Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7477
Gene name
LocationContig_95:4255..4585
Strand-
Gene length (bp)330
Transcript length (bp)330
Coding sequence length (bp)330
Protein length (aa) 110

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4ALG0|LYSM1_ARTBC LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05157 PE=1 SV=1 45 109 2.0E-19
sp|D4ALG0|LYSM1_ARTBC LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05157 PE=1 SV=1 30 109 2.0E-14
sp|D4ALG0|LYSM1_ARTBC LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05157 PE=1 SV=1 30 109 7.0E-13
sp|D4ALG0|LYSM1_ARTBC LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05157 PE=1 SV=1 42 109 2.0E-12
sp|D4AVW3|LYSM5_ARTBC LysM domain-containing protein ARB_00327 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_00327 PE=3 SV=2 50 109 1.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4ALG0|LYSM1_ARTBC LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05157 PE=1 SV=1 45 109 2.0E-19
sp|D4ALG0|LYSM1_ARTBC LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05157 PE=1 SV=1 30 109 2.0E-14
sp|D4ALG0|LYSM1_ARTBC LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05157 PE=1 SV=1 30 109 7.0E-13
sp|D4ALG0|LYSM1_ARTBC LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05157 PE=1 SV=1 42 109 2.0E-12
sp|D4AVW3|LYSM5_ARTBC LysM domain-containing protein ARB_00327 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_00327 PE=3 SV=2 50 109 1.0E-09
sp|D4B5F9|PGDA_ARTBC Probable peptidoglycan-N-acetylglucosamine deacetylase ARB_03699 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03699 PE=1 SV=2 59 109 2.0E-09
sp|D4B4Q2|LYSM4_ARTBC LysM domain-containing protein ARB_03442 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03442 PE=3 SV=2 36 107 2.0E-07
sp|D4AZ68|LYSM3_ARTBC LysM domain-containing protein ARB_01488 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01488 PE=3 SV=1 48 109 2.0E-06
sp|D4B4P8|LYSM2_ARTBC LysM domain-containing protein ARB_03438 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03438 PE=3 SV=1 48 109 3.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 19 0.999737

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup265
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2459
Ophiocordyceps australis map64 (Brazil) OphauB2|4462
Ophiocordyceps australis map64 (Brazil) OphauB2|7698
Ophiocordyceps camponoti-floridani Ophcf2|02949
Ophiocordyceps camponoti-rufipedis Ophun1|7477 (this protein)
Ophiocordyceps kimflemingae Ophio5|3948
Ophiocordyceps subramaniannii Hirsu2|1076
Ophiocordyceps subramaniannii Hirsu2|3841
Ophiocordyceps subramaniannii Hirsu2|6024
Ophiocordyceps subramaniannii Hirsu2|8728
Ophiocordyceps subramaniannii Hirsu2|9191

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7477
MLLKTLTLTLLSAIPLANAAASPVVDDAKLNHSPDKVLADPPQPVVTPRPIQSGMIKGCRAFHLVVKGETCLSIE
AMFGPSLEDLVKWNPAIREDCTNMWADTYLCIGV*
Coding >Ophun1|7477
ATGCTCCTCAAAACCCTCACCCTCACGCTCCTCAGCGCCATCCCCCTCGCCAACGCCGCCGCCTCCCCCGTCGTC
GACGACGCAAAGCTCAACCACTCCCCAGACAAGGTCCTCGCGGATCCTCCCCAGCCAGTGGTGACACCCCGGCCC
ATCCAGTCCGGCATGATCAAAGGCTGCCGCGCCTTCCACCTCGTCGTCAAGGGCGAGACTTGTCTGTCCATCGAG
GCCATGTTCGGCCCTTCGCTCGAGGACCTGGTGAAATGGAATCCGGCTATTCGGGAGGACTGCACTAATATGTGG
GCGGATACGTATCTGTGCATTGGTGTTTGA
Transcript >Ophun1|7477
ATGCTCCTCAAAACCCTCACCCTCACGCTCCTCAGCGCCATCCCCCTCGCCAACGCCGCCGCCTCCCCCGTCGTC
GACGACGCAAAGCTCAACCACTCCCCAGACAAGGTCCTCGCGGATCCTCCCCAGCCAGTGGTGACACCCCGGCCC
ATCCAGTCCGGCATGATCAAAGGCTGCCGCGCCTTCCACCTCGTCGTCAAGGGCGAGACTTGTCTGTCCATCGAG
GCCATGTTCGGCCCTTCGCTCGAGGACCTGGTGAAATGGAATCCGGCTATTCGGGAGGACTGCACTAATATGTGG
GCGGATACGTATCTGTGCATTGGTGTTTGA
Gene >Ophun1|7477
ATGCTCCTCAAAACCCTCACCCTCACGCTCCTCAGCGCCATCCCCCTCGCCAACGCCGCCGCCTCCCCCGTCGTC
GACGACGCAAAGCTCAACCACTCCCCAGACAAGGTCCTCGCGGATCCTCCCCAGCCAGTGGTGACACCCCGGCCC
ATCCAGTCCGGCATGATCAAAGGCTGCCGCGCCTTCCACCTCGTCGTCAAGGGCGAGACTTGTCTGTCCATCGAG
GCCATGTTCGGCCCTTCGCTCGAGGACCTGGTGAAATGGAATCCGGCTATTCGGGAGGACTGCACTAATATGTGG
GCGGATACGTATCTGTGCATTGGTGTTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail