Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7475
Gene name
LocationContig_949:2291..4380
Strand+
Gene length (bp)2089
Transcript length (bp)1962
Coding sequence length (bp)1962
Protein length (aa) 654

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00083 Sugar_tr Sugar (and other) transporter 2.3E-07 114 310
PF00083 Sugar_tr Sugar (and other) transporter 2.4E-16 363 550

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8GSD9|PHT12_ORYSJ Inorganic phosphate transporter 1-2 OS=Oryza sativa subsp. japonica GN=PTH1-2 PE=2 SV=1 100 548 3.0E-42
sp|Q01MW8|PHT14_ORYSI Probable inorganic phosphate transporter 1-4 OS=Oryza sativa subsp. indica GN=PHT1-4 PE=2 SV=2 100 545 2.0E-39
sp|Q8H074|PT112_ORYSJ Probable inorganic phosphate transporter 1-12 OS=Oryza sativa subsp. japonica GN=PHT1-12 PE=2 SV=1 100 547 2.0E-39
sp|Q8H6H2|PHT14_ORYSJ Probable inorganic phosphate transporter 1-4 OS=Oryza sativa subsp. japonica GN=PHT1-4 PE=2 SV=1 100 545 2.0E-39
sp|Q8H6H0|PHT16_ORYSJ Inorganic phosphate transporter 1-6 OS=Oryza sativa subsp. japonica GN=PHT1-6 PE=1 SV=1 100 547 3.0E-38
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8GSD9|PHT12_ORYSJ Inorganic phosphate transporter 1-2 OS=Oryza sativa subsp. japonica GN=PTH1-2 PE=2 SV=1 100 548 3.0E-42
sp|Q01MW8|PHT14_ORYSI Probable inorganic phosphate transporter 1-4 OS=Oryza sativa subsp. indica GN=PHT1-4 PE=2 SV=2 100 545 2.0E-39
sp|Q8H074|PT112_ORYSJ Probable inorganic phosphate transporter 1-12 OS=Oryza sativa subsp. japonica GN=PHT1-12 PE=2 SV=1 100 547 2.0E-39
sp|Q8H6H2|PHT14_ORYSJ Probable inorganic phosphate transporter 1-4 OS=Oryza sativa subsp. japonica GN=PHT1-4 PE=2 SV=1 100 545 2.0E-39
sp|Q8H6H0|PHT16_ORYSJ Inorganic phosphate transporter 1-6 OS=Oryza sativa subsp. japonica GN=PHT1-6 PE=1 SV=1 100 547 3.0E-38
sp|Q8GYF4|PHT15_ARATH Probable inorganic phosphate transporter 1-5 OS=Arabidopsis thaliana GN=PHT1-5 PE=2 SV=2 99 549 7.0E-38
sp|Q7XDZ7|PHT13_ORYSJ Probable inorganic phosphate transporter 1-3 OS=Oryza sativa subsp. japonica GN=PHT1-3 PE=2 SV=1 106 549 5.0E-37
sp|Q9ZWT3|PHT16_ARATH Probable inorganic phosphate transporter 1-6 OS=Arabidopsis thaliana GN=PHT1-6 PE=1 SV=1 100 545 6.0E-37
sp|Q7X7V2|PHT15_ORYSJ Probable inorganic phosphate transporter 1-5 OS=Oryza sativa subsp. japonica GN=PHT1-5 PE=2 SV=2 100 545 8.0E-37
sp|Q8VYM2|PHT11_ARATH Inorganic phosphate transporter 1-1 OS=Arabidopsis thaliana GN=PHT1-1 PE=1 SV=2 99 545 8.0E-37
sp|Q494P0|PHT17_ARATH Probable inorganic phosphate transporter 1-7 OS=Arabidopsis thaliana GN=PHT1-7 PE=2 SV=2 100 547 1.0E-36
sp|Q7XRH8|PT113_ORYSJ Putative inorganic phosphate transporter 1-13 OS=Oryza sativa subsp. japonica GN=PHT1-13 PE=3 SV=2 99 545 2.0E-36
sp|O48639|PHT13_ARATH Probable inorganic phosphate transporter 1-3 OS=Arabidopsis thaliana GN=PHT1-3 PE=2 SV=1 99 545 3.0E-36
sp|Q69T94|PT110_ORYSJ Probable inorganic phosphate transporter 1-10 OS=Oryza sativa subsp. japonica GN=PHT1-10 PE=2 SV=1 100 572 2.0E-35
sp|Q94DB8|PT111_ORYSJ Inorganic phosphate transporter 1-11 OS=Oryza sativa subsp. japonica GN=PHT1-11 PE=2 SV=1 99 545 2.0E-35
sp|Q96303|PHT14_ARATH Inorganic phosphate transporter 1-4 OS=Arabidopsis thaliana GN=PHT1-4 PE=1 SV=1 100 547 2.0E-35
sp|Q9SYQ1|PHT18_ARATH Probable inorganic phosphate transporter 1-8 OS=Arabidopsis thaliana GN=PHT1-8 PE=2 SV=2 100 547 3.0E-34
sp|Q8H6G9|PHT17_ORYSJ Probable inorganic phosphate transporter 1-7 OS=Oryza sativa subsp. japonica GN=PHT1-7 PE=2 SV=1 100 549 3.0E-34
sp|Q9S735|PHT19_ARATH Probable inorganic phosphate transporter 1-9 OS=Arabidopsis thaliana GN=PHT1-9 PE=2 SV=1 100 547 2.0E-33
sp|Q8H6G7|PHT19_ORYSJ Probable inorganic phosphate transporter 1-9 OS=Oryza sativa subsp. japonica GN=PHT1-9 PE=2 SV=2 100 547 1.0E-31
sp|Q8H6G8|PHT18_ORYSJ Probable inorganic phosphate transporter 1-8 OS=Oryza sativa subsp. japonica GN=PHT1-8 PE=2 SV=1 100 560 3.0E-31
sp|Q96243|PHT12_ARATH Probable inorganic phosphate transporter 1-2 OS=Arabidopsis thaliana GN=PHT1-2 PE=2 SV=2 99 490 7.0E-30
sp|Q8H6H4|PHT11_ORYSJ Inorganic phosphate transporter 1-1 OS=Oryza sativa subsp. japonica GN=PHT1-1 PE=2 SV=1 100 490 2.0E-29
sp|P25297|PHO84_YEAST Inorganic phosphate transporter PHO84 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO84 PE=1 SV=2 102 592 1.0E-27
sp|Q09852|YAEC_SCHPO Putative inorganic phosphate transporter C23D3.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC23D3.12 PE=1 SV=1 323 563 2.0E-27
sp|O42885|YBN1_SCHPO Putative inorganic phosphate transporter C8E4.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC8E4.01c PE=1 SV=2 317 548 5.0E-25
sp|Q9P6J9|YHD1_SCHPO Putative inorganic phosphate transporter C1683.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.01 PE=3 SV=1 320 548 6.0E-25
sp|Q7RVX9|PHO5_NEUCR Repressible high-affinity phosphate permease OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pho-5 PE=1 SV=2 96 514 2.0E-24
sp|P25346|GIT1_YEAST Probable metabolite transport protein GIT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIT1 PE=1 SV=1 74 553 1.0E-18
sp|Q9Y7Q9|YCX2_SCHPO Probable metabolite transporter C2H8.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC2H8.02 PE=1 SV=1 353 557 2.0E-18
sp|O94342|YHM9_SCHPO Probable metabolite transport protein C1271.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.09 PE=3 SV=1 104 550 2.0E-18
sp|Q9P6J9|YHD1_SCHPO Putative inorganic phosphate transporter C1683.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.01 PE=3 SV=1 103 338 1.0E-08
sp|O42885|YBN1_SCHPO Putative inorganic phosphate transporter C8E4.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC8E4.01c PE=1 SV=2 81 342 3.0E-08
sp|Q09852|YAEC_SCHPO Putative inorganic phosphate transporter C23D3.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC23D3.12 PE=1 SV=1 109 280 5.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0006810 transport No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.45

Transmembrane Domains

Domain # Start End Length
1 147 169 22
2 184 206 22
3 256 278 22
4 293 313 20
5 349 368 19
6 391 413 22
7 425 442 17
8 489 511 22
9 518 535 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7475
MAPKEASSPDTEHHVIPGQVPGPPTDSDSDDCGLSPDERRIFSHVTRPDDCYTPEGIYWADLPWADRFAFVSRVD
LDADIQELRSFASMAKKNPFSPLLWYVRNAVIPGAGLGLEGYVLFSIGNLEPLFRQVWPQCWEKHQVCGQNWVAS
VTYLEIIGIMVGQAAVGVIGDWIGRRWGLIQDALIMFVGLLMLTASWGFTLEGWVICYAWSLFFYSLGVGGEYPI
TATASLEGANNAGKLSTREDRLHRGRRVTMAFLMQGWGQFVNQVLLMVLLVIFNKGSGSPPYSSSAAQYTFRLSF
AFPAIGTAWLVYYRTWKMPHASKQLADAKSRSNVTGYDVHALRYCVNHFGGRLLATAGTWFCNDVFFYGNKLFQG
HFIKVISDNPDSLMTSWYWSLVNITISLAGYYSASLLIDNKLYGRRMMQQVGFFMCFLMFVIPAVQYDKYTKPEH
IHAFQAMYFISSFFNQFGPNSVTFLVAGEVFPTPIRATAHGFSACLGKAGALLASVLYNYIDTRTKFYFVTWFGL
VGMLLTWLFLPDTTGLDLKEQERRWNYIRQGRAEDYHGVAVNPAHLSLWERIRGIGNTYDPELDWKAKIDDMRAE
WEAVQKARDPRESEDQDGHGMPDDGEFSQEIHDYFKRSATTSNTVVGEKTSSQ*
Coding >Ophun1|7475
ATGGCGCCTAAGGAAGCGTCCTCGCCCGACACGGAGCACCACGTTATTCCCGGCCAAGTTCCAGGTCCCCCCACC
GATTCGGACAGCGACGACTGTGGATTGAGCCCTGACGAGCGCCGCATCTTCAGTCACGTCACCCGTCCCGACGAC
TGCTACACCCCAGAGGGCATCTACTGGGCCGACCTGCCATGGGCCGACCGTTTCGCCTTTGTCTCACGCGTCGAC
CTCGATGCCGACATTCAAGAACTGCGCTCGTTCGCTTCCATGGCCAAGAAGAACCCCTTTTCGCCCTTGCTGTGG
TACGTTCGCAATGCTGTCATACCAGGCGCCGGCCTCGGTCTCGAGGGCTACGTCCTCTTCTCCATCGGCAACCTG
GAGCCTCTCTTTCGTCAAGTCTGGCCGCAATGCTGGGAGAAGCATCAGGTTTGCGGTCAGAACTGGGTGGCCAGC
GTCACCTACCTGGAGATTATCGGCATCATGGTTGGTCAGGCCGCCGTCGGTGTCATCGGTGATTGGATCGGCCGT
CGTTGGGGCCTGATCCAGGATGCCCTCATCATGTTCGTTGGCCTGCTCATGCTGACCGCCAGCTGGGGCTTCACG
CTTGAGGGCTGGGTCATCTGCTATGCCTGGTCTCTGTTCTTCTACAGTCTTGGTGTTGGAGGCGAGTATCCCATC
ACCGCCACGGCGTCTCTCGAGGGCGCCAACAATGCCGGAAAGCTGTCCACTCGTGAGGATCGCCTGCACCGCGGA
CGCCGCGTCACCATGGCCTTTCTCATGCAGGGATGGGGTCAGTTCGTCAACCAGGTCCTCCTCATGGTCCTTCTC
GTCATCTTCAACAAGGGCAGCGGCAGTCCGCCCTACAGCAGCTCGGCAGCCCAGTACACCTTTCGCCTGTCCTTT
GCCTTTCCCGCCATCGGCACCGCCTGGCTCGTCTACTACCGCACCTGGAAAATGCCTCACGCCTCGAAGCAGCTC
GCCGACGCAAAGAGCCGCTCCAACGTGACGGGCTACGACGTCCACGCCCTCCGTTACTGCGTCAACCACTTCGGC
GGCCGTCTCCTCGCCACGGCCGGCACCTGGTTCTGCAACGACGTCTTCTTCTACGGCAACAAGCTCTTCCAGGGC
CACTTCATCAAAGTCATCTCGGACAACCCCGACTCCCTCATGACGTCGTGGTACTGGAGCCTCGTCAACATCACC
ATCTCCCTCGCAGGCTACTACTCGGCTTCCCTCCTCATCGACAACAAGCTCTACGGAAGGAGGATGATGCAGCAG
GTCGGCTTCTTCATGTGCTTCCTCATGTTTGTCATTCCCGCCGTCCAATACGACAAGTACACCAAGCCCGAGCAC
ATACACGCCTTTCAGGCCATGTACTTTATCTCCTCCTTCTTCAACCAGTTCGGCCCAAACTCCGTCACCTTCCTC
GTCGCCGGTGAAGTCTTTCCCACGCCCATCCGCGCCACGGCTCACGGCTTCTCCGCCTGCCTCGGAAAGGCCGGC
GCCCTGCTCGCCTCGGTCCTCTACAACTACATCGACACCCGCACCAAGTTCTACTTCGTCACCTGGTTCGGTCTC
GTCGGCATGCTGCTGACGTGGCTTTTCCTGCCGGACACGACGGGCCTGGATCTCAAGGAACAGGAGCGTCGCTGG
AACTACATCCGCCAAGGAAGGGCAGAAGACTACCACGGCGTCGCCGTCAATCCCGCCCACCTCAGCCTCTGGGAA
CGCATCCGCGGCATCGGCAACACGTACGACCCCGAGCTGGACTGGAAGGCCAAGATTGACGACATGCGCGCCGAG
TGGGAGGCTGTCCAAAAGGCCCGCGATCCCAGGGAGAGCGAGGACCAGGACGGACACGGCATGCCCGACGACGGC
GAGTTTTCCCAAGAGATTCACGACTATTTCAAGCGCTCGGCTACCACGTCCAACACCGTGGTCGGCGAGAAGACG
TCGTCGCAATAA
Transcript >Ophun1|7475
ATGGCGCCTAAGGAAGCGTCCTCGCCCGACACGGAGCACCACGTTATTCCCGGCCAAGTTCCAGGTCCCCCCACC
GATTCGGACAGCGACGACTGTGGATTGAGCCCTGACGAGCGCCGCATCTTCAGTCACGTCACCCGTCCCGACGAC
TGCTACACCCCAGAGGGCATCTACTGGGCCGACCTGCCATGGGCCGACCGTTTCGCCTTTGTCTCACGCGTCGAC
CTCGATGCCGACATTCAAGAACTGCGCTCGTTCGCTTCCATGGCCAAGAAGAACCCCTTTTCGCCCTTGCTGTGG
TACGTTCGCAATGCTGTCATACCAGGCGCCGGCCTCGGTCTCGAGGGCTACGTCCTCTTCTCCATCGGCAACCTG
GAGCCTCTCTTTCGTCAAGTCTGGCCGCAATGCTGGGAGAAGCATCAGGTTTGCGGTCAGAACTGGGTGGCCAGC
GTCACCTACCTGGAGATTATCGGCATCATGGTTGGTCAGGCCGCCGTCGGTGTCATCGGTGATTGGATCGGCCGT
CGTTGGGGCCTGATCCAGGATGCCCTCATCATGTTCGTTGGCCTGCTCATGCTGACCGCCAGCTGGGGCTTCACG
CTTGAGGGCTGGGTCATCTGCTATGCCTGGTCTCTGTTCTTCTACAGTCTTGGTGTTGGAGGCGAGTATCCCATC
ACCGCCACGGCGTCTCTCGAGGGCGCCAACAATGCCGGAAAGCTGTCCACTCGTGAGGATCGCCTGCACCGCGGA
CGCCGCGTCACCATGGCCTTTCTCATGCAGGGATGGGGTCAGTTCGTCAACCAGGTCCTCCTCATGGTCCTTCTC
GTCATCTTCAACAAGGGCAGCGGCAGTCCGCCCTACAGCAGCTCGGCAGCCCAGTACACCTTTCGCCTGTCCTTT
GCCTTTCCCGCCATCGGCACCGCCTGGCTCGTCTACTACCGCACCTGGAAAATGCCTCACGCCTCGAAGCAGCTC
GCCGACGCAAAGAGCCGCTCCAACGTGACGGGCTACGACGTCCACGCCCTCCGTTACTGCGTCAACCACTTCGGC
GGCCGTCTCCTCGCCACGGCCGGCACCTGGTTCTGCAACGACGTCTTCTTCTACGGCAACAAGCTCTTCCAGGGC
CACTTCATCAAAGTCATCTCGGACAACCCCGACTCCCTCATGACGTCGTGGTACTGGAGCCTCGTCAACATCACC
ATCTCCCTCGCAGGCTACTACTCGGCTTCCCTCCTCATCGACAACAAGCTCTACGGAAGGAGGATGATGCAGCAG
GTCGGCTTCTTCATGTGCTTCCTCATGTTTGTCATTCCCGCCGTCCAATACGACAAGTACACCAAGCCCGAGCAC
ATACACGCCTTTCAGGCCATGTACTTTATCTCCTCCTTCTTCAACCAGTTCGGCCCAAACTCCGTCACCTTCCTC
GTCGCCGGTGAAGTCTTTCCCACGCCCATCCGCGCCACGGCTCACGGCTTCTCCGCCTGCCTCGGAAAGGCCGGC
GCCCTGCTCGCCTCGGTCCTCTACAACTACATCGACACCCGCACCAAGTTCTACTTCGTCACCTGGTTCGGTCTC
GTCGGCATGCTGCTGACGTGGCTTTTCCTGCCGGACACGACGGGCCTGGATCTCAAGGAACAGGAGCGTCGCTGG
AACTACATCCGCCAAGGAAGGGCAGAAGACTACCACGGCGTCGCCGTCAATCCCGCCCACCTCAGCCTCTGGGAA
CGCATCCGCGGCATCGGCAACACGTACGACCCCGAGCTGGACTGGAAGGCCAAGATTGACGACATGCGCGCCGAG
TGGGAGGCTGTCCAAAAGGCCCGCGATCCCAGGGAGAGCGAGGACCAGGACGGACACGGCATGCCCGACGACGGC
GAGTTTTCCCAAGAGATTCACGACTATTTCAAGCGCTCGGCTACCACGTCCAACACCGTGGTCGGCGAGAAGACG
TCGTCGCAATAA
Gene >Ophun1|7475
ATGGCGCCTAAGGAAGCGTCCTCGCCCGACACGGAGCACCACGTTATTCCCGGCCAAGTTCCAGGTCCCCCCACC
GATTCGGACAGCGACGACTGTGGATTGAGCCCTGACGAGCGCCGCATCTTCAGTCACGTCACCCGTCCCGACGAC
TGCTACACCCCAGAGGGCATCTACTGGGCCGACCTGCCATGGGCCGACCGTTTCGCCTTTGTCTCACGCGTCGAC
CTCGATGCCGACATTCAAGAACTGCGCTCGTTCGCTTCCATGGCCAAGAAGAACCCCTTTTCGCCCTTGCTGTGG
TACGTTCGCAATGCTGTCATACCAGGCGCCGGCCTCGGTCTCGAGGGCTACGTCCTCTTCTCCATCGGCAACCTG
GAGCCTCTCTTTCGTCAAGTCTGGCCGCAATGCTGGGAGAAGCATCAGGTTTGCGGTCAGAACTGGGTGGCCAGC
GTCACCTACCTGGAGATTATCGGCATCATGGTTGGTCAGGCCGCCGTCGGTGTAGGTTCCCAACCAACCCTTGGC
TCTTGACTAGCCTTTGCCCGACTGACGCCTCTCGAACCCAGGTCATCGGTGATTGGATCGGCCGTCGTTGGGGCC
TGATCCAGGATGCCCTCATCATGTTCGTTGGCCTGCTCATGCTGACCGCCAGCTGGGGCTTCACGCTTGAGGGCT
GGGTCATCTGCTATGCCTGGTCTCTGTTCTTCTACAGTACGTCTCTCACGTCCCTCGCCAATGGCCTTTCGGACC
TAATGTCCCCCCCCCCCTGCTAGGTCTTGGTGTTGGAGGCGAGTATCCCATCACCGCCACGGCGTCTCTCGAGGG
CGCCAACAATGCCGGAAAGCTGTCCACTCGTGAGGATCGCCTGCACCGCGGACGCCGCGTCACCATGGCCTTTCT
CATGCAGGGATGGGGTCAGTTCGTCAACCAGGTCCTCCTCATGGTCCTTCTCGTCATCTTCAACAAGGGCAGCGG
CAGTCCGCCCTACAGCAGCTCGGCAGCCCAGTACACCTTTCGCCTGTCCTTTGCCTTTCCCGCCATCGGCACCGC
CTGGCTCGTCTACTACCGCACCTGGAAAATGCCTCACGCCTCGAAGCAGCTCGCCGACGCAAAGAGCCGCTCCAA
CGTGACGGGCTACGACGTCCACGCCCTCCGTTACTGCGTCAACCACTTCGGCGGCCGTCTCCTCGCCACGGCCGG
CACCTGGTTCTGCAACGACGTCTTCTTCTACGGCAACAAGCTCTTCCAGGGCCACTTCATCAAAGTCATCTCGGA
CAACCCCGACTCCCTCATGACGTCGTGGTACTGGAGCCTCGTCAACATCACCATCTCCCTCGCAGGCTACTACTC
GGCTTCCCTCCTCATCGACAACAAGCTCTACGGAAGGAGGATGATGCAGCAGGTCGGCTTCTTCATGTGCTTCCT
CATGTTTGTCATTCCCGCCGTCCAATACGACAAGTACACCAAGCCCGAGCACATACACGCCTTTCAGGCCATGTA
CTTTATCTCCTCCTTCTTCAACCAGTTCGGCCCAAACTCCGTCACCTTCCTCGTCGCCGGTGAAGTCTTTCCCAC
GCCCATCCGCGCCACGGCTCACGGCTTCTCCGCCTGCCTCGGAAAGGCCGGCGCCCTGCTCGCCTCGGTCCTCTA
CAACTACATCGACACCCGCACCAAGTTCTACTTCGTCACCTGGTTCGGTCTCGTCGGCATGCTGCTGACGTGGCT
TTTCCTGCCGGACACGACGGGCCTGGATCTCAAGGAACAGGAGCGTCGCTGGAACTACATCCGCCAAGGAAGGGC
AGAAGACTACCACGGCGTCGCCGTCAATCCCGCCCACCTCAGCCTCTGGGAACGCATCCGCGGCATCGGCAACAC
GTACGACCCCGAGCTGGACTGGAAGGCCAAGATTGACGACATGCGCGCCGAGTGGGAGGCTGTCCAAAAGGCCCG
CGATCCCAGGGAGAGCGAGGACCAGGACGGACACGGCATGCCCGACGACGGCGAGTTTTCCCAAGAGATTCACGA
CTATTTCAAGCGCTCGGCTACCACGTCCAACACCGTGGTCGGCGAGAAGACGTCGTCGCAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail