabB PE=3 SV=1 88 434 4.0E-16
sp|P0A953|FABB_ECOLI 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Escherichia coli (strain K12) GN=fabB PE=1 SV=1 109 434 7.0E-16
sp|P0A954|FABB_ECOL6 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fabB PE=3 SV=1 109 434 7.0E-16
sp|Q7A124|FABD_STAAW Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain MW2) GN=fabD PE=3 SV=1 535 833 1.0E-15
sp|Q7A5Z3|FABD_STAAN Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain N315) GN=fabD PE=1 SV=1 535 833 1.0E-15
sp|Q99UN8|FABD_STAAM Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=fabD PE=1 SV=1 535 833 1.0E-15
sp|Q93QD4|FABD_STAAU Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus GN=fabD PE=3 SV=1 535 833 1.0E-15
sp|Q6G9Y3|FABD_STAAS Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain MSSA476) GN=fabD PE=3 SV=1 535 833 1.0E-15
sp|Q5HGK3|FABD_STAAC Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain COL) GN=fabD PE=3 SV=1 535 833 1.0E-15
sp|Q6GHK5|FABD_STAAR Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain MRSA252) GN=fabD PE=3 SV=1 535 833 1.0E-15
sp|A7Z4X8|BAEC_BACMF Polyketide biosynthesis malonyl CoA-acyl carrier protein transacylase BaeC OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=baeC PE=1 SV=1 536 756 2.0E-15
sp|P43712|FABD_HAEIN Malonyl CoA-acyl carrier protein transacylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fabD PE=3 SV=1 535 841 2.0E-15
sp|P23902|KASC1_HORVU 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic OS=Hordeum vulgare GN=KAS12 PE=1 SV=1 26 432 2.0E-15
sp|O34825|PKSC_BACSU Polyketide biosynthesis malonyl CoA-acyl carrier protein transacylase PksC OS=Bacillus subtilis (strain 168) GN=pksC PE=1 SV=1 536 749 2.0E-15
sp|P52410|KASC1_ARATH 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic OS=Arabidopsis thaliana GN=KAS1 PE=2 SV=2 171 428 3.0E-15
sp|Q3MIE4|VAT1_RAT Synaptic vesicle membrane protein VAT-1 homolog OS=Rattus norvegicus GN=Vat1 PE=1 SV=1 1542 1840 4.0E-15
sp|O34787|PKSE_BACSU Polyketide biosynthesis protein PksE OS=Bacillus subtilis (strain 168) GN=pksE PE=1 SV=3 536 845 4.0E-15
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 1842 2020 6.0E-15
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 1859 2037 1.0E-14
sp|Q9CBS7|FAB1_MYCLE 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Mycobacterium leprae (strain TN) GN=kasA PE=3 SV=1 173 434 1.0E-14
sp|Q02062|KASB_STRCO Actinorhodin polyketide putative beta-ketoacyl synthase 2 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO5088 PE=1 SV=1 97 385 3.0E-14
sp|Q62465|VAT1_MOUSE Synaptic vesicle membrane protein VAT-1 homolog OS=Mus musculus GN=Vat1 PE=1 SV=3 1542 1840 4.0E-14
sp|P38230|QOR_YEAST Probable quinone oxidoreductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZTA1 PE=1 SV=1 1517 1748 6.0E-14
sp|Q9C9P4|KASC2_ARATH 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic OS=Arabidopsis thaliana GN=KAS2 PE=1 SV=1 96 432 1.0E-13
sp|A4YGN2|ACAR_METS5 Acryloyl-coenzyme A reductase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=Msed_1426 PE=1 SV=1 1542 1761 2.0E-13
sp|P42865|QOR_LEIAM Probable quinone oxidoreductase OS=Leishmania amazonensis PE=3 SV=1 1543 1833 2.0E-13
sp|P9WQD9|FAB1_MYCTU 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=kasA PE=1 SV=1 180 434 5.0E-13
sp|P9WQD8|FAB1_MYCTO 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=kasA PE=3 SV=1 180 434 5.0E-13
sp|H8ESN0|FAB1_MYCTE 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Mycobacterium tuberculosis (strain ATCC 35801 / TMC 107 / Erdman) GN=kasA PE=2 SV=2 180 434 5.0E-13
sp|P63455|FAB1_MYCBO 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=kasA PE=3 SV=1 180 434 5.0E-13
sp|Q975C8|ACAR_SULTO Acryloyl-coenzyme A reductase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=STK_04800 PE=1 SV=1 1541 1835 6.0E-13
sp|Q9R9J2|FENF_BACIU Malonyl CoA-acyl carrier protein transacylase OS=Bacillus subtilis GN=fenF PE=1 SV=1 536 829 6.0E-13
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 1857 2028 1.0E-12
sp|Q8H0M1|QORH_SPIOL Quinone-oxidoreductase homolog, chloroplastic OS=Spinacia oleracea GN=QOR PE=1 SV=1 1520 1835 1.0E-12
sp|O74489|QOR_SCHPO Probable quinone oxidoreductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=zta1 PE=1 SV=2 1545 1748 2.0E-12
sp|O85140|FABD_SALTY Malonyl CoA-acyl carrier protein transacylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fabD PE=1 SV=3 535 830 6.0E-12
sp|P40804|PKSF_BACSU Polyketide biosynthesis malonyl-ACP decarboxylase PksF OS=Bacillus subtilis (strain 168) GN=pksF PE=1 SV=3 159 433 1.0E-11
sp|P0AAI9|FABD_ECOLI Malonyl CoA-acyl carrier protein transacylase OS=Escherichia coli (strain K12) GN=fabD PE=1 SV=2 535 830 2.0E-11
sp|P0AAJ0|FABD_ECOL6 Malonyl CoA-acyl carrier protein transacylase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fabD PE=3 SV=2 535 830 2.0E-11
sp|Q8X8I7|FABD_ECO57 Malonyl CoA-acyl carrier protein transacylase OS=Escherichia coli O157:H7 GN=fabD PE=3 SV=3 535 830 2.0E-11
sp|P43678|KAS1_STRRM Oxytetracycline polyketide putative beta-ketoacyl synthase 1 OS=Streptomyces rimosus PE=3 SV=2 12 435 2.0E-11
sp|Q8KA28|FABB_BUCAP 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=fabB PE=3 SV=1 138 434 3.0E-11
sp|P0C842|CJ052_HUMAN Putative uncharacterized protein encoded by LINC00614 OS=Homo sapiens GN=LINC00614 PE=5 SV=1 44 145 5.0E-11
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 1859 2052 6.0E-11
sp|Q7T3C7|RT4I1_DANRE Reticulon-4-interacting protein 1 homolog, mitochondrial OS=Danio rerio GN=rtn4ip1 PE=2 SV=2 1519 1834 1.0E-10
sp|P73242|FABD_SYNY3 Malonyl CoA-acyl carrier protein transacylase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fabD PE=1 SV=1 535 836 1.0E-10
sp|P51831|FABG_BACSU 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Bacillus subtilis (strain 168) GN=fabG PE=3 SV=3 1857 2007 3.0E-10
sp|Q84V25|ENOXE_FRAAN 2-methylene-furan-3-one reductase OS=Fragaria ananassa GN=EO PE=1 SV=1 1526 1837 4.0E-10
sp|Q24K16|ZADH2_BOVIN Zinc-binding alcohol dehydrogenase domain-containing protein 2 OS=Bos taurus GN=ZADH2 PE=2 SV=1 1540 1748 1.0E-09
sp|Q8BGC4|ZADH2_MOUSE Zinc-binding alcohol dehydrogenase domain-containing protein 2 OS=Mus musculus GN=Zadh2 PE=1 SV=1 1532 1837 2.0E-09
sp|P16539|KAS2_STRGA Tetracenomycin C polyketide putative beta-ketoacyl synthase 2 OS=Streptomyces glaucescens GN=tcmL PE=3 SV=2 10 434 2.0E-09
sp|P0A2C9|FABG_SALTY 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fabG PE=1 SV=1 1859 2014 3.0E-09
sp|P0A2D0|FABG_SALTI 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Salmonella typhi GN=fabG PE=3 SV=1 1859 2014 3.0E-09
sp|Q39172|P1_ARATH NADP-dependent alkenal double bond reductase P1 OS=Arabidopsis thaliana GN=P1 PE=1 SV=1 1633 1833 3.0E-09
sp|Q9BV79|MECR_HUMAN Trans-2-enoyl-CoA reductase, mitochondrial OS=Homo sapiens GN=MECR PE=1 SV=2 1538 1690 3.0E-09
sp|P34055|INC11_HYPAT Protein indc11 OS=Hypocrea atroviridis GN=indc11 PE=2 SV=1 1516 1755 5.0E-09
sp|Q00681|STCJ_EMENI Sterigmatocystin biosynthesis fatty acid synthase subunit alpha OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcJ PE=3 SV=2 86 435 7.0E-09
sp|Q39173|P2_ARATH NADP-dependent alkenal double bond reductase P2 OS=Arabidopsis thaliana GN=P2 PE=2 SV=2 1633 1833 7.0E-09
sp|Q6P0H7|CBR4_DANRE Carbonyl reductase family member 4 OS=Danio rerio GN=cbr4 PE=2 SV=1 1859 2075 8.0E-09
sp|Q7TS56|CBR4_RAT Carbonyl reductase family member 4 OS=Rattus norvegicus GN=Cbr4 PE=2 SV=1 1860 2014 8.0E-09
sp|Q8N4Q0|ZADH2_HUMAN Zinc-binding alcohol dehydrogenase domain-containing protein 2 OS=Homo sapiens GN=ZADH2 PE=1 SV=1 1532 1833 9.0E-09
sp|K4BW79|ENOX_SOLLC 2-methylene-furan-3-one reductase OS=Solanum lycopersicum GN=EO PE=1 SV=1 1522 1687 9.0E-09
sp|Q02207|FOX2_YEAST Peroxisomal hydratase-dehydrogenase-epimerase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FOX2 PE=2 SV=1 1859 2022 1.0E-08
sp|Q9Z311|MECR_RAT Trans-2-enoyl-CoA reductase, mitochondrial OS=Rattus norvegicus GN=Mecr PE=1 SV=1 1542 1671 1.0E-08
sp|P73574|FABG1_SYNY3 3-oxoacyl-[acyl-carrier-protein] reductase 1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fabG1 PE=1 SV=1 1859 2065 1.0E-08
sp|P96825|Y0148_MYCTU Putative short-chain type dehydrogenase/reductase Rv0148 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0148 PE=1 SV=3 1859 2016 2.0E-08
sp|O94038|ADH2_CANAL Alcohol dehydrogenase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ADH2 PE=3 SV=1 1599 1833 2.0E-08
sp|P07246|ADH3_YEAST Alcohol dehydrogenase 3, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADH3 PE=1 SV=2 1528 1833 2.0E-08
sp|Q9X248|FABG_THEMA 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=fabG PE=3 SV=1 1859 2007 2.0E-08
sp|A0R0B2|FABD_MYCS2 Malonyl CoA-acyl carrier protein transacylase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=fabD PE=1 SV=1 625 831 4.0E-08
sp|Q9KQH7|FABG_VIBCH 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=fabG PE=1 SV=2 1859 2016 4.0E-08
sp|Q941I0|ENOXC_FRAAN 2-methylene-furan-3-one reductase OS=Fragaria ananassa GN=EO PE=1 SV=2 1526 1837 4.0E-08
sp|O67610|FABG_AQUAE 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Aquifex aeolicus (strain VF5) GN=fabG PE=1 SV=1 1859 2016 5.0E-08
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 1872 2020 6.0E-08
sp|Q6WAU0|PULR_MENPI (+)-pulegone reductase OS=Mentha piperita PE=1 SV=1 1633 1743 6.0E-08
sp|Q9DCS3|MECR_MOUSE Trans-2-enoyl-CoA reductase, mitochondrial OS=Mus musculus GN=Mecr PE=1 SV=2 1542 1667 6.0E-08
sp|A4IFA7|CBR4_BOVIN Carbonyl reductase family member 4 OS=Bos taurus GN=CBR4 PE=2 SV=1 1860 2014 8.0E-08
sp|O23939|ENOX_FRAVE 2-methylene-furan-3-one reductase OS=Fragaria vesca GN=EO PE=2 SV=2 1526 1837 8.0E-08
sp|O94564|YGD6_SCHPO Zinc-type alcohol dehydrogenase-like protein C1773.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.06c PE=3 SV=1 1536 1748 9.0E-08
sp|O35017|YOGA_BACSU Uncharacterized zinc-type alcohol dehydrogenase-like protein YogA OS=Bacillus subtilis (strain 168) GN=yogA PE=3 SV=1 1524 1748 9.0E-08
sp|Q9SV68|QORH_ARATH Putative quinone-oxidoreductase homolog, chloroplastic OS=Arabidopsis thaliana GN=At4g13010 PE=2 SV=1 1523 1835 1.0E-07
sp|Q9C0Y6|YKM8_SCHPO Zinc-type alcohol dehydrogenase-like protein PB24D3.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB24D3.08c PE=3 SV=1 1633 1833 1.0E-07
sp|Q9SLN8|DBR_TOBAC 2-alkenal reductase (NADP(+)-dependent) OS=Nicotiana tabacum GN=DBR PE=1 SV=1 1633 1833 1.0E-07
sp|Q7YS70|MECR_BOVIN Trans-2-enoyl-CoA reductase, mitochondrial OS=Bos taurus GN=MECR PE=1 SV=1 1543 1667 2.0E-07
sp|P0AEK3|FABG_SHIFL 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Shigella flexneri GN=fabG PE=3 SV=1 1859 2014 2.0E-07
sp|P0AEK2|FABG_ECOLI 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Escherichia coli (strain K12) GN=fabG PE=1 SV=1 1859 2014 2.0E-07
sp|Q6GQN8|MECR_DANRE Trans-2-enoyl-CoA reductase, mitochondrial OS=Danio rerio GN=mecr PE=2 SV=2 1543 1667 2.0E-07
sp|P49384|ADH3_KLULA Alcohol dehydrogenase 3, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ADH3 PE=3 SV=2 1528 1833 2.0E-07
sp|P49385|ADH4_KLULA Alcohol dehydrogenase 4, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ADH4 PE=3 SV=2 1528 1833 3.0E-07
sp|Q28GQ2|MECR_XENTR Trans-2-enoyl-CoA reductase, mitochondrial OS=Xenopus tropicalis GN=mecr PE=2 SV=1 1540 1671 4.0E-07
sp|B0G103|PKS10_DICDI Probable polyketide synthase 10 OS=Dictyostelium discoideum GN=pks10 PE=3 SV=1 1859 2190 7.0E-07
sp|P99173|ZDH1_STAAN Zinc-type alcohol dehydrogenase-like protein SA1988 OS=Staphylococcus aureus (strain N315) GN=SA1988 PE=1 SV=1 1523 1677 7.0E-07
sp|P63475|ZDH1_STAAM Zinc-type alcohol dehydrogenase-like protein SAV2186 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV2186 PE=3 SV=1 1523 1677 7.0E-07
sp|Q91VT4|CBR4_MOUSE Carbonyl reductase family member 4 OS=Mus musculus GN=Cbr4 PE=1 SV=2 1860 2014 8.0E-07
sp|Q93X67|FABG2_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 2, chloroplastic OS=Brassica napus GN=bkr2 PE=2 SV=1 1859 2067 8.0E-07
sp|Q6GEP3|ZDH1_STAAR Zinc-type alcohol dehydrogenase-like protein SAR2277 OS=Staphylococcus aureus (strain MRSA252) GN=SAR2277 PE=3 SV=1 1523 1677 8.0E-07
sp|Q9Y7D0|LOVC_ASPTE Enoyl reductase LovC OS=Aspergillus terreus GN=lovC PE=1 SV=1 1534 1638 8.0E-07
sp|Q8NVD1|ZDH1_STAAW Zinc-type alcohol dehydrogenase-like protein MW2112 OS=Staphylococcus aureus (strain MW2) GN=MW2112 PE=3 SV=1 1523 1677 1.0E-06
sp|Q6G7C8|ZDH1_STAAS Zinc-type alcohol dehydrogenase-like protein SAS2087 OS=Staphylococcus aureus (strain MSSA476) GN=SAS2087 PE=3 SV=1 1523 1677 1.0E-06
sp|Q5HE19|ZDH1_STAAC Zinc-type alcohol dehydrogenase-like protein SACOL2177 OS=Staphylococcus aureus (strain COL) GN=SACOL2177 PE=3 SV=1 1523 1677 1.0E-06
sp|Q3SZJ4|PTGR1_BOVIN Prostaglandin reductase 1 OS=Bos taurus GN=PTGR1 PE=2 SV=1 1633 1756 1.0E-06
sp|Q14914|PTGR1_HUMAN Prostaglandin reductase 1 OS=Homo sapiens GN=PTGR1 PE=1 SV=2 1633 1744 1.0E-06
sp|Q07288|ADH1_KLUMA Alcohol dehydrogenase 1 OS=Kluyveromyces marxianus GN=ADH1 PE=3 SV=1 1528 1833 2.0E-06
sp|Q93X68|FABG5_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 5, chloroplastic (Fragment) OS=Brassica napus GN=bkr1 PE=2 SV=1 1859 2067 2.0E-06
sp|P33207|FABG_ARATH 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic OS=Arabidopsis thaliana GN=At1g24360 PE=1 SV=2 1837 2067 2.0E-06
sp|P55336|FABG_VIBHA 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Vibrio harveyi GN=fabG PE=3 SV=1 1859 2065 2.0E-06
sp|P43713|FABG_HAEIN 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fabG PE=3 SV=1 1859 2014 2.0E-06
sp|P66782|Y1385_MYCBO Uncharacterized oxidoreductase Mb1385 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fabG2 PE=3 SV=1 1849 2008 3.0E-06
sp|P9WGR9|Y1350_MYCTU Uncharacterized oxidoreductase Rv1350 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fabG2 PE=1 SV=1 1849 2008 3.0E-06
sp|P9WGR8|Y1350_MYCTO Uncharacterized oxidoreductase MT1393 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fabG2 PE=3 SV=1 1849 2008 3.0E-06
sp|P0A0I0|FABG_STAAW 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain MW2) GN=fabG PE=3 SV=1 1859 2006 3.0E-06
sp|Q6G9Y2|FABG_STAAS 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain MSSA476) GN=fabG PE=3 SV=1 1859 2006 3.0E-06
sp|Q6GHK4|FABG_STAAR 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain MRSA252) GN=fabG PE=3 SV=1 1859 2006 3.0E-06
sp|P99093|FABG_STAAN 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain N315) GN=fabG PE=1 SV=1 1859 2006 3.0E-06
sp|P0A0H9|FABG_STAAM 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=fabG PE=1 SV=1 1859 2006 3.0E-06
sp|Q5HGK2|FABG_STAAC 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain COL) GN=fabG PE=3 SV=2 1859 2006 3.0E-06
sp|P51660|DHB4_MOUSE Peroxisomal multifunctional enzyme type 2 OS=Mus musculus GN=Hsd17b4 PE=1 SV=3 1859 2007 4.0E-06
sp|P97852|DHB4_RAT Peroxisomal multifunctional enzyme type 2 OS=Rattus norvegicus GN=Hsd17b4 PE=1 SV=3 1859 2011 4.0E-06
sp|Q949M3|FABG3_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 3, chloroplastic OS=Brassica napus GN=bkr3 PE=2 SV=1 1859 2067 4.0E-06
sp|Q29073|PTGR1_PIG Prostaglandin reductase 1 OS=Sus scrofa GN=PTGR1 PE=1 SV=1 1633 1743 5.0E-06
sp|Q93X62|FABG1_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 1, chloroplastic OS=Brassica napus GN=gbkr1 PE=1 SV=1 1859 2067 5.0E-06
sp|P97584|PTGR1_RAT Prostaglandin reductase 1 OS=Rattus norvegicus GN=Ptgr1 PE=2 SV=3 1633 1744 6.0E-06
sp|Q9Z8P2|FABG_CHLPN 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Chlamydia pneumoniae GN=fabG PE=3 SV=1 1859 2016 6.0E-06
sp|P28643|FABG_CUPLA 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic OS=Cuphea lanceolata GN=CLKR27 PE=2 SV=1 1859 2067 6.0E-06
sp|Q9EQZ5|PTGR1_CAVPO Prostaglandin reductase 1 OS=Cavia porcellus GN=Ptgr1 PE=1 SV=1 1633 1759 7.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

Gene cluster ID Type of secondary metabolism gene
Cluster 32 PKS

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup11
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis map64 (Brazil) OphauB2|1456
Ophiocordyceps camponoti-floridani Ophcf2|04509
Ophiocordyceps camponoti-floridani Ophcf2|05945
Ophiocordyceps camponoti-floridani Ophcf2|05210
Ophiocordyceps camponoti-floridani Ophcf2|04876
Ophiocordyceps camponoti-floridani Ophcf2|03559
Ophiocordyceps camponoti-floridani Ophcf2|02946
Ophiocordyceps camponoti-floridani Ophcf2|02940
Ophiocordyceps camponoti-floridani Ophcf2|02393
Ophiocordyceps camponoti-floridani Ophcf2|02162
Ophiocordyceps camponoti-floridani Ophcf2|01419
Ophiocordyceps camponoti-floridani Ophcf2|00877
Ophiocordyceps camponoti-floridani Ophcf2|00026
Ophiocordyceps camponoti-floridani Ophcf2|02640
Ophiocordyceps camponoti-rufipedis Ophun1|7018
Ophiocordyceps camponoti-rufipedis Ophun1|5875
Ophiocordyceps camponoti-rufipedis Ophun1|61
Ophiocordyceps camponoti-rufipedis Ophun1|7079
Ophiocordyceps camponoti-rufipedis Ophun1|2808
Ophiocordyceps camponoti-rufipedis Ophun1|7149
Ophiocordyceps camponoti-rufipedis Ophun1|7480
Ophiocordyceps camponoti-rufipedis Ophun1|5641
Ophiocordyceps camponoti-rufipedis Ophun1|7148
Ophiocordyceps camponoti-rufipedis Ophun1|5297
Ophiocordyceps camponoti-rufipedis Ophun1|839
Ophiocordyceps camponoti-rufipedis Ophun1|5181
Ophiocordyceps camponoti-rufipedis Ophun1|5180
Ophiocordyceps camponoti-rufipedis Ophun1|5123
Ophiocordyceps camponoti-rufipedis Ophun1|5085
Ophiocordyceps camponoti-rufipedis Ophun1|4013
Ophiocordyceps camponoti-rufipedis Ophun1|2837
Ophiocordyceps camponoti-rufipedis Ophun1|7483 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1461
Ophiocordyceps camponoti-rufipedis Ophun1|5183
Ophiocordyceps kimflemingae Ophio5|2713
Ophiocordyceps subramaniannii Hirsu2|2752

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7483
MASDNGRKLAPVAVVGMSCRLPGGVSTLDDFWTMLSRARSGWREIPEDRFSSKAFFHPNPQKKGCFNARGGYFMD
HDLSLFDAPFFNITKQEALAMDPKQRQLLECTYEALENAGISKESVAGSNMGVFVGGSVSDYAMSTFRDPDSIPM
FDVTGNHQSILSGRISHAFDLRGPCFSVDTACSSGLYALHAAVQSIRSGDCDSAVVAGCHLHLQPDHWVSMSMSG
LFAEHGKTYAFDHRAKSGFARGEGVGCLILKSLDRARADKDQIRSIIVNTGANQDGRTVGLSTPSVEAQEQLIRD
VYTKAGVNVQEVGFVEAHGTGTKIGDPIEARAIYNALGEGRTKRQPLYMGSVKTNIGHLENASGIISVIKASLML
EKGFILPNVNFEKANPSIPLDEWNIKVPTNLRSWPAQKRFISVNNFGFGGSNAHCILQRPDLVPSSLTQEKSDNH
HKLFVLSGYTEDAAKQRSKHLGIYAEQHPEVFQKRLVNNLAYTLCQRRSHLPWRVAVTATCCSEIVEALNSIDAK
PARASGKAPKIAFVFTGQGAQWHAMGRELMTSHPVFADTMREADACLSRLGADFSLLEELAKDKETSEVNKARLS
QPACTAVQLALVRLLASWGIEPQAVVGHSSGEIGAAFATGAISLEDAMAAAFQRGQATLRMKAEHPDLKGGMLAV
GASPAEVRKTIKALGLEGAAVACENSPGSTTVSGDVQDVEKLAAELESRKVFNRKLLVDVAYHSSHMELVAEEYT
RSIKNIKATEGSSKTSFFSSLQGKALDSLTSLTAEYWRDNLVKPVLFSSALEALCREAEPTVLVEIGPHAALEGP
IKQVLREMGDKVASSIKYCPTLVRNKDASAAALQTAGRLYVMGQPIRFEEVNQMNEADPPSVIEDMLPYPWTHEK
YWHETRMSREHRIKEFARHDLLGRLSTSSSDFEHRWRNILTTDDVPWLRDHKMQSLVTFPFAGFIAMVAEAASQR
AAMKRVSFDRFCLREVQITSPLIMNDGDEYEVTLSLSRYAEGTRSYSNAWDSFCVSSWTQQRGWVEHCRGLVSVR
KNEAANPVGLTVRRDARRRFDRASGVCNEVVDKDKFYADLTGNGAEYGPLFRIDDDTLVGEGHSLTTIKVPDTSA
CMPHNYEAPSILSAAVLDMFFHLTFAILGAGRGLMPNLYMPNAVKHMEFSKEFPATPGKTMRAICEGYPDTVNLI
PADFFIDVWESPDSAQPLFSTQGFTMTPVNDRVNEQLEPPSICFKVEWEELGGKESPAAVENGQANGSNGHDSNG
VNGHSNGHSNGHSNGTNGVNGSNGVHDLNGHADVEADSPPEFSAPVVIISDNKGESDPLAKALVDLIALKTGATP
TICPLDTLDATDKICIAVCELNSPVISNISGKAFDKLQKVILTAHALLWVSAGTFKNAKHPDSALAQGLLRTVRS
ETSKMAATLDLDPDSPLDNGSRSELIIQALRRVLASETELGPSDFEFAESEGKLVVPRVVEDEEMNQLVQHQTQP
TGPYLQPFDQYGRRLQIAIGTYGALDSLYFCDQPARPLRDDEVEVKIAATGMNFKDVVIAMGQVPSPYLGVECSG
TISNVGAKVTSLSVGDRVCAMSLGAYGTFARCRATSAAVIPHDMSFETAASIPVVYSTAYYGMVELARIQAGESI
LIHAASGGVGQAAIQLAHMIGAEIYATVGGADKKQLLMDKYGIPEDRIFYSRTADFGPAIREATGGHGVDVVLNS
LAGELLRESWESLAHFGRFIEIGKRDITSNTRLDMNKFEHNVTFSSVDLTLVASERPKIMSSVLNSVMELMGKKS
IAPIGPITVLGISELETALRTLQSGKSTGKLIISPRPGEQVKVTHRPAATILNGHATYIIIGGTGGLGRSMAKRM
VQRGAKHIVLLSRAGRMTAELAQLSDECRGLGATITVKACNVANEGSVRQVVEECTRSLPPIRGVIHAAMVLRDM
LFEKMSFDDFHQVMESKVAGTWNFHRALSSHQLDFFIMLSSVAGIVGNRGQAAYAAANTFLDAFVQYRTQRGLPA
TSIDLTAVEDVGYLAENAARSKEVLKTLEGNSFGEAEVLALLEAGIRGQISQLSNSQCITGLSFAGSSLPFYADD
ARFVRLREAYQSTMQMNDAAAPGQSLPSQELIQAPSYDEAVNVVSQRISEKLCAILMLQPGDVDTKTSVKSYGLD
SLNAIELRNWIGKEYLAHLQVLELLTSGAISDLAALTMKKSKIQHAHKEP*
Coding >Ophun1|7483
ATGGCGTCAGACAATGGCCGGAAGCTGGCCCCTGTCGCCGTGGTCGGCATGTCATGCCGTCTCCCCGGCGGCGTC
TCGACTCTCGATGACTTTTGGACAATGCTCTCGCGTGCCCGCTCCGGCTGGCGGGAGATTCCAGAGGACCGTTTC
AGCAGCAAGGCGTTTTTCCACCCGAATCCGCAGAAGAAGGGCTGCTTCAACGCCCGGGGCGGCTATTTCATGGAC
CACGACCTGAGCTTGTTTGACGCTCCATTCTTCAACATTACCAAGCAAGAGGCCCTGGCCATGGATCCCAAGCAG
CGGCAGCTCCTCGAGTGCACTTACGAGGCCCTCGAAAACGCCGGCATCTCCAAGGAGAGCGTAGCCGGCAGCAAC
ATGGGCGTCTTCGTCGGCGGCTCCGTCTCTGATTACGCCATGAGCACCTTTCGCGACCCGGACTCGATTCCCATG
TTTGACGTGACGGGCAACCATCAGTCGATTCTGTCCGGTCGTATCTCTCACGCCTTTGACCTCCGTGGGCCGTGC
TTCTCCGTCGACACGGCCTGTTCATCCGGCCTGTACGCTCTGCACGCGGCGGTGCAGAGCATCCGTAGCGGGGAC
TGTGACTCTGCCGTCGTTGCAGGCTGTCACCTGCATCTGCAGCCGGATCATTGGGTCTCCATGTCCATGTCTGGC
CTCTTTGCCGAACATGGCAAGACGTATGCCTTTGATCACCGCGCCAAGTCCGGCTTCGCCCGTGGAGAGGGAGTC
GGCTGCCTTATCCTCAAGTCACTGGATCGGGCTCGAGCGGACAAGGACCAGATCAGGTCCATCATCGTCAACACT
GGCGCCAACCAGGATGGCAGGACCGTCGGACTGTCGACCCCAAGCGTCGAGGCGCAAGAGCAGCTGATCCGTGAC
GTTTATACCAAAGCTGGCGTCAACGTCCAGGAAGTCGGTTTCGTCGAGGCTCACGGAACAGGCACCAAGATCGGC
GATCCGATAGAGGCCAGGGCCATCTACAACGCCCTCGGCGAGGGCCGCACCAAGAGGCAGCCGCTGTACATGGGC
TCGGTCAAAACCAACATTGGCCATCTGGAGAACGCCAGCGGTATCATCTCGGTCATCAAGGCGTCCCTCATGCTG
GAAAAGGGCTTCATTCTGCCCAATGTCAATTTCGAAAAGGCCAACCCCAGCATTCCGCTCGATGAGTGGAACATC
AAGGTTCCCACCAACCTGCGGTCATGGCCTGCTCAGAAGCGATTCATCAGCGTCAACAACTTTGGCTTCGGAGGA
TCCAACGCTCACTGCATCCTCCAGCGTCCCGACCTCGTACCCTCCTCGCTCACCCAGGAAAAGTCGGACAACCAT
CATAAACTCTTCGTCCTGTCCGGCTACACCGAGGATGCCGCCAAGCAGCGGTCCAAGCACCTCGGCATCTACGCC
GAGCAGCATCCGGAGGTCTTCCAGAAGCGTCTCGTCAACAACCTGGCTTACACCTTGTGCCAGCGACGATCTCAC
CTCCCCTGGCGCGTTGCCGTAACGGCCACCTGCTGCAGCGAAATCGTCGAGGCACTCAACAGCATCGATGCCAAG
CCGGCTCGCGCCTCGGGCAAGGCGCCCAAGATTGCCTTCGTCTTCACCGGCCAGGGCGCTCAGTGGCACGCCATG
GGTCGCGAGCTGATGACGTCACACCCGGTCTTCGCCGACACTATGCGCGAGGCCGACGCCTGTCTGTCGCGTCTG
GGAGCCGACTTTTCTCTTCTCGAGGAGCTGGCCAAGGACAAGGAGACGTCCGAGGTCAACAAGGCCAGGCTGAGT
CAGCCGGCCTGCACCGCCGTTCAACTTGCCCTCGTCCGCCTGCTGGCATCGTGGGGGATCGAGCCCCAGGCCGTC
GTTGGCCATTCGAGCGGTGAGATCGGCGCAGCCTTCGCTACAGGCGCCATCAGCCTGGAAGATGCCATGGCAGCT
GCCTTCCAGCGAGGCCAGGCCACGCTGCGGATGAAGGCCGAGCACCCGGATCTCAAGGGCGGCATGTTGGCTGTG
GGCGCGAGTCCGGCCGAGGTGCGCAAGACGATCAAGGCTCTGGGCCTCGAGGGCGCTGCTGTCGCCTGCGAGAAC
TCGCCTGGATCGACTACCGTCTCGGGAGACGTCCAGGATGTCGAGAAGCTGGCCGCCGAGCTGGAGAGCCGCAAG
GTCTTCAACCGCAAGCTGCTCGTTGACGTCGCCTACCACTCGTCGCACATGGAGCTCGTGGCCGAAGAGTACACG
CGTTCTATCAAGAATATCAAGGCGACCGAGGGCAGCTCCAAGACGTCCTTCTTCTCTTCCCTTCAGGGCAAGGCC
TTGGACAGCCTCACGTCGTTGACGGCCGAGTACTGGCGCGACAATCTCGTCAAGCCCGTGCTGTTCTCGTCGGCG
CTCGAGGCCCTCTGCCGCGAGGCCGAGCCGACGGTCCTGGTCGAGATCGGGCCTCATGCCGCTCTCGAGGGTCCC
ATCAAGCAAGTGCTCCGCGAGATGGGTGACAAGGTGGCCAGCAGCATCAAGTATTGTCCTACTCTTGTTCGCAAC
AAGGATGCCAGCGCAGCGGCTCTCCAGACCGCTGGGCGACTCTACGTCATGGGCCAGCCCATCCGCTTTGAAGAG
GTCAATCAGATGAATGAGGCTGACCCGCCGAGCGTCATTGAAGACATGCTCCCATACCCCTGGACGCACGAAAAG
TACTGGCACGAGACGCGCATGAGCCGCGAGCATCGGATCAAGGAGTTTGCTCGCCATGACCTTCTCGGACGCCTG
AGCACCTCGTCCAGCGACTTTGAGCATCGCTGGCGCAACATCCTCACCACCGACGACGTGCCGTGGCTGAGGGAT
CACAAGATGCAGTCGCTCGTTACCTTTCCCTTTGCCGGCTTCATCGCCATGGTCGCCGAGGCCGCCTCGCAGCGG
GCGGCCATGAAGCGCGTCTCCTTCGATCGCTTCTGCTTGCGCGAGGTCCAGATTACTTCGCCGCTCATCATGAAC
GACGGCGACGAGTATGAGGTGACGTTGAGCCTGAGCCGGTACGCCGAGGGCACGCGCTCCTACTCCAACGCTTGG
GACTCGTTCTGCGTCTCATCGTGGACGCAGCAGAGGGGATGGGTCGAGCACTGCCGCGGTCTCGTTTCTGTTCGC
AAGAACGAGGCTGCCAATCCGGTCGGCTTGACGGTCAGGAGAGACGCTCGCCGCCGGTTCGACAGGGCCTCTGGC
GTGTGTAACGAAGTTGTCGACAAGGACAAGTTTTACGCTGACTTGACCGGCAACGGAGCCGAGTACGGGCCCCTG
TTCCGGATCGACGACGATACCCTCGTTGGCGAGGGACACTCCCTCACCACCATCAAGGTTCCCGACACGTCCGCC
TGCATGCCTCACAACTACGAGGCGCCCTCGATCCTATCGGCAGCCGTGCTTGACATGTTCTTCCACCTGACGTTT
GCCATCCTCGGAGCTGGACGCGGCCTGATGCCGAATCTGTACATGCCAAATGCCGTCAAGCACATGGAGTTTAGC
AAGGAGTTCCCTGCCACTCCAGGTAAGACGATGCGGGCCATCTGCGAGGGCTATCCCGACACGGTCAATCTGATT
CCCGCCGACTTCTTCATCGACGTGTGGGAATCGCCGGACTCGGCTCAGCCGCTGTTCAGCACCCAGGGATTCACC
ATGACGCCCGTCAACGATCGCGTCAATGAGCAGCTTGAGCCGCCTTCCATCTGCTTCAAGGTTGAGTGGGAGGAG
CTTGGAGGCAAGGAGAGTCCCGCTGCAGTTGAAAATGGGCAAGCCAATGGCAGCAATGGACATGACAGCAACGGC
GTCAATGGCCACTCAAACGGTCACAGCAACGGCCACAGCAACGGGACCAACGGAGTCAACGGCTCCAATGGAGTC
CACGATTTGAACGGTCACGCCGACGTTGAAGCCGACAGCCCCCCCGAGTTCTCGGCCCCCGTCGTCATCATCTCC
GACAACAAGGGCGAAAGTGACCCCTTGGCCAAAGCCCTCGTCGACCTCATCGCCCTCAAGACGGGAGCGACGCCA
ACCATCTGCCCGCTCGACACTCTCGACGCCACCGACAAGATCTGCATCGCCGTCTGCGAGCTCAACAGCCCCGTC
ATCTCCAACATCAGCGGCAAGGCTTTTGACAAGCTGCAAAAGGTCATTCTCACCGCCCACGCCCTGCTCTGGGTC
AGCGCCGGCACTTTCAAGAATGCCAAGCACCCGGATAGCGCGTTGGCTCAGGGTCTGCTGCGGACGGTGCGCTCT
GAGACGAGCAAGATGGCCGCCACGCTTGACCTTGACCCGGACTCTCCTCTCGACAACGGGTCCCGGTCCGAGCTC
ATCATCCAGGCCTTGCGGCGCGTTCTGGCGTCCGAGACGGAGCTTGGGCCGAGTGACTTCGAGTTTGCCGAGAGT
GAGGGCAAGCTCGTCGTCCCCCGTGTCGTCGAAGATGAAGAGATGAACCAGCTCGTCCAGCACCAGACGCAACCG
ACTGGACCCTACCTTCAGCCCTTTGACCAGTACGGTCGCCGGCTACAGATCGCCATCGGCACCTACGGCGCGCTC
GACTCGCTGTACTTTTGCGATCAGCCGGCCCGGCCGTTGCGAGATGACGAGGTCGAGGTCAAGATTGCTGCCACC
GGCATGAACTTCAAGGACGTTGTCATCGCCATGGGTCAGGTTCCCAGCCCCTATCTCGGCGTCGAGTGCAGTGGT
ACCATCTCCAACGTGGGCGCCAAGGTCACCTCGCTCTCGGTTGGCGATCGCGTCTGTGCAATGTCCCTGGGGGCG
TACGGCACCTTTGCCCGCTGTCGGGCGACGAGCGCGGCTGTCATTCCTCACGACATGAGTTTCGAGACGGCGGCC
TCGATCCCTGTCGTCTACTCGACCGCCTACTACGGCATGGTCGAGCTGGCCCGCATCCAGGCCGGGGAGAGTATC
CTGATCCACGCTGCCTCGGGCGGTGTCGGTCAGGCTGCCATCCAGCTGGCCCACATGATCGGAGCCGAGATATAC
GCCACGGTTGGCGGCGCCGACAAGAAGCAGCTGCTGATGGACAAGTACGGCATCCCTGAGGACCGCATCTTCTAC
AGTCGTACCGCCGACTTCGGCCCGGCCATCCGCGAAGCCACTGGCGGCCACGGTGTCGACGTCGTCCTCAACTCG
CTGGCCGGCGAGCTGCTGCGCGAGTCGTGGGAGAGTCTGGCGCACTTTGGACGCTTCATCGAGATTGGCAAGCGT
GATATCACGTCCAACACGCGTCTCGACATGAACAAGTTTGAGCACAACGTCACCTTTAGCTCCGTCGATCTGACG
CTCGTCGCCTCGGAGAGACCAAAGATCATGAGCAGCGTCCTCAACTCTGTCATGGAGCTGATGGGTAAGAAGAGC
ATCGCGCCCATCGGTCCCATTACCGTCCTCGGCATCTCTGAGCTCGAGACGGCTCTGCGCACGCTCCAGAGCGGC
AAGTCGACGGGGAAGCTCATCATCTCTCCGCGTCCGGGGGAGCAAGTCAAGGTCACCCATCGCCCAGCAGCCACC
ATCCTCAACGGTCATGCCACCTACATCATCATCGGCGGTACGGGCGGCCTGGGGAGATCCATGGCTAAGCGTATG
GTCCAGCGAGGCGCCAAGCACATTGTGCTCCTGTCCCGAGCCGGTCGCATGACGGCTGAGCTGGCGCAGCTGAGC
GACGAGTGCCGCGGCCTCGGCGCTACCATCACCGTCAAGGCTTGCAACGTTGCCAACGAGGGGAGTGTCAGGCAG
GTTGTCGAAGAGTGTACCCGGTCTCTGCCGCCCATCCGAGGTGTCATCCACGCGGCCATGGTCCTCCGGGACATG
CTGTTCGAGAAGATGTCGTTCGATGACTTCCATCAGGTCATGGAATCCAAGGTGGCTGGCACCTGGAACTTCCAC
CGCGCTCTGAGCAGCCACCAGCTCGACTTCTTTATCATGCTCTCGTCAGTCGCTGGTATCGTCGGAAACAGGGGT
CAAGCCGCCTACGCAGCGGCCAACACTTTCCTCGACGCCTTCGTTCAGTACAGGACACAGAGGGGCCTGCCAGCC
ACGTCGATCGACCTGACGGCCGTTGAGGACGTGGGTTATCTGGCCGAGAACGCTGCTCGATCCAAGGAGGTGCTC
AAGACTCTCGAGGGCAACTCTTTCGGCGAGGCAGAGGTGCTGGCCCTGCTCGAGGCCGGCATTCGTGGTCAAATC
TCGCAGTTGTCCAACAGCCAGTGCATCACGGGTCTCAGCTTCGCCGGTTCGTCACTGCCCTTCTACGCCGACGAC
GCCCGCTTTGTCCGTCTCCGCGAGGCCTACCAGTCGACGATGCAGATGAACGACGCCGCGGCTCCCGGCCAGTCA
CTGCCGTCGCAGGAGCTCATCCAGGCTCCCTCATACGACGAGGCCGTCAATGTGGTCAGCCAGAGGATAAGCGAG
AAGCTCTGCGCCATCTTGATGCTGCAGCCGGGCGACGTGGATACCAAGACGTCGGTCAAGTCGTACGGCCTCGAC
TCGCTCAACGCCATCGAGCTGCGCAACTGGATCGGCAAGGAGTATCTCGCTCATCTGCAGGTCCTCGAGCTGTTG
ACCTCGGGCGCCATCTCGGATCTCGCGGCGCTGACGATGAAGAAGTCCAAGATTCAGCATGCGCACAAGGAGCCT
TGA
Transcript >Ophun1|7483
ATGGCGTCAGACAATGGCCGGAAGCTGGCCCCTGTCGCCGTGGTCGGCATGTCATGCCGTCTCCCCGGCGGCGTC
TCGACTCTCGATGACTTTTGGACAATGCTCTCGCGTGCCCGCTCCGGCTGGCGGGAGATTCCAGAGGACCGTTTC
AGCAGCAAGGCGTTTTTCCACCCGAATCCGCAGAAGAAGGGCTGCTTCAACGCCCGGGGCGGCTATTTCATGGAC
CACGACCTGAGCTTGTTTGACGCTCCATTCTTCAACATTACCAAGCAAGAGGCCCTGGCCATGGATCCCAAGCAG
CGGCAGCTCCTCGAGTGCACTTACGAGGCCCTCGAAAACGCCGGCATCTCCAAGGAGAGCGTAGCCGGCAGCAAC
ATGGGCGTCTTCGTCGGCGGCTCCGTCTCTGATTACGCCATGAGCACCTTTCGCGACCCGGACTCGATTCCCATG
TTTGACGTGACGGGCAACCATCAGTCGATTCTGTCCGGTCGTATCTCTCACGCCTTTGACCTCCGTGGGCCGTGC
TTCTCCGTCGACACGGCCTGTTCATCCGGCCTGTACGCTCTGCACGCGGCGGTGCAGAGCATCCGTAGCGGGGAC
TGTGACTCTGCCGTCGTTGCAGGCTGTCACCTGCATCTGCAGCCGGATCATTGGGTCTCCATGTCCATGTCTGGC
CTCTTTGCCGAACATGGCAAGACGTATGCCTTTGATCACCGCGCCAAGTCCGGCTTCGCCCGTGGAGAGGGAGTC
GGCTGCCTTATCCTCAAGTCACTGGATCGGGCTCGAGCGGACAAGGACCAGATCAGGTCCATCATCGTCAACACT
GGCGCCAACCAGGATGGCAGGACCGTCGGACTGTCGACCCCAAGCGTCGAGGCGCAAGAGCAGCTGATCCGTGAC
GTTTATACCAAAGCTGGCGTCAACGTCCAGGAAGTCGGTTTCGTCGAGGCTCACGGAACAGGCACCAAGATCGGC
GATCCGATAGAGGCCAGGGCCATCTACAACGCCCTCGGCGAGGGCCGCACCAAGAGGCAGCCGCTGTACATGGGC
TCGGTCAAAACCAACATTGGCCATCTGGAGAACGCCAGCGGTATCATCTCGGTCATCAAGGCGTCCCTCATGCTG
GAAAAGGGCTTCATTCTGCCCAATGTCAATTTCGAAAAGGCCAACCCCAGCATTCCGCTCGATGAGTGGAACATC
AAGGTTCCCACCAACCTGCGGTCATGGCCTGCTCAGAAGCGATTCATCAGCGTCAACAACTTTGGCTTCGGAGGA
TCCAACGCTCACTGCATCCTCCAGCGTCCCGACCTCGTACCCTCCTCGCTCACCCAGGAAAAGTCGGACAACCAT
CATAAACTCTTCGTCCTGTCCGGCTACACCGAGGATGCCGCCAAGCAGCGGTCCAAGCACCTCGGCATCTACGCC
GAGCAGCATCCGGAGGTCTTCCAGAAGCGTCTCGTCAACAACCTGGCTTACACCTTGTGCCAGCGACGATCTCAC
CTCCCCTGGCGCGTTGCCGTAACGGCCACCTGCTGCAGCGAAATCGTCGAGGCACTCAACAGCATCGATGCCAAG
CCGGCTCGCGCCTCGGGCAAGGCGCCCAAGATTGCCTTCGTCTTCACCGGCCAGGGCGCTCAGTGGCACGCCATG
GGTCGCGAGCTGATGACGTCACACCCGGTCTTCGCCGACACTATGCGCGAGGCCGACGCCTGTCTGTCGCGTCTG
GGAGCCGACTTTTCTCTTCTCGAGGAGCTGGCCAAGGACAAGGAGACGTCCGAGGTCAACAAGGCCAGGCTGAGT
CAGCCGGCCTGCACCGCCGTTCAACTTGCCCTCGTCCGCCTGCTGGCATCGTGGGGGATCGAGCCCCAGGCCGTC
GTTGGCCATTCGAGCGGTGAGATCGGCGCAGCCTTCGCTACAGGCGCCATCAGCCTGGAAGATGCCATGGCAGCT
GCCTTCCAGCGAGGCCAGGCCACGCTGCGGATGAAGGCCGAGCACCCGGATCTCAAGGGCGGCATGTTGGCTGTG
GGCGCGAGTCCGGCCGAGGTGCGCAAGACGATCAAGGCTCTGGGCCTCGAGGGCGCTGCTGTCGCCTGCGAGAAC
TCGCCTGGATCGACTACCGTCTCGGGAGACGTCCAGGATGTCGAGAAGCTGGCCGCCGAGCTGGAGAGCCGCAAG
GTCTTCAACCGCAAGCTGCTCGTTGACGTCGCCTACCACTCGTCGCACATGGAGCTCGTGGCCGAAGAGTACACG
CGTTCTATCAAGAATATCAAGGCGACCGAGGGCAGCTCCAAGACGTCCTTCTTCTCTTCCCTTCAGGGCAAGGCC
TTGGACAGCCTCACGTCGTTGACGGCCGAGTACTGGCGCGACAATCTCGTCAAGCCCGTGCTGTTCTCGTCGGCG
CTCGAGGCCCTCTGCCGCGAGGCCGAGCCGACGGTCCTGGTCGAGATCGGGCCTCATGCCGCTCTCGAGGGTCCC
ATCAAGCAAGTGCTCCGCGAGATGGGTGACAAGGTGGCCAGCAGCATCAAGTATTGTCCTACTCTTGTTCGCAAC
AAGGATGCCAGCGCAGCGGCTCTCCAGACCGCTGGGCGACTCTACGTCATGGGCCAGCCCATCCGCTTTGAAGAG
GTCAATCAGATGAATGAGGCTGACCCGCCGAGCGTCATTGAAGACATGCTCCCATACCCCTGGACGCACGAAAAG
TACTGGCACGAGACGCGCATGAGCCGCGAGCATCGGATCAAGGAGTTTGCTCGCCATGACCTTCTCGGACGCCTG
AGCACCTCGTCCAGCGACTTTGAGCATCGCTGGCGCAACATCCTCACCACCGACGACGTGCCGTGGCTGAGGGAT
CACAAGATGCAGTCGCTCGTTACCTTTCCCTTTGCCGGCTTCATCGCCATGGTCGCCGAGGCCGCCTCGCAGCGG
GCGGCCATGAAGCGCGTCTCCTTCGATCGCTTCTGCTTGCGCGAGGTCCAGATTACTTCGCCGCTCATCATGAAC
GACGGCGACGAGTATGAGGTGACGTTGAGCCTGAGCCGGTACGCCGAGGGCACGCGCTCCTACTCCAACGCTTGG
GACTCGTTCTGCGTCTCATCGTGGACGCAGCAGAGGGGATGGGTCGAGCACTGCCGCGGTCTCGTTTCTGTTCGC
AAGAACGAGGCTGCCAATCCGGTCGGCTTGACGGTCAGGAGAGACGCTCGCCGCCGGTTCGACAGGGCCTCTGGC
GTGTGTAACGAAGTTGTCGACAAGGACAAGTTTTACGCTGACTTGACCGGCAACGGAGCCGAGTACGGGCCCCTG
TTCCGGATCGACGACGATACCCTCGTTGGCGAGGGACACTCCCTCACCACCATCAAGGTTCCCGACACGTCCGCC
TGCATGCCTCACAACTACGAGGCGCCCTCGATCCTATCGGCAGCCGTGCTTGACATGTTCTTCCACCTGACGTTT
GCCATCCTCGGAGCTGGACGCGGCCTGATGCCGAATCTGTACATGCCAAATGCCGTCAAGCACATGGAGTTTAGC
AAGGAGTTCCCTGCCACTCCAGGTAAGACGATGCGGGCCATCTGCGAGGGCTATCCCGACACGGTCAATCTGATT
CCCGCCGACTTCTTCATCGACGTGTGGGAATCGCCGGACTCGGCTCAGCCGCTGTTCAGCACCCAGGGATTCACC
ATGACGCCCGTCAACGATCGCGTCAATGAGCAGCTTGAGCCGCCTTCCATCTGCTTCAAGGTTGAGTGGGAGGAG
CTTGGAGGCAAGGAGAGTCCCGCTGCAGTTGAAAATGGGCAAGCCAATGGCAGCAATGGACATGACAGCAACGGC
GTCAATGGCCACTCAAACGGTCACAGCAACGGCCACAGCAACGGGACCAACGGAGTCAACGGCTCCAATGGAGTC
CACGATTTGAACGGTCACGCCGACGTTGAAGCCGACAGCCCCCCCGAGTTCTCGGCCCCCGTCGTCATCATCTCC
GACAACAAGGGCGAAAGTGACCCCTTGGCCAAAGCCCTCGTCGACCTCATCGCCCTCAAGACGGGAGCGACGCCA
ACCATCTGCCCGCTCGACACTCTCGACGCCACCGACAAGATCTGCATCGCCGTCTGCGAGCTCAACAGCCCCGTC
ATCTCCAACATCAGCGGCAAGGCTTTTGACAAGCTGCAAAAGGTCATTCTCACCGCCCACGCCCTGCTCTGGGTC
AGCGCCGGCACTTTCAAGAATGCCAAGCACCCGGATAGCGCGTTGGCTCAGGGTCTGCTGCGGACGGTGCGCTCT
GAGACGAGCAAGATGGCCGCCACGCTTGACCTTGACCCGGACTCTCCTCTCGACAACGGGTCCCGGTCCGAGCTC
ATCATCCAGGCCTTGCGGCGCGTTCTGGCGTCCGAGACGGAGCTTGGGCCGAGTGACTTCGAGTTTGCCGAGAGT
GAGGGCAAGCTCGTCGTCCCCCGTGTCGTCGAAGATGAAGAGATGAACCAGCTCGTCCAGCACCAGACGCAACCG
ACTGGACCCTACCTTCAGCCCTTTGACCAGTACGGTCGCCGGCTACAGATCGCCATCGGCACCTACGGCGCGCTC
GACTCGCTGTACTTTTGCGATCAGCCGGCCCGGCCGTTGCGAGATGACGAGGTCGAGGTCAAGATTGCTGCCACC
GGCATGAACTTCAAGGACGTTGTCATCGCCATGGGTCAGGTTCCCAGCCCCTATCTCGGCGTCGAGTGCAGTGGT
ACCATCTCCAACGTGGGCGCCAAGGTCACCTCGCTCTCGGTTGGCGATCGCGTCTGTGCAATGTCCCTGGGGGCG
TACGGCACCTTTGCCCGCTGTCGGGCGACGAGCGCGGCTGTCATTCCTCACGACATGAGTTTCGAGACGGCGGCC
TCGATCCCTGTCGTCTACTCGACCGCCTACTACGGCATGGTCGAGCTGGCCCGCATCCAGGCCGGGGAGAGTATC
CTGATCCACGCTGCCTCGGGCGGTGTCGGTCAGGCTGCCATCCAGCTGGCCCACATGATCGGAGCCGAGATATAC
GCCACGGTTGGCGGCGCCGACAAGAAGCAGCTGCTGATGGACAAGTACGGCATCCCTGAGGACCGCATCTTCTAC
AGTCGTACCGCCGACTTCGGCCCGGCCATCCGCGAAGCCACTGGCGGCCACGGTGTCGACGTCGTCCTCAACTCG
CTGGCCGGCGAGCTGCTGCGCGAGTCGTGGGAGAGTCTGGCGCACTTTGGACGCTTCATCGAGATTGGCAAGCGT
GATATCACGTCCAACACGCGTCTCGACATGAACAAGTTTGAGCACAACGTCACCTTTAGCTCCGTCGATCTGACG
CTCGTCGCCTCGGAGAGACCAAAGATCATGAGCAGCGTCCTCAACTCTGTCATGGAGCTGATGGGTAAGAAGAGC
ATCGCGCCCATCGGTCCCATTACCGTCCTCGGCATCTCTGAGCTCGAGACGGCTCTGCGCACGCTCCAGAGCGGC
AAGTCGACGGGGAAGCTCATCATCTCTCCGCGTCCGGGGGAGCAAGTCAAGGTCACCCATCGCCCAGCAGCCACC
ATCCTCAACGGTCATGCCACCTACATCATCATCGGCGGTACGGGCGGCCTGGGGAGATCCATGGCTAAGCGTATG
GTCCAGCGAGGCGCCAAGCACATTGTGCTCCTGTCCCGAGCCGGTCGCATGACGGCTGAGCTGGCGCAGCTGAGC
GACGAGTGCCGCGGCCTCGGCGCTACCATCACCGTCAAGGCTTGCAACGTTGCCAACGAGGGGAGTGTCAGGCAG
GTTGTCGAAGAGTGTACCCGGTCTCTGCCGCCCATCCGAGGTGTCATCCACGCGGCCATGGTCCTCCGGGACATG
CTGTTCGAGAAGATGTCGTTCGATGACTTCCATCAGGTCATGGAATCCAAGGTGGCTGGCACCTGGAACTTCCAC
CGCGCTCTGAGCAGCCACCAGCTCGACTTCTTTATCATGCTCTCGTCAGTCGCTGGTATCGTCGGAAACAGGGGT
CAAGCCGCCTACGCAGCGGCCAACACTTTCCTCGACGCCTTCGTTCAGTACAGGACACAGAGGGGCCTGCCAGCC
ACGTCGATCGACCTGACGGCCGTTGAGGACGTGGGTTATCTGGCCGAGAACGCTGCTCGATCCAAGGAGGTGCTC
AAGACTCTCGAGGGCAACTCTTTCGGCGAGGCAGAGGTGCTGGCCCTGCTCGAGGCCGGCATTCGTGGTCAAATC
TCGCAGTTGTCCAACAGCCAGTGCATCACGGGTCTCAGCTTCGCCGGTTCGTCACTGCCCTTCTACGCCGACGAC
GCCCGCTTTGTCCGTCTCCGCGAGGCCTACCAGTCGACGATGCAGATGAACGACGCCGCGGCTCCCGGCCAGTCA
CTGCCGTCGCAGGAGCTCATCCAGGCTCCCTCATACGACGAGGCCGTCAATGTGGTCAGCCAGAGGATAAGCGAG
AAGCTCTGCGCCATCTTGATGCTGCAGCCGGGCGACGTGGATACCAAGACGTCGGTCAAGTCGTACGGCCTCGAC
TCGCTCAACGCCATCGAGCTGCGCAACTGGATCGGCAAGGAGTATCTCGCTCATCTGCAGGTCCTCGAGCTGTTG
ACCTCGGGCGCCATCTCGGATCTCGCGGCGCTGACGATGAAGAAGTCCAAGATTCAGCATGCGCACAAGGAGCCT
TGA
Gene >Ophun1|7483
ATGGCGTCAGACAATGGCCGGAAGCTGGCCCCTGTCGCCGTGGTCGGCATGTCATGCCGTCTCCCCGGCGGCGTC
TCGACTCTCGATGACTTTTGGACAATGCTCTCGCGTGCCCGCTCCGGCTGGCGGGAGATTCCAGAGGACCGTTTC
AGCAGCAAGGCGTTTTTCCACCCGAATCCGCAGAAGAAGGGCTGCTTCAACGCCCGGGGCGGCTATTTCATGGAC
CACGACCTGAGCTTGTTTGACGCTCCATTCTTCAACATTACCAAGCAAGAGGCCCTGGCCATGGGTATGTCCCCT
GCAAGAGGGTAGAAGAGGAAGAAGACTAACAAGGACGTACAGATCCCAAGCAGCGGCAGCTCCTCGAGTGCACTT
ACGAGGCCCTCGAAAACGCCGGCATCTCCAAGGAGAGCGTAGCCGGCAGCAACATGGGCGTCTTCGTCGGCGGCT
CCGTCTCTGATTACGCCATGAGCACCTTTCGCGACCCGGACTCGATTCCCATGTTTGACGTGACGGGCAACCATC
AGTCGATTCTGTCCGGTCGTATCTCTCACGCCTTTGACCTCCGTGGGCCGTGCTTCTCCGTCGACACGGCCTGTT
CATCCGGCCTGTACGCTCTGCACGCGGCGGTGCAGAGCATCCGTAGCGGGGACTGTGACTCTGCCGTCGTTGCAG
GCTGTCACCTGCATCTGCAGCCGGATCATTGGGTCTCCATGTCCATGTCTGGGTAGGTGAATCTCTTTCCTCGGC
TTCGTGGGCTTGACTGAACATCTGGACGCAGCCTCTTTGCCGAACATGGCAAGACGTATGCCTTTGATCACCGCG
CCAAGTCCGGCTTCGCCCGTGGAGAGGGAGTCGGCTGCCTTATCCTCAAGTCACTGGATCGGGCTCGAGCGGACA
AGGACCAGATCAGGTCCATCATCGTCAACACTGGCGCCAACCAGGATGGCAGGACCGTCGGTAAGGCCATCTTTC
TCTTCTCTGTATGTTTCTGATACTGACCACATATTCAGGACTGTCGACCCCAAGCGTCGAGGCGCAAGAGCAGCT
GATCCGTGACGTTTATACCAAAGCTGGCGTCAACGTCCAGGAAGTCGGTTTCGTCGAGGCTCACGGAACAGGCAC
CAAGATCGGCGATCCGATAGAGGCCAGGGCCATCTACAACGCCCTCGGCGAGGGCCGCACCAAGAGGCAGCCGCT
GTACATGGGCTCGGTCAAAACCAACATTGGCCATCTGGAGAACGCCAGCGGTATCATCTCGGTCATCAAGGCGTC
CCTCATGCTGGAAAAGGGCTTCATTCTGCCCAATGTCAATTTCGAAAAGGCCAACCCCAGCATTCCGCTCGATGA
GTGGAACATCAAGGTTCCCACCAACCTGCGGTCATGGCCTGCTCAGAAGCGATTCATCAGCGTCAACAACTTTGG
CTTCGGAGGATCCAACGCTCACTGCATCCTCCAGCGTCCCGACCTCGTACCCTCCTCGCTCACCCAGGAAAAGTC
GGACAACCATCATAAACTCTTCGTCCTGTCCGGCTACACCGAGGATGCCGCCAAGCAGCGGTCCAAGCACCTCGG
CATCTACGCCGAGCAGCATCCGGAGGTCTTCCAGAAGCGTCTCGTCAACAACCTGGCTTACACCTTGTGCCAGCG
ACGATCTCACCTCCCCTGGCGCGTTGCCGTAACGGCCACCTGCTGCAGCGAAATCGTCGAGGCACTCAACAGCAT
CGATGCCAAGCCGGCTCGCGCCTCGGGCAAGGCGCCCAAGATTGCCTTCGTCTTCACCGGCCAGGGCGCTCAGTG
GCACGCCATGGGTCGCGAGCTGATGACGTCACACCCGGTCTTCGCCGACACTATGCGCGAGGCCGACGCCTGTCT
GTCGCGTCTGGGAGCCGACTTTTCTCTTCTCGAGGAGCTGGCCAAGGACAAGGAGACGTCCGAGGTCAACAAGGC
CAGGCTGAGTCAGCCGGCCTGCACCGCCGTTCAACTTGCCCTCGTCCGCCTGCTGGCATCGTGGGGGATCGAGCC
CCAGGCCGTCGTTGGCCATTCGAGCGGTGAGATCGGCGCAGCCTTCGCTACAGGCGCCATCAGCCTGGAAGATGC
CATGGCAGCTGCCTTCCAGCGAGGCCAGGCCACGCTGCGGATGAAGGCCGAGCACCCGGATCTCAAGGGCGGCAT
GTTGGCTGTGGGCGCGAGTCCGGCCGAGGTGCGCAAGACGATCAAGGCTCTGGGCCTCGAGGGCGCTGCTGTCGC
CTGCGAGAACTCGCCTGGATCGACTACCGTCTCGGGAGACGTCCAGGATGTCGAGAAGCTGGCCGCCGAGCTGGA
GAGCCGCAAGGTCTTCAACCGCAAGCTGCTCGTTGACGTCGCCTACCACTCGTCGCACATGGAGCTCGTGGCCGA
AGAGTACACGCGTTCTATCAAGAATATCAAGGCGACCGAGGGCAGCTCCAAGACGTCCTTCTTCTCTTCCCTTCA
GGGCAAGGCCTTGGACAGCCTCACGTCGTTGACGGCCGAGTACTGGCGCGACAATCTCGTCAAGCCCGTGCTGTT
CTCGTCGGCGCTCGAGGCCCTCTGCCGCGAGGCCGAGCCGACGGTCCTGGTCGAGATCGGGCCTCATGCCGCTCT
CGAGGGTCCCATCAAGCAAGTGCTCCGCGAGATGGGTGACAAGGTGGCCAGCAGCATCAAGTATTGTCCTACTCT
TGTTCGCAACAAGGATGCCAGCGCAGCGGCTCTCCAGACCGCTGGGCGACTCTACGTCATGGGCCAGCCCATCCG
CTTTGAAGAGGTCAATCAGATGAATGAGGCTGACCCGCCGAGCGTCATTGAAGACATGCTCCCATACCCCTGGAC
GCACGAAAAGTACTGGCACGAGACGCGCATGAGCCGCGAGCATCGGATCAAGGAGTTTGCTCGCCATGACCTTCT
CGGACGCCTGAGCACCTCGTCCAGCGACTTTGAGCATCGCTGGCGCAACATCCTCACCACCGACGACGTGCCGTG
GCTGAGGGATCACAAGATGCAGTCGCTCGTTACCTTTCCCTTTGCCGGCTTCATCGCCATGGTCGCCGAGGCCGC
CTCGCAGCGGGCGGCCATGAAGCGCGTCTCCTTCGATCGCTTCTGCTTGCGCGAGGTCCAGATTACTTCGCCGCT
CATCATGAACGACGGCGACGAGTATGAGGTGACGTTGAGCCTGAGCCGGTACGCCGAGGGCACGCGCTCCTACTC
CAACGCTTGGGACTCGTTCTGCGTCTCATCGTGGACGCAGCAGAGGGGATGGGTCGAGCACTGCCGCGGTCTCGT
TTCTGTTCGCAAGAACGAGGCTGCCAATCCGGTCGGCTTGACGGTCAGGAGAGACGCTCGCCGCCGGTTCGACAG
GGCCTCTGGCGTGTGTAACGAAGTTGTCGACAAGGACAAGTTTTACGCTGACTTGACCGGCAACGGAGCCGAGTA
CGGGCCCCTGTTCCGGATCGACGACGATACCCTCGTTGGCGAGGGACACTCCCTCACCACCATCAAGGTTCCCGA
CACGTCCGCCTGCATGCCTCACAACTACGAGGCGCCCTCGATCCTATCGGCAGCCGTGCTTGACATGTTCTTCCA
CCTGACGTTTGCCATCCTCGGAGCTGGACGCGGCCTGATGCCGAATCTGTACATGCCAAATGCCGTCAAGCACAT
GGAGTTTAGCAAGGAGTTCCCTGCCACTCCAGGTAAGACGATGCGGGCCATCTGCGAGGGCTATCCCGACACGGT
CAATCTGATTCCCGCCGACTTCTTCATCGACGTGTGGGAATCGCCGGACTCGGCTCAGCCGCTGTTCAGCACCCA
GGGATTCACCATGACGCCCGTCAACGATCGCGTCAATGAGCAGCTTGAGCCGCCTTCCATCTGCTTCAAGGTTGA
GTGGGAGGAGCTTGGAGGCAAGGAGAGTCCCGCTGCAGTTGAAAATGGGCAAGCCAATGGCAGCAATGGACATGA
CAGCAACGGCGTCAATGGCCACTCAAACGGTCACAGCAACGGCCACAGCAACGGGACCAACGGAGTCAACGGCTC
CAATGGAGTCCACGATTTGAACGGTCACGCCGACGTTGAAGCCGACAGCCCCCCCGAGTTCTCGGCCCCCGTCGT
CATCATCTCCGACAACAAGGGCGAAAGTGACCCCTTGGCCAAAGCCCTCGTCGACCTCATCGCCCTCAAGACGGG
AGCGACGCCAACCATCTGCCCGCTCGACACTCTCGACGCCACCGACAAGATCTGCATCGCCGTCTGCGAGCTCAA
CAGCCCCGTCATCTCCAACATCAGCGGCAAGGCTTTTGACAAGCTGCAAAAGGTCATTCTCACCGCCCACGCCCT
GCTCTGGGTCAGCGCCGGCACTTTCAAGAATGCCAAGCACCCGGATAGCGCGTTGGCTCAGGGTCTGCTGCGGAC
GGTGCGCTCTGAGACGAGCAAGATGGCCGCCACGCTTGACCTTGACCCGGACTCTCCTCTCGACAACGGGTCCCG
GTCCGAGCTCATCATCCAGGCCTTGCGGCGCGTTCTGGCGTCCGAGACGGAGCTTGGGCCGAGTGACTTCGAGTT
TGCCGAGAGTGAGGGCAAGCTCGTCGTCCCCCGTGTCGTCGAAGATGAAGAGATGAACCAGCTCGTCCAGCACCA
GACGCAACCGACTGGACCCTACCTTCAGCCCTTTGACCAGTACGGTCGCCGGCTACAGATCGCCATCGGCACCTA
CGGCGCGCTCGACTCGCTGTACTTTTGCGATCAGCCGGCCCGGCCGTTGCGAGATGACGAGGTCGAGGTCAAGAT
TGCTGCCACCGGCATGAACTTCAAGGACGTTGTCATCGCCATGGGTCAGGTTCCCAGCCCCTATCTCGGCGTCGA
GTGCAGTGGTACCATCTCCAACGTGGGCGCCAAGGTCACCTCGCTCTCGGTTGGCGATCGCGTCTGTGCAATGTC
CCTGGGGGCGTACGGCACCTTTGCCCGCTGTCGGGCGACGAGCGCGGCTGTCATTCCTCACGACATGAGTTTCGA
GACGGCGGCCTCGATCCCTGTCGTCTACTCGACCGCCTACTACGGCATGGTCGAGCTGGCCCGCATCCAGGCCGG
GGAGAGTATCCTGATCCACGCTGCCTCGGGCGGTGTCGGTCAGGCTGCCATCCAGCTGGCCCACATGATCGGAGC
CGAGATATACGCCACGGTTGGCGGCGCCGACAAGAAGCAGCTGCTGATGGACAAGTACGGCATCCCTGAGGACCG
CATCTTCTACAGTCGTACCGCCGACTTCGGCCCGGCCATCCGCGAAGCCACTGGCGGCCACGGTGTCGACGTCGT
CCTCAACTCGCTGGCCGGCGAGCTGCTGCGCGAGTCGTGGGAGAGTCTGGCGCACTTTGGACGCTTCATCGAGAT
TGGCAAGCGTGATATCACGTCCAACACGCGTCTCGACATGAACAAGTTTGAGCACAACGTCACCTTTAGCTCCGT
CGATCTGACGCTCGTCGCCTCGGAGAGACCAAAGATCATGAGCAGCGTCCTCAACTCTGTCATGGAGCTGATGGG
TAAGAAGAGCATCGCGCCCATCGGTCCCATTACCGTCCTCGGCATCTCTGAGCTCGAGACGGCTCTGCGCACGCT
CCAGAGCGGCAAGTCGACGGGGAAGCTCATCATCTCTCCGCGTCCGGGGGAGCAAGTCAAGGTACTTTACTGTTC
TTCTCTCTGATGTGTCTCGTGGATGCTAACGCGAGGTTATCATAGGTCACCCATCGCCCAGCAGCCACCATCCTC
AACGGTCATGCCACCTACATCATCATCGGCGGTACGGGCGGCCTGGGGAGATCCATGGCTAAGCGTATGGTCCAG
CGAGGCGCCAAGCACATTGTGCTCCTGTCCCGAGCCGGTCGCATGACGGCTGAGCTGGCGCAGCTGAGCGACGAG
TGCCGCGGCCTCGGCGCTACCATCACCGTCAAGGCTTGCAACGTTGCCAACGAGGGGAGTGTCAGGCAGGTTGTC
GAAGAGTGTACCCGGTCTCTGCCGCCCATCCGAGGTGTCATCCACGCGGCCATGGTCCTCCGGGTATGATTGTCT
ACAGACGTATCTTGATCTCGCGAAACTAACGCTTCGCAGGACATGCTGTTCGAGAAGATGTCGTTCGATGACTTC
CATCAGGTCATGGAATCCAAGGTGGCTGGCACCTGGAACTTCCACCGCGCTCTGAGCAGCCACCAGCTCGACTTC
TTTATCATGCTCTCGTCAGTCGCTGGTATCGTCGGAAACAGGGGTCAAGCCGCCTACGCAGCGGCCAACACTTTC
CTCGACGCCTTCGTTCAGTACAGGACACAGAGGGGCCTGCCAGCCACGTCGATCGACCTGACGGCCGTTGAGGAC
GTGGGTTATCTGGCCGAGAACGCTGCTCGATCCAAGGAGGTGCTCAAGACTCTCGAGGGCAACTCTTTCGGCGAG
GCAGAGGTGCTGGCCCTGCTCGAGGCCGGCATTCGTGGTCAAATCTCGCAGTTGTCCAACAGCCAGTGCATCACG
GGTCTCAGCTTCGCCGGTTCGTCACTGCCCTTCTACGCCGACGACGCCCGCTTTGTCCGTCTCCGCGAGGCCTAC
CAGTCGACGATGCAGATGAACGACGCCGCGGCTCCCGGCCAGTCACTGCCGTCGCAGGAGCTCATCCAGGCTCCC
TCATACGACGAGGCCGTCAATGTGGTCAGCCAGAGGATAAGCGAGAAGCTCTGCGCCATCTTGATGCTGCAGCCG
GGCGACGTGGATACCAAGACGTCGGTCAAGTCGTACGGCCTCGACTCGCTCAACGCCATCGAGCTGCGCAACTGG
ATCGGCAAGGAGTATCTCGCTCATCTGCAGGTCCTCGAGCTGTTGACCTCGGGCGCCATCTCGGATCTCGCGGCG
CTGACGATGAAGAAGTCCAAGATTCAGCATGCGCACAAGGAGCCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail