Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7474
Gene name
LocationContig_947:3860..4910
Strand-
Gene length (bp)1050
Transcript length (bp)552
Coding sequence length (bp)552
Protein length (aa) 184

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00808 CBFD_NFYB_HMF Histone-like transcription factor (CBF/NF-Y) and archaeal histone 2.4E-29 26 90
PF00125 Histone Core histone H2A/H2B/H3/H4 2.8E-06 24 90

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P13434|HAP3_YEAST Transcriptional activator HAP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HAP3 PE=1 SV=1 16 118 6.0E-48
sp|Q6RG77|NFYB_HORSE Nuclear transcription factor Y subunit beta OS=Equus caballus GN=NFYB PE=2 SV=1 1 111 1.0E-47
sp|Q32KW0|NFYB_BOVIN Nuclear transcription factor Y subunit beta OS=Bos taurus GN=NFYB PE=2 SV=1 1 111 1.0E-47
sp|P25208|NFYB_HUMAN Nuclear transcription factor Y subunit beta OS=Homo sapiens GN=NFYB PE=1 SV=2 1 111 1.0E-47
sp|P63140|NFYB_RAT Nuclear transcription factor Y subunit beta OS=Rattus norvegicus GN=Nfyb PE=1 SV=1 1 111 2.0E-47
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P13434|HAP3_YEAST Transcriptional activator HAP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HAP3 PE=1 SV=1 16 118 6.0E-48
sp|Q6RG77|NFYB_HORSE Nuclear transcription factor Y subunit beta OS=Equus caballus GN=NFYB PE=2 SV=1 1 111 1.0E-47
sp|Q32KW0|NFYB_BOVIN Nuclear transcription factor Y subunit beta OS=Bos taurus GN=NFYB PE=2 SV=1 1 111 1.0E-47
sp|P25208|NFYB_HUMAN Nuclear transcription factor Y subunit beta OS=Homo sapiens GN=NFYB PE=1 SV=2 1 111 1.0E-47
sp|P63140|NFYB_RAT Nuclear transcription factor Y subunit beta OS=Rattus norvegicus GN=Nfyb PE=1 SV=1 1 111 2.0E-47
sp|P63139|NFYB_MOUSE Nuclear transcription factor Y subunit beta OS=Mus musculus GN=Nfyb PE=1 SV=1 1 111 2.0E-47
sp|P25207|NFYB_CHICK Nuclear transcription factor Y subunit beta OS=Gallus gallus GN=NFYB PE=2 SV=2 1 111 2.0E-47
sp|Q5QMG3|NFYB2_ORYSJ Nuclear transcription factor Y subunit B-2 OS=Oryza sativa subsp. japonica GN=NFYB2 PE=2 SV=1 19 111 6.0E-47
sp|O23310|NFYB3_ARATH Nuclear transcription factor Y subunit B-3 OS=Arabidopsis thaliana GN=NFYB3 PE=2 SV=1 20 128 1.0E-46
sp|Q54WV0|NFYB_DICDI Nuclear transcription factor Y subunit beta OS=Dictyostelium discoideum GN=nfyB PE=3 SV=1 21 120 2.0E-46
sp|P25210|NFYB_PETMA Nuclear transcription factor Y subunit beta OS=Petromyzon marinus GN=NFYB PE=2 SV=1 18 142 6.0E-46
sp|P25209|NFYB_MAIZE Nuclear transcription factor Y subunit B OS=Zea mays GN=NFY2 PE=2 SV=1 20 116 9.0E-46
sp|P40914|HAP3_KLULA Transcriptional activator HAP3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HAP3 PE=3 SV=1 17 118 1.0E-45
sp|Q9SLG0|NFYB1_ARATH Nuclear transcription factor Y subunit B-1 OS=Arabidopsis thaliana GN=NFYB1 PE=1 SV=2 20 113 3.0E-45
sp|Q9FGJ3|NFYB2_ARATH Nuclear transcription factor Y subunit B-2 OS=Arabidopsis thaliana GN=NFYB2 PE=2 SV=1 21 111 3.0E-45
sp|Q60EQ4|NFYB3_ORYSJ Nuclear transcription factor Y subunit B-3 OS=Oryza sativa subsp. japonica GN=NFYB3 PE=1 SV=2 20 116 3.0E-45
sp|Q8VYK4|NFYB8_ARATH Nuclear transcription factor Y subunit B-8 OS=Arabidopsis thaliana GN=NFYB8 PE=2 SV=1 20 113 4.0E-45
sp|P36611|HAP3_SCHPO Transcriptional activator hap3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hap3 PE=3 SV=1 26 116 4.0E-45
sp|Q67XJ2|NFYBA_ARATH Nuclear transcription factor Y subunit B-10 OS=Arabidopsis thaliana GN=NFYB10 PE=2 SV=1 20 111 5.0E-45
sp|O82248|NFYB5_ARATH Nuclear transcription factor Y subunit B-5 OS=Arabidopsis thaliana GN=NFYB5 PE=2 SV=1 20 110 5.0E-42
sp|Q65XK1|NFYB4_ORYSJ Nuclear transcription factor Y subunit B-4 OS=Oryza sativa subsp. japonica GN=NFYB4 PE=2 SV=2 21 141 6.0E-42
sp|Q9SIT9|NFYB7_ARATH Nuclear transcription factor Y subunit B-7 OS=Arabidopsis thaliana GN=NFYB7 PE=2 SV=1 21 113 6.0E-42
sp|Q9SFD8|NFYB9_ARATH Nuclear transcription factor Y subunit B-9 OS=Arabidopsis thaliana GN=NFYB9 PE=1 SV=2 21 111 1.0E-36
sp|O04027|NFYB4_ARATH Nuclear transcription factor Y subunit B-4 OS=Arabidopsis thaliana GN=NFYB4 PE=1 SV=1 22 120 2.0E-36
sp|Q84W66|NFYB6_ARATH Nuclear transcription factor Y subunit B-6 OS=Arabidopsis thaliana GN=NFYB6 PE=1 SV=2 20 111 2.0E-36
sp|P25211|NFYB_XENLA Nuclear transcription factor Y subunit beta (Fragment) OS=Xenopus laevis GN=nfyb PE=2 SV=1 54 111 2.0E-26
sp|Q6Z348|NFYB1_ORYSJ Nuclear transcription factor Y subunit B-1 OS=Oryza sativa subsp. japonica GN=NFYB1 PE=1 SV=2 27 120 4.0E-18
sp|O14348|NC2B_SCHPO Negative cofactor 2 complex subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ncb2 PE=3 SV=1 18 122 3.0E-15
sp|Q55DJ5|NC2B_DICDI Protein Dr1 homolog OS=Dictyostelium discoideum GN=dr1 PE=3 SV=1 21 110 4.0E-14
sp|P49592|NC2B_ARATH Protein Dr1 homolog OS=Arabidopsis thaliana GN=DR1 PE=2 SV=1 19 102 2.0E-13
sp|Q9NRF9|DPOE3_HUMAN DNA polymerase epsilon subunit 3 OS=Homo sapiens GN=POLE3 PE=1 SV=1 23 113 3.0E-13
sp|Q3SZN5|DPOE3_BOVIN DNA polymerase epsilon subunit 3 OS=Bos taurus GN=POLE3 PE=2 SV=1 23 113 3.0E-13
sp|Q5R4W3|DPOE3_PONAB DNA polymerase epsilon subunit 3 OS=Pongo abelii GN=POLE3 PE=2 SV=1 23 113 3.0E-13
sp|Q9VJQ5|NC2B_DROME Protein Dr1 OS=Drosophila melanogaster GN=NC2beta PE=1 SV=1 27 118 4.0E-13
sp|Q642A5|DPOE3_RAT DNA polymerase epsilon subunit 3 OS=Rattus norvegicus GN=Pole3 PE=1 SV=1 23 113 4.0E-13
sp|Q9JKP7|DPOE3_MOUSE DNA polymerase epsilon subunit 3 OS=Mus musculus GN=Pole3 PE=1 SV=1 23 110 2.0E-12
sp|Q5XI68|NC2B_RAT Protein Dr1 OS=Rattus norvegicus GN=Dr1 PE=2 SV=1 24 110 3.0E-11
sp|Q91WV0|NC2B_MOUSE Protein Dr1 OS=Mus musculus GN=Dr1 PE=1 SV=1 24 110 3.0E-11
sp|Q01658|NC2B_HUMAN Protein Dr1 OS=Homo sapiens GN=DR1 PE=1 SV=1 24 110 3.0E-11
sp|Q5ZMV3|NC2B_CHICK Protein Dr1 OS=Gallus gallus GN=DR1 PE=2 SV=1 24 110 3.0E-11
sp|P87174|DPB4_SCHPO DNA polymerase epsilon subunit D OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dpb4 PE=1 SV=1 24 109 4.0E-08
sp|Q75JQ9|DPOE3_DICDI DNA polymerase epsilon subunit 3 OS=Dictyostelium discoideum GN=pole3 PE=3 SV=1 27 110 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0003676 nucleic acid binding No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Histone-like TF

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup998
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6224
Ophiocordyceps australis map64 (Brazil) OphauB2|3966
Ophiocordyceps camponoti-floridani Ophcf2|04436
Ophiocordyceps camponoti-rufipedis Ophun1|7474 (this protein)
Ophiocordyceps kimflemingae Ophio5|5096
Ophiocordyceps subramaniannii Hirsu2|8415

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7474
MNDNRDPQSAGLTSYEFDGVKEQDRWLPIANVARIMKNALPDNAKIAKEAKECMQECVSEFISFVTSEASEKCQQ
EKRKTVNGEDILFAMTSLGFENYSEALKVYLSKYREQQNQSNRERGTDAGYMGSMLPGEKGEPGAAGGDYAVAGA
AGEASSSADGGGDPNYMYGPHAAHNGAGAGDGY*
Coding >Ophun1|7474
ATGAACGACAATCGTGACCCGCAGTCGGCCGGCCTGACTAGCTACGAGTTCGACGGCGTTAAAGAACAGGATAGG
TGGCTGCCCATAGCCAATGTCGCTCGCATTATGAAGAACGCCTTGCCTGACAATGCCAAGATCGCCAAAGAGGCC
AAAGAGTGCATGCAAGAGTGTGTCAGCGAATTCATCTCTTTTGTTACCAGCGAAGCATCGGAAAAATGCCAGCAA
GAGAAACGAAAAACAGTCAACGGCGAGGACATCTTATTTGCGATGACGTCGCTAGGATTTGAGAATTACTCCGAG
GCTCTCAAGGTCTATCTATCCAAATATCGCGAGCAACAGAATCAGTCCAATAGAGAACGAGGCACCGACGCCGGA
TACATGGGGTCCATGCTCCCTGGCGAAAAGGGCGAGCCCGGAGCTGCCGGCGGAGACTACGCCGTGGCGGGGGCG
GCCGGCGAGGCGTCCTCGAGTGCAGACGGTGGCGGAGATCCGAACTACATGTACGGTCCACACGCCGCTCACAAC
GGAGCCGGAGCCGGAGATGGATACTAG
Transcript >Ophun1|7474
ATGAACGACAATCGTGACCCGCAGTCGGCCGGCCTGACTAGCTACGAGTTCGACGGCGTTAAAGAACAGGATAGG
TGGCTGCCCATAGCCAATGTCGCTCGCATTATGAAGAACGCCTTGCCTGACAATGCCAAGATCGCCAAAGAGGCC
AAAGAGTGCATGCAAGAGTGTGTCAGCGAATTCATCTCTTTTGTTACCAGCGAAGCATCGGAAAAATGCCAGCAA
GAGAAACGAAAAACAGTCAACGGCGAGGACATCTTATTTGCGATGACGTCGCTAGGATTTGAGAATTACTCCGAG
GCTCTCAAGGTCTATCTATCCAAATATCGCGAGCAACAGAATCAGTCCAATAGAGAACGAGGCACCGACGCCGGA
TACATGGGGTCCATGCTCCCTGGCGAAAAGGGCGAGCCCGGAGCTGCCGGCGGAGACTACGCCGTGGCGGGGGCG
GCCGGCGAGGCGTCCTCGAGTGCAGACGGTGGCGGAGATCCGAACTACATGTACGGTCCACACGCCGCTCACAAC
GGAGCCGGAGCCGGAGATGGATACTAG
Gene >Ophun1|7474
ATGAACGACAATCGTGACCCGCAGTCGGCCGGCCTGACTAGCTACGAGTTCGACGGCGTTAAAGAACAGGATAGG
TGGCTGCCCATAGCCAATGGTGAGTCCTCATGCCCCCCCCTTCTCCCTCTGGGCTCTCGCCCGTGATTTGCTCTC
CTGGACGCCCCCCCCCCTTTCCTCTTCGATTCAGGGACAGCCTCGCATGCCTCCATGTCTCACGATTCGTCCGCC
AACCCGTCGCGCGTCTCCAGGACCGACAGGGCAGACGAGCTTGACGCTAACATTCGCAACTTTGCTCCAGTCGCT
CGCATTATGAAGAACGCCTTGCCTGACAATGCCAAGATCGCCAAAGAGGCCAAAGAGTGCATGCAAGAGTGTGTC
AGCGAATTCATCTCTTTTGTTACCAGCGAAGGTGAGTTTATTTTTGTTTGGACGAAACTGTTGATTCGCATACAA
TGACCCCCCCCTCTTTTACCCCCCATGCCCCTCGTCGTTGTCTCTGTTTGTCTCCGTTTTTGTTGTCTATACGAA
TCCTTTAGTTAAAGGCCCTATCTGATCTCAACCCCGTTCATACAATTGTCTGCCCCGTTCGCCTACCCACTTCCT
GTCGTCGTTGCTCTTTTTCCCGCTGACATCTGGCGCCCACCAGCATCGGAAAAATGCCAGCAAGAGAAACGAAAA
ACAGTCAACGGCGAGGACATCTTATTTGCGATGACGTCGCTAGGATTTGAGAATTACTCCGAGGCTCTCAAGGTC
TATCTATCCAAATATCGCGAGGTACACGAGCACTCTACACAACAATCGCATATCCCCGTCACGCTGACACTTTCG
CGATAGCAACAGAATCAGTCCAATAGAGAACGAGGCACCGACGCCGGATACATGGGGTCCATGCTCCCTGGCGAA
AAGGGCGAGCCCGGAGCTGCCGGCGGAGACTACGCCGTGGCGGGGGCGGCCGGCGAGGCGTCCTCGAGTGCAGAC
GGTGGCGGAGATCCGAACTACATGTACGGTCCACACGCCGCTCACAACGGAGCCGGAGCCGGAGATGGATACTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail