Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7481
Gene name
LocationContig_95:14760..17753
Strand-
Gene length (bp)2993
Transcript length (bp)2694
Coding sequence length (bp)2694
Protein length (aa) 898

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03707 MHYT Bacterial signalling protein N terminal repeat 5.9E-10 67 121
PF03707 MHYT Bacterial signalling protein N terminal repeat 1.6E-05 136 188

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O34311|YKOW_BACSU Signaling protein YkoW OS=Bacillus subtilis (strain 168) GN=ykoW PE=3 SV=2 16 218 7.0E-11
sp|Q9I310|Y1727_PSEAE Uncharacterized signaling protein PA1727 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA1727 PE=3 SV=1 19 257 1.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.5

Transmembrane Domains

Domain # Start End Length
1 20 42 22
2 55 77 22
3 92 114 22
4 127 146 19
5 161 183 22
6 238 260 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7481
MTTTAELLDRYSGQLVPLSFHAGFVCLSYAISLVGTCSTLELLRRRTSHWGLSNLVLLVGAAISMGGIAIWSMHF
IGNRAIYILDGREDIQIAYSTGMTILSLIVPIVVLVIAFLATSVNGRIRWYSISIAGFFSGGAISGMHYLADASI
SNYQAEYKMGYVAGATVISVVASTAALALFFVFETAWKVSWWKRLGCAMVLAGAVSGMHWCAAVGTGYRLLRPRN
LDRGMSRQETLIMVICLSIAAGVTITVSSIYSGWIRRDYASKSQQVVLAAAVFDDKGRIMVNQEGFLPTEVVTDT
FIPKTHNEVFDTSHPLFQWMYRASRNWNSIAPLTDKMESHISQLSQDKYNHRIGLKLIAEDGLLVPYYDQMICEL
FSLAALALARKTKEDICHMGTLWDEIFVTGNFPCSSTPPSPTLTSKQRDKSLLGDLAERGLVPPPQYGRGCLMFL
VRHVHARRDIDKLEAAGYRFAEMHHVITTISSSMQIKNHDFADRFRVMSEATHHGNPLAAGVHLGIFAVRARIDR
CGFDVLVRREARNLVPSVRLPLRRLEPWHHELLSRLQGQTPSAIIRSLYSFGKQGSREAYFASVMRHAIRGLRDL
MGDEESFGTVTLMSQVVQVPCFSDDTLRLSTCSFISFRIVLPIHATAPSLTCEFVPLSFFQTQQMVYNGSAHHVE
FSHKVHRELSSFLHVAPKQACNKGQRRPFPRRAMAWIRRSRSSRYVDDDVVLQSSIKSHKRLSAVAVSNGWPRAP
SDEMSFNDWLKRQSSSFPSPVASLGAFSQDDFSPHREKRYGGIMISQEITVDVEKVCSTSNTRETDDYAHSTQMP
NVLTTELSLNSQTGDKSNPETPSTLDETPSSTRTKYFSTAFGEHSARAALEQEGSGFVNKLLVLCMDNKANG*
Coding >Ophun1|7481
ATGACGACGACTGCGGAGCTTCTCGATCGGTATTCGGGGCAGCTGGTGCCTTTATCGTTCCATGCTGGCTTTGTG
TGTCTGAGTTATGCCATCAGTCTTGTTGGGACGTGCTCTACGCTCGAGTTGTTGCGGAGACGGACTTCTCATTGG
GGTCTTTCGAACTTAGTGCTTTTGGTGGGCGCGGCCATCTCCATGGGAGGAATCGCCATCTGGTCTATGCACTTT
ATCGGCAACAGAGCCATCTACATCCTCGATGGCAGAGAAGACATCCAAATCGCCTACTCAACCGGCATGACCATC
CTCTCCCTCATCGTCCCCATTGTCGTCCTCGTCATCGCCTTCCTCGCCACCAGCGTGAATGGCCGTATCCGCTGG
TACTCCATCTCCATCGCCGGCTTCTTCTCTGGCGGCGCCATCAGCGGGATGCACTACCTCGCCGACGCCTCCATC
AGCAATTACCAAGCCGAGTATAAGATGGGTTACGTAGCCGGCGCAACCGTCATCTCCGTCGTCGCCAGCACCGCC
GCGTTAGCCCTCTTCTTCGTCTTCGAGACGGCGTGGAAGGTCTCATGGTGGAAGAGACTGGGTTGTGCCATGGTG
TTGGCCGGTGCCGTCTCGGGAATGCACTGGTGCGCAGCCGTTGGCACTGGCTACAGGCTCCTTCGGCCGCGGAAC
CTAGATAGGGGCATGTCTCGGCAAGAGACGCTCATCATGGTCATCTGCTTGTCGATAGCCGCCGGTGTGACCATA
ACGGTCAGCTCCATCTACTCCGGGTGGATCAGACGAGACTACGCCAGCAAGTCGCAGCAGGTCGTCTTGGCGGCA
GCCGTATTCGACGACAAGGGGAGGATCATGGTGAACCAGGAGGGCTTCCTCCCGACCGAGGTCGTCACCGACACC
TTTATACCAAAGACGCACAATGAAGTCTTTGACACCAGCCACCCTCTCTTCCAGTGGATGTATCGGGCATCCCGT
AACTGGAACAGCATCGCCCCCCTTACCGACAAGATGGAAAGCCACATCAGCCAGCTGTCTCAAGACAAATACAAC
CATAGAATCGGCCTTAAGCTGATTGCCGAGGACGGCCTTCTCGTTCCCTACTACGACCAGATGATCTGCGAGCTC
TTTAGCCTAGCCGCCCTCGCCCTCGCCCGCAAGACCAAGGAGGACATCTGTCACATGGGAACGCTCTGGGACGAG
ATCTTCGTTACGGGCAACTTTCCCTGTTCCTCGACCCCTCCCAGCCCGACACTCACCTCGAAGCAAAGGGACAAG
TCGCTTCTCGGAGATCTAGCCGAACGAGGTCTCGTGCCACCTCCGCAGTACGGACGCGGATGTCTGATGTTTCTT
GTCCGCCACGTTCACGCAAGAAGGGACATTGATAAACTCGAGGCGGCAGGCTATCGCTTCGCAGAGATGCACCAC
GTCATCACCACCATCTCCTCCAGCATGCAGATCAAGAACCACGACTTTGCCGACCGGTTCCGGGTCATGTCCGAA
GCTACTCATCACGGCAACCCCTTGGCTGCAGGCGTTCATCTCGGCATCTTCGCCGTCCGCGCCAGAATTGACCGC
TGTGGCTTCGACGTGCTCGTCCGCAGAGAGGCGAGGAACCTCGTCCCCTCCGTTCGTCTCCCGCTTCGCCGCCTT
GAGCCGTGGCATCACGAGCTCCTTTCTCGGCTTCAGGGTCAGACACCCTCAGCCATCATCAGATCGCTATATAGC
TTCGGCAAACAGGGATCTCGGGAAGCCTATTTCGCTTCTGTTATGAGGCATGCTATTCGAGGGCTTCGCGACCTT
ATGGGTGACGAGGAGTCTTTCGGCACCGTGACTCTCATGTCTCAAGTCGTGCAGGTTCCCTGCTTTTCCGACGAC
ACTCTACGGCTTTCTACGTGCTCGTTCATCTCGTTCCGCATTGTGCTGCCAATCCACGCAACAGCTCCGTCTCTC
ACCTGCGAGTTCGTCCCATTGAGCTTCTTCCAAACCCAGCAAATGGTGTACAATGGCTCAGCGCATCACGTCGAG
TTCTCCCACAAGGTCCACCGCGAGCTCTCCTCCTTTCTTCACGTCGCGCCCAAACAAGCGTGCAACAAGGGCCAG
AGAAGGCCGTTTCCGCGCCGTGCAATGGCATGGATCCGGAGATCACGGTCCTCGCGCTACGTCGATGACGACGTC
GTCTTGCAATCTTCCATCAAGAGTCACAAGCGGTTATCGGCAGTGGCTGTTAGCAACGGCTGGCCTCGTGCTCCG
AGTGACGAGATGAGTTTCAACGATTGGTTGAAGAGACAATCATCTAGCTTTCCTTCGCCGGTTGCCAGTCTCGGT
GCCTTTTCACAGGATGACTTTTCTCCGCACCGAGAGAAGCGATACGGCGGAATCATGATCTCGCAGGAGATAACG
GTCGATGTTGAAAAGGTATGCTCAACCTCCAATACACGGGAGACGGACGATTATGCTCACAGCACACAGATGCCC
AATGTCCTCACGACCGAGCTCTCGCTAAATAGCCAAACGGGAGACAAATCCAACCCCGAAACGCCCTCGACTCTA
GACGAGACGCCAAGCTCGACGAGGACAAAGTACTTTTCCACCGCTTTTGGCGAGCATAGCGCCAGAGCGGCGCTC
GAGCAGGAGGGTTCCGGCTTTGTAAATAAGCTGCTTGTGCTATGCATGGACAATAAAGCCAATGGGTAG
Transcript >Ophun1|7481
ATGACGACGACTGCGGAGCTTCTCGATCGGTATTCGGGGCAGCTGGTGCCTTTATCGTTCCATGCTGGCTTTGTG
TGTCTGAGTTATGCCATCAGTCTTGTTGGGACGTGCTCTACGCTCGAGTTGTTGCGGAGACGGACTTCTCATTGG
GGTCTTTCGAACTTAGTGCTTTTGGTGGGCGCGGCCATCTCCATGGGAGGAATCGCCATCTGGTCTATGCACTTT
ATCGGCAACAGAGCCATCTACATCCTCGATGGCAGAGAAGACATCCAAATCGCCTACTCAACCGGCATGACCATC
CTCTCCCTCATCGTCCCCATTGTCGTCCTCGTCATCGCCTTCCTCGCCACCAGCGTGAATGGCCGTATCCGCTGG
TACTCCATCTCCATCGCCGGCTTCTTCTCTGGCGGCGCCATCAGCGGGATGCACTACCTCGCCGACGCCTCCATC
AGCAATTACCAAGCCGAGTATAAGATGGGTTACGTAGCCGGCGCAACCGTCATCTCCGTCGTCGCCAGCACCGCC
GCGTTAGCCCTCTTCTTCGTCTTCGAGACGGCGTGGAAGGTCTCATGGTGGAAGAGACTGGGTTGTGCCATGGTG
TTGGCCGGTGCCGTCTCGGGAATGCACTGGTGCGCAGCCGTTGGCACTGGCTACAGGCTCCTTCGGCCGCGGAAC
CTAGATAGGGGCATGTCTCGGCAAGAGACGCTCATCATGGTCATCTGCTTGTCGATAGCCGCCGGTGTGACCATA
ACGGTCAGCTCCATCTACTCCGGGTGGATCAGACGAGACTACGCCAGCAAGTCGCAGCAGGTCGTCTTGGCGGCA
GCCGTATTCGACGACAAGGGGAGGATCATGGTGAACCAGGAGGGCTTCCTCCCGACCGAGGTCGTCACCGACACC
TTTATACCAAAGACGCACAATGAAGTCTTTGACACCAGCCACCCTCTCTTCCAGTGGATGTATCGGGCATCCCGT
AACTGGAACAGCATCGCCCCCCTTACCGACAAGATGGAAAGCCACATCAGCCAGCTGTCTCAAGACAAATACAAC
CATAGAATCGGCCTTAAGCTGATTGCCGAGGACGGCCTTCTCGTTCCCTACTACGACCAGATGATCTGCGAGCTC
TTTAGCCTAGCCGCCCTCGCCCTCGCCCGCAAGACCAAGGAGGACATCTGTCACATGGGAACGCTCTGGGACGAG
ATCTTCGTTACGGGCAACTTTCCCTGTTCCTCGACCCCTCCCAGCCCGACACTCACCTCGAAGCAAAGGGACAAG
TCGCTTCTCGGAGATCTAGCCGAACGAGGTCTCGTGCCACCTCCGCAGTACGGACGCGGATGTCTGATGTTTCTT
GTCCGCCACGTTCACGCAAGAAGGGACATTGATAAACTCGAGGCGGCAGGCTATCGCTTCGCAGAGATGCACCAC
GTCATCACCACCATCTCCTCCAGCATGCAGATCAAGAACCACGACTTTGCCGACCGGTTCCGGGTCATGTCCGAA
GCTACTCATCACGGCAACCCCTTGGCTGCAGGCGTTCATCTCGGCATCTTCGCCGTCCGCGCCAGAATTGACCGC
TGTGGCTTCGACGTGCTCGTCCGCAGAGAGGCGAGGAACCTCGTCCCCTCCGTTCGTCTCCCGCTTCGCCGCCTT
GAGCCGTGGCATCACGAGCTCCTTTCTCGGCTTCAGGGTCAGACACCCTCAGCCATCATCAGATCGCTATATAGC
TTCGGCAAACAGGGATCTCGGGAAGCCTATTTCGCTTCTGTTATGAGGCATGCTATTCGAGGGCTTCGCGACCTT
ATGGGTGACGAGGAGTCTTTCGGCACCGTGACTCTCATGTCTCAAGTCGTGCAGGTTCCCTGCTTTTCCGACGAC
ACTCTACGGCTTTCTACGTGCTCGTTCATCTCGTTCCGCATTGTGCTGCCAATCCACGCAACAGCTCCGTCTCTC
ACCTGCGAGTTCGTCCCATTGAGCTTCTTCCAAACCCAGCAAATGGTGTACAATGGCTCAGCGCATCACGTCGAG
TTCTCCCACAAGGTCCACCGCGAGCTCTCCTCCTTTCTTCACGTCGCGCCCAAACAAGCGTGCAACAAGGGCCAG
AGAAGGCCGTTTCCGCGCCGTGCAATGGCATGGATCCGGAGATCACGGTCCTCGCGCTACGTCGATGACGACGTC
GTCTTGCAATCTTCCATCAAGAGTCACAAGCGGTTATCGGCAGTGGCTGTTAGCAACGGCTGGCCTCGTGCTCCG
AGTGACGAGATGAGTTTCAACGATTGGTTGAAGAGACAATCATCTAGCTTTCCTTCGCCGGTTGCCAGTCTCGGT
GCCTTTTCACAGGATGACTTTTCTCCGCACCGAGAGAAGCGATACGGCGGAATCATGATCTCGCAGGAGATAACG
GTCGATGTTGAAAAGGTATGCTCAACCTCCAATACACGGGAGACGGACGATTATGCTCACAGCACACAGATGCCC
AATGTCCTCACGACCGAGCTCTCGCTAAATAGCCAAACGGGAGACAAATCCAACCCCGAAACGCCCTCGACTCTA
GACGAGACGCCAAGCTCGACGAGGACAAAGTACTTTTCCACCGCTTTTGGCGAGCATAGCGCCAGAGCGGCGCTC
GAGCAGGAGGGTTCCGGCTTTGTAAATAAGCTGCTTGTGCTATGCATGGACAATAAAGCCAATGGGTAG
Gene >Ophun1|7481
ATGACGACGACTGCGGAGCTTCTCGATCGGTATTCGGGGCAGCTGGTGCCTTTATCGTTCCATGCTGGCTTTGTG
TGTCTGAGTTATGCCATCAGTCTTGTTGGGACGTGCTCTACGCTCGAGTTGTTGCGGAGACGGACTTCTCATTGG
GGTCTTTCGAACTTGTGCGTTTTGGATGAGATGATGATTCGATGATGTCTGGCTGATGGATTCGGTAGAGTGCTT
TTGGTGGGCGCGGCCATCTCCATGGGAGGAATCGCCATCTGGTCTATGGTAGGTGTGAATCTGTTTCTACCTGTT
GTTGTTCGATGTTGTTGTCTACTATCATCTCAAGCCCTGCAACCTCCTGATGACGTTAAACACACCTGTTCAACT
GAATCCATCGCTAAAACCACCCAGCACTTTATCGGCAACAGAGCCATCTACATCCTCGATGGCAGAGAAGACATC
CAAATCGCCTACTCAACCGGCATGACCATCCTCTCCCTCATCGTCCCCATTGTCGTCCTCGTCATCGCCTTCCTC
GCCACCAGCGTGAATGGCCGTATCCGCTGGTACTCCATCTCCATCGCCGGCTTCTTCTCTGGCGGCGCCATCAGC
GGGATGCACTACCTCGCCGACGCCTCCATCAGCAATTACCAAGCCGAGTATAAGATGGGTTACGTAGCCGGCGCA
ACCGTCATCTCCGTCGTCGCCAGCACCGCCGCGTTAGCCCTCTTCTTCGTCTTCGAGACGGCGTGGAAGGTCTCA
TGGTGGAAGAGACTGGGTTGTGCCATGGTGTTGGCCGGTGCCGTCTCGGGAATGCACTGGTGCGCAGCCGTTGGC
ACTGGCTACAGGCTCCTTCGGCCGCGGAACCTAGATAGGGGCATGTCTCGGCAAGAGACGCTCATCATGGTCATC
TGCTTGGTAAGAAACGGCTACGTCCACCGCCAACGTCACCGGCATCTAACGAGGTTGCAGTCGATAGCCGCCGGT
GTGACCATAACGGTCAGCTCCATCTACTCCGGGTGGATCAGACGAGACTACGCCAGCAAGTCGCAGCAGGTCGTC
TTGGCGGCAGCCGTATTCGACGACAAGGGGAGGATCATGGTGAACCAGGAGGGCTTCCTCCCGACCGAGGTCGTC
ACCGACACCTTTATACCAAAGGTCAGACAACCATTGAAAGCATCAACGACCAAGTACATGCTCACCTTGACTAAA
CTCCCTCTCAGACGCACAATGAAGTCTTTGACACCAGCCACCCTCTCTTCCAGTGGATGTATCGGGCATCCCGTA
ACTGGAACAGCATCGCCCCCCTTACCGACAAGATGGAAAGCCACATCAGCCAGCTGTCTCAAGACAAATACAACC
ATAGAATCGGCCTTAAGCTGATTGCCGAGGACGGCCTTCTCGTTCCCTACTACGACCAGATGATCTGCGAGCTCT
TTAGCCTAGCCGCCCTCGCCCTCGCCCGCAAGACCAAGGAGGACATCTGTCACATGGGAACGCTCTGGGACGAGA
TCTTCGTTACGGGCAACTTTCCCTGTTCCTCGACCCCTCCCAGCCCGACACTCACCTCGAAGCAAAGGGACAAGT
CGCTTCTCGGAGATCTAGCCGAACGAGGTCTCGTGCCACCTCCGCAGTACGGACGCGGATGTCTGATGTTTCTTG
TCCGCCACGTTCACGCAAGAAGGGACATTGATAAACTCGAGGCGGCAGGCTATCGCTTCGCAGAGATGCACCACG
TCATCACCACCATCTCCTCCAGCATGCAGATCAAGAACCACGACTTTGCCGACCGGTTCCGGGTCATGTCCGAAG
CTACTCATCACGGCAACCCCTTGGCTGCAGGCGTTCATCTCGGCATCTTCGCCGTCCGCGCCAGAATTGACCGCT
GTGGCTTCGACGTGCTCGTCCGCAGAGAGGCGAGGAACCTCGTCCCCTCCGTTCGTCTCCCGCTTCGCCGCCTTG
AGCCGTGGCATCACGAGCTCCTTTCTCGGCTTCAGGGTCAGACACCCTCAGCCATCATCAGATCGCTATATAGCT
TCGGCAAACAGGGATCTCGGGAAGCCTATTTCGCTTCTGTTATGAGGCATGCTATTCGAGGGCTTCGCGACCTTA
TGGGTGACGAGGAGTCTTTCGGCACCGTGACTCTCATGTCTCAAGTCGTGCAGGTTCCCTGCTTTTCCGACGACA
CTCTACGGCTTTCTACGTGCTCGTTCATCTCGTTCCGCATTGTGCTGCCAATCCACGCAACAGCTCCGTCTCTCA
CCTGCGAGTTCGTCCCATTGAGCTTCTTCCAAACCCAGCAAATGGTGTACAATGGCTCAGCGCATCACGTCGAGT
TCTCCCACAAGGTCCACCGCGAGCTCTCCTCCTTTCTTCACGTCGCGCCCAAACAAGCGTGCAACAAGGGCCAGA
GAAGGCCGTTTCCGCGCCGTGCAATGGCATGGATCCGGAGATCACGGTCCTCGCGCTACGTCGATGACGACGTCG
TCTTGCAATCTTCCATCAAGAGTCACAAGCGGTTATCGGCAGTGGCTGTTAGCAACGGCTGGCCTCGTGCTCCGA
GTGACGAGATGAGTTTCAACGATTGGTTGAAGAGACAATCATCTAGCTTTCCTTCGCCGGTTGCCAGTCTCGGTG
CCTTTTCACAGGATGACTTTTCTCCGCACCGAGAGAAGCGATACGGCGGAATCATGATCTCGCAGGAGATAACGG
TCGATGTTGAAAAGGTATGCTCAACCTCCAATACACGGGAGACGGACGATTATGCTCACAGCACACAGATGCCCA
ATGTCCTCACGACCGAGCTCTCGCTAAATAGCCAAACGGGAGACAAATCCAACCCCGAAACGCCCTCGACTCTAG
ACGAGACGCCAAGCTCGACGAGGACAAAGTACTTTTCCACCGCTTTTGGCGAGCATAGCGCCAGAGCGGCGCTCG
AGCAGGAGGGTTCCGGCTTTGTAAATAAGCTGCTTGTGCTATGCATGGACAATAAAGCCAATGGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail