Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|748
Gene name
LocationContig_125:25106..27398
Strand-
Gene length (bp)2292
Transcript length (bp)2292
Coding sequence length (bp)2292
Protein length (aa) 764

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13915 DUF4210 Domain of unknown function (DUF4210) 1.1E-33 329 403
PF13889 Chromosome_seg Chromosome segregation during meiosis 1.8E-22 539 591

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10140|YAS4_SCHPO Uncharacterized protein C3H8.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H8.04 PE=4 SV=1 324 585 1.0E-23
sp|Q69ZK7|F214A_MOUSE Protein FAM214A OS=Mus musculus GN=Fam214a PE=2 SV=3 314 590 8.0E-21
sp|Q5ZI58|F214A_CHICK Protein FAM214A OS=Gallus gallus GN=FAM214A PE=2 SV=2 314 590 5.0E-20
sp|Q32MH5|F214A_HUMAN Protein FAM214A OS=Homo sapiens GN=FAM214A PE=1 SV=2 313 590 1.0E-19
sp|Q5FW46|F214A_XENTR Protein FAM214A OS=Xenopus tropicalis GN=fam214a PE=2 SV=1 328 569 6.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10140|YAS4_SCHPO Uncharacterized protein C3H8.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H8.04 PE=4 SV=1 324 585 1.0E-23
sp|Q69ZK7|F214A_MOUSE Protein FAM214A OS=Mus musculus GN=Fam214a PE=2 SV=3 314 590 8.0E-21
sp|Q5ZI58|F214A_CHICK Protein FAM214A OS=Gallus gallus GN=FAM214A PE=2 SV=2 314 590 5.0E-20
sp|Q32MH5|F214A_HUMAN Protein FAM214A OS=Homo sapiens GN=FAM214A PE=1 SV=2 313 590 1.0E-19
sp|Q5FW46|F214A_XENTR Protein FAM214A OS=Xenopus tropicalis GN=fam214a PE=2 SV=1 328 569 6.0E-19
sp|Q1LV22|F214A_DANRE Protein FAM214A OS=Danio rerio GN=fam214a PE=2 SV=2 317 590 8.0E-19
sp|Q4R676|F214B_MACFA Protein FAM214B OS=Macaca fascicularis GN=FAM214B PE=2 SV=1 475 569 4.0E-11
sp|Q7L5A3|F214B_HUMAN Protein FAM214B OS=Homo sapiens GN=FAM214B PE=1 SV=1 475 569 4.0E-11
sp|Q5RBA3|F214B_PONAB Protein FAM214B OS=Pongo abelii GN=FAM214B PE=2 SV=1 475 569 5.0E-11
sp|Q5BIM2|F214B_BOVIN Protein FAM214B OS=Bos taurus GN=FAM214B PE=2 SV=1 475 569 2.0E-10
sp|Q8BR27|F214B_MOUSE Protein FAM214B OS=Mus musculus GN=Fam214b PE=1 SV=1 475 569 3.0E-10
sp|Q5PQM8|F214B_RAT Protein FAM214B OS=Rattus norvegicus GN=Fam214b PE=2 SV=1 475 569 4.0E-10
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5893
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7240
Ophiocordyceps australis map64 (Brazil) OphauB2|4659
Ophiocordyceps camponoti-floridani Ophcf2|02852
Ophiocordyceps camponoti-rufipedis Ophun1|748 (this protein)
Ophiocordyceps kimflemingae Ophio5|4070

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|748
MPIFQADLDSGGRRRQPPAIDIGPVSPRLRLSDAHRRPDVDGTATSDRGELIQRLKRGESPTWIPNRLARACKPV
PRLRNDDDDEDEDDEDDDDDDEEPPLDSILPNTDVDDGSSAPAQPGLRSPAQMTHDGAGIEHPRPALHTGDFTHN
VVHDDTPRRIVGRVERKSTHGSWIATSPPRDFAPFRHEHRRQLTDSAACFVSGPSPLSSSLSSSFAYQPPTSPLV
QSESNDDLDFSMPMSLSQRDSADMGLAASPFSSAAAASAWRQAERRRDSLPCQAHQPRRCLTTIPTTPTPGFPHN
GSSPQTPAMLRSRRPSIGSDLSPIQHASMVGSYEESILRGRMSTTPSKPFDFLAQIGVLGKGKCRSSLRCPSHVT
LPFPAVYYSYGGTTNGLPRDDDGPSPYVGQIDLENGLPNVNDESRSRRKLRTRYLDRGSAARTDGDPDTDTAPAL
SDSRRSRYTKRRRSASPRAPPGGSYRIPEKGQVQMVIKNQNKTAVKLFLVPYDLTGMEAGTKTFIRQRSYSAGPI
VSHEARPNDDKRPMLRYLVHLHICCPSRGRFYLYKSIRVVFANRCPDGKEKLRNDTTWPEPRFSPYKPIRLMHPP
AASLSAGPAALLAADKALRRRSLGIAFGPSSLSSPSARLSSPAGNTLPVDPVAYNLMPPFRLHSDSDIPVVTCSS
LDSSSRPSSSSTTVTTTDTTTNPNPNDGPPTIAPPIPPPPPWGSTHYEKLSRGDAGYGGCGPESPPQGATEGLLS
QRLRCFNIRNRRE*
Coding >Ophun1|748
ATGCCCATCTTCCAGGCTGATCTCGACTCTGGCGGTCGTCGTCGCCAGCCGCCGGCCATCGATATCGGGCCCGTC
TCTCCTCGCTTGCGCCTCTCGGACGCACACAGACGGCCTGACGTCGACGGCACGGCTACTTCGGACCGGGGCGAG
TTGATTCAGCGTCTCAAGCGAGGCGAGAGTCCGACTTGGATCCCGAATCGACTGGCAAGAGCCTGCAAGCCCGTG
CCTCGACTCCGGAACGATGACGACGACGAAGACGAAGACGACGAAGATGATGATGATGACGACGAGGAGCCGCCG
CTCGACTCCATCCTCCCCAACACCGACGTCGACGACGGTTCCTCTGCTCCCGCTCAGCCCGGCCTCCGTTCGCCT
GCTCAGATGACCCACGACGGAGCCGGCATCGAGCATCCTCGACCCGCCCTCCACACCGGCGACTTCACCCACAAC
GTCGTCCATGACGATACGCCGCGCAGGATCGTCGGCCGTGTCGAGAGAAAGTCGACACACGGCTCGTGGATCGCC
ACCTCGCCCCCCCGCGACTTCGCCCCTTTCCGCCACGAGCATCGGAGACAACTGACGGACAGCGCGGCGTGCTTC
GTCTCGGGCCCGTCTCCCCTGTCGTCGTCCCTATCCTCGAGTTTCGCCTACCAACCGCCGACGAGCCCGCTGGTG
CAGTCGGAGAGCAACGACGATCTCGACTTCTCCATGCCCATGTCGTTGAGCCAGCGGGATTCGGCCGACATGGGA
CTCGCCGCCTCGCCCTTTTCTTCGGCCGCCGCAGCTTCGGCCTGGCGCCAGGCTGAGCGGCGCAGGGACTCGCTG
CCGTGTCAAGCGCATCAGCCGCGGAGGTGCCTGACGACGATTCCGACGACGCCGACGCCCGGCTTCCCGCACAAC
GGCTCGTCGCCGCAGACACCAGCCATGCTCCGCTCCAGGCGGCCGTCGATCGGATCAGACCTGTCGCCCATCCAG
CACGCGTCCATGGTCGGATCGTACGAGGAGAGCATCCTCCGCGGCCGAATGTCGACGACGCCGTCCAAGCCCTTT
GACTTCCTGGCCCAGATTGGCGTCTTGGGCAAAGGCAAATGCAGATCCAGCCTCCGGTGCCCTTCACATGTCACG
CTACCCTTTCCCGCCGTCTACTACAGCTACGGCGGCACAACCAACGGCCTGCCACGCGATGACGACGGCCCGAGC
CCCTACGTCGGCCAGATCGACCTGGAGAACGGGCTGCCCAACGTCAACGACGAGTCGCGTTCGCGGAGGAAGCTC
AGGACACGCTATCTCGACAGAGGCTCAGCTGCCAGGACAGACGGCGATCCCGACACGGACACGGCACCGGCCCTC
TCGGACTCCCGACGATCCCGCTACACCAAACGCCGTCGATCTGCGTCTCCCCGGGCACCCCCCGGCGGCAGCTAC
AGGATCCCGGAAAAGGGCCAGGTGCAAATGGTGATTAAGAATCAGAACAAGACGGCCGTCAAGCTCTTCCTCGTC
CCATACGACCTGACGGGCATGGAAGCCGGCACCAAGACCTTTATCCGCCAGCGCAGCTACTCAGCCGGACCCATC
GTCTCCCACGAAGCGCGACCAAACGACGACAAGAGACCAATGCTACGATATCTCGTCCATCTGCACATCTGCTGT
CCCTCGCGCGGCCGCTTCTACCTCTACAAGAGCATCCGCGTCGTCTTCGCCAACCGCTGTCCAGATGGAAAGGAG
AAGCTACGCAACGATACGACCTGGCCCGAGCCTCGCTTCTCGCCCTATAAACCCATCCGACTCATGCACCCGCCC
GCAGCCTCGCTCTCTGCCGGACCAGCCGCTCTGCTGGCAGCGGACAAGGCCCTCCGTCGTCGCAGCCTCGGCATC
GCCTTCGGTCCCTCGTCTCTATCATCGCCTTCTGCGCGCCTCTCGTCACCCGCGGGAAACACCCTTCCCGTCGAT
CCCGTCGCCTACAACCTGATGCCGCCATTCCGCCTCCACAGCGACAGCGACATCCCCGTCGTCACATGCTCCTCC
CTCGACTCCTCCAGCCGTCCCTCATCCTCGTCAACAACAGTGACGACAACAGACACCACCACCAACCCCAACCCC
AACGACGGCCCCCCAACCATCGCACCCCCCATCCCGCCCCCTCCGCCATGGGGCTCAACCCACTACGAGAAGCTC
AGCCGCGGCGACGCAGGATACGGCGGCTGCGGACCGGAGTCCCCTCCGCAGGGCGCGACGGAGGGCCTCCTCTCG
CAACGACTGCGCTGCTTCAACATCCGGAACAGGCGCGAGTGA
Transcript >Ophun1|748
ATGCCCATCTTCCAGGCTGATCTCGACTCTGGCGGTCGTCGTCGCCAGCCGCCGGCCATCGATATCGGGCCCGTC
TCTCCTCGCTTGCGCCTCTCGGACGCACACAGACGGCCTGACGTCGACGGCACGGCTACTTCGGACCGGGGCGAG
TTGATTCAGCGTCTCAAGCGAGGCGAGAGTCCGACTTGGATCCCGAATCGACTGGCAAGAGCCTGCAAGCCCGTG
CCTCGACTCCGGAACGATGACGACGACGAAGACGAAGACGACGAAGATGATGATGATGACGACGAGGAGCCGCCG
CTCGACTCCATCCTCCCCAACACCGACGTCGACGACGGTTCCTCTGCTCCCGCTCAGCCCGGCCTCCGTTCGCCT
GCTCAGATGACCCACGACGGAGCCGGCATCGAGCATCCTCGACCCGCCCTCCACACCGGCGACTTCACCCACAAC
GTCGTCCATGACGATACGCCGCGCAGGATCGTCGGCCGTGTCGAGAGAAAGTCGACACACGGCTCGTGGATCGCC
ACCTCGCCCCCCCGCGACTTCGCCCCTTTCCGCCACGAGCATCGGAGACAACTGACGGACAGCGCGGCGTGCTTC
GTCTCGGGCCCGTCTCCCCTGTCGTCGTCCCTATCCTCGAGTTTCGCCTACCAACCGCCGACGAGCCCGCTGGTG
CAGTCGGAGAGCAACGACGATCTCGACTTCTCCATGCCCATGTCGTTGAGCCAGCGGGATTCGGCCGACATGGGA
CTCGCCGCCTCGCCCTTTTCTTCGGCCGCCGCAGCTTCGGCCTGGCGCCAGGCTGAGCGGCGCAGGGACTCGCTG
CCGTGTCAAGCGCATCAGCCGCGGAGGTGCCTGACGACGATTCCGACGACGCCGACGCCCGGCTTCCCGCACAAC
GGCTCGTCGCCGCAGACACCAGCCATGCTCCGCTCCAGGCGGCCGTCGATCGGATCAGACCTGTCGCCCATCCAG
CACGCGTCCATGGTCGGATCGTACGAGGAGAGCATCCTCCGCGGCCGAATGTCGACGACGCCGTCCAAGCCCTTT
GACTTCCTGGCCCAGATTGGCGTCTTGGGCAAAGGCAAATGCAGATCCAGCCTCCGGTGCCCTTCACATGTCACG
CTACCCTTTCCCGCCGTCTACTACAGCTACGGCGGCACAACCAACGGCCTGCCACGCGATGACGACGGCCCGAGC
CCCTACGTCGGCCAGATCGACCTGGAGAACGGGCTGCCCAACGTCAACGACGAGTCGCGTTCGCGGAGGAAGCTC
AGGACACGCTATCTCGACAGAGGCTCAGCTGCCAGGACAGACGGCGATCCCGACACGGACACGGCACCGGCCCTC
TCGGACTCCCGACGATCCCGCTACACCAAACGCCGTCGATCTGCGTCTCCCCGGGCACCCCCCGGCGGCAGCTAC
AGGATCCCGGAAAAGGGCCAGGTGCAAATGGTGATTAAGAATCAGAACAAGACGGCCGTCAAGCTCTTCCTCGTC
CCATACGACCTGACGGGCATGGAAGCCGGCACCAAGACCTTTATCCGCCAGCGCAGCTACTCAGCCGGACCCATC
GTCTCCCACGAAGCGCGACCAAACGACGACAAGAGACCAATGCTACGATATCTCGTCCATCTGCACATCTGCTGT
CCCTCGCGCGGCCGCTTCTACCTCTACAAGAGCATCCGCGTCGTCTTCGCCAACCGCTGTCCAGATGGAAAGGAG
AAGCTACGCAACGATACGACCTGGCCCGAGCCTCGCTTCTCGCCCTATAAACCCATCCGACTCATGCACCCGCCC
GCAGCCTCGCTCTCTGCCGGACCAGCCGCTCTGCTGGCAGCGGACAAGGCCCTCCGTCGTCGCAGCCTCGGCATC
GCCTTCGGTCCCTCGTCTCTATCATCGCCTTCTGCGCGCCTCTCGTCACCCGCGGGAAACACCCTTCCCGTCGAT
CCCGTCGCCTACAACCTGATGCCGCCATTCCGCCTCCACAGCGACAGCGACATCCCCGTCGTCACATGCTCCTCC
CTCGACTCCTCCAGCCGTCCCTCATCCTCGTCAACAACAGTGACGACAACAGACACCACCACCAACCCCAACCCC
AACGACGGCCCCCCAACCATCGCACCCCCCATCCCGCCCCCTCCGCCATGGGGCTCAACCCACTACGAGAAGCTC
AGCCGCGGCGACGCAGGATACGGCGGCTGCGGACCGGAGTCCCCTCCGCAGGGCGCGACGGAGGGCCTCCTCTCG
CAACGACTGCGCTGCTTCAACATCCGGAACAGGCGCGAGTGA
Gene >Ophun1|748
ATGCCCATCTTCCAGGCTGATCTCGACTCTGGCGGTCGTCGTCGCCAGCCGCCGGCCATCGATATCGGGCCCGTC
TCTCCTCGCTTGCGCCTCTCGGACGCACACAGACGGCCTGACGTCGACGGCACGGCTACTTCGGACCGGGGCGAG
TTGATTCAGCGTCTCAAGCGAGGCGAGAGTCCGACTTGGATCCCGAATCGACTGGCAAGAGCCTGCAAGCCCGTG
CCTCGACTCCGGAACGATGACGACGACGAAGACGAAGACGACGAAGATGATGATGATGACGACGAGGAGCCGCCG
CTCGACTCCATCCTCCCCAACACCGACGTCGACGACGGTTCCTCTGCTCCCGCTCAGCCCGGCCTCCGTTCGCCT
GCTCAGATGACCCACGACGGAGCCGGCATCGAGCATCCTCGACCCGCCCTCCACACCGGCGACTTCACCCACAAC
GTCGTCCATGACGATACGCCGCGCAGGATCGTCGGCCGTGTCGAGAGAAAGTCGACACACGGCTCGTGGATCGCC
ACCTCGCCCCCCCGCGACTTCGCCCCTTTCCGCCACGAGCATCGGAGACAACTGACGGACAGCGCGGCGTGCTTC
GTCTCGGGCCCGTCTCCCCTGTCGTCGTCCCTATCCTCGAGTTTCGCCTACCAACCGCCGACGAGCCCGCTGGTG
CAGTCGGAGAGCAACGACGATCTCGACTTCTCCATGCCCATGTCGTTGAGCCAGCGGGATTCGGCCGACATGGGA
CTCGCCGCCTCGCCCTTTTCTTCGGCCGCCGCAGCTTCGGCCTGGCGCCAGGCTGAGCGGCGCAGGGACTCGCTG
CCGTGTCAAGCGCATCAGCCGCGGAGGTGCCTGACGACGATTCCGACGACGCCGACGCCCGGCTTCCCGCACAAC
GGCTCGTCGCCGCAGACACCAGCCATGCTCCGCTCCAGGCGGCCGTCGATCGGATCAGACCTGTCGCCCATCCAG
CACGCGTCCATGGTCGGATCGTACGAGGAGAGCATCCTCCGCGGCCGAATGTCGACGACGCCGTCCAAGCCCTTT
GACTTCCTGGCCCAGATTGGCGTCTTGGGCAAAGGCAAATGCAGATCCAGCCTCCGGTGCCCTTCACATGTCACG
CTACCCTTTCCCGCCGTCTACTACAGCTACGGCGGCACAACCAACGGCCTGCCACGCGATGACGACGGCCCGAGC
CCCTACGTCGGCCAGATCGACCTGGAGAACGGGCTGCCCAACGTCAACGACGAGTCGCGTTCGCGGAGGAAGCTC
AGGACACGCTATCTCGACAGAGGCTCAGCTGCCAGGACAGACGGCGATCCCGACACGGACACGGCACCGGCCCTC
TCGGACTCCCGACGATCCCGCTACACCAAACGCCGTCGATCTGCGTCTCCCCGGGCACCCCCCGGCGGCAGCTAC
AGGATCCCGGAAAAGGGCCAGGTGCAAATGGTGATTAAGAATCAGAACAAGACGGCCGTCAAGCTCTTCCTCGTC
CCATACGACCTGACGGGCATGGAAGCCGGCACCAAGACCTTTATCCGCCAGCGCAGCTACTCAGCCGGACCCATC
GTCTCCCACGAAGCGCGACCAAACGACGACAAGAGACCAATGCTACGATATCTCGTCCATCTGCACATCTGCTGT
CCCTCGCGCGGCCGCTTCTACCTCTACAAGAGCATCCGCGTCGTCTTCGCCAACCGCTGTCCAGATGGAAAGGAG
AAGCTACGCAACGATACGACCTGGCCCGAGCCTCGCTTCTCGCCCTATAAACCCATCCGACTCATGCACCCGCCC
GCAGCCTCGCTCTCTGCCGGACCAGCCGCTCTGCTGGCAGCGGACAAGGCCCTCCGTCGTCGCAGCCTCGGCATC
GCCTTCGGTCCCTCGTCTCTATCATCGCCTTCTGCGCGCCTCTCGTCACCCGCGGGAAACACCCTTCCCGTCGAT
CCCGTCGCCTACAACCTGATGCCGCCATTCCGCCTCCACAGCGACAGCGACATCCCCGTCGTCACATGCTCCTCC
CTCGACTCCTCCAGCCGTCCCTCATCCTCGTCAACAACAGTGACGACAACAGACACCACCACCAACCCCAACCCC
AACGACGGCCCCCCAACCATCGCACCCCCCATCCCGCCCCCTCCGCCATGGGGCTCAACCCACTACGAGAAGCTC
AGCCGCGGCGACGCAGGATACGGCGGCTGCGGACCGGAGTCCCCTCCGCAGGGCGCGACGGAGGGCCTCCTCTCG
CAACGACTGCGCTGCTTCAACATCCGGAACAGGCGCGAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail