Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|747
Gene name
LocationContig_125:20310..24744
Strand+
Gene length (bp)4434
Transcript length (bp)4434
Coding sequence length (bp)4434
Protein length (aa) 1478

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01535 PPR PPR repeat 5.1E-02 1221 1246

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9LSL9|PP445_ARATH Pentatricopeptide repeat-containing protein At5g65560 OS=Arabidopsis thaliana GN=At5g65560 PE=2 SV=1 772 1026 2.0E-08
sp|Q9SZ52|PP344_ARATH Pentatricopeptide repeat-containing protein At4g31850, chloroplastic OS=Arabidopsis thaliana GN=PGR3 PE=1 SV=1 739 1181 1.0E-07
sp|Q5G1S8|PP241_ARATH Pentatricopeptide repeat-containing protein At3g18110, chloroplastic OS=Arabidopsis thaliana GN=EMB1270 PE=2 SV=2 692 948 1.0E-07
sp|Q9FMF6|PP444_ARATH Pentatricopeptide repeat-containing protein At5g64320, mitochondrial OS=Arabidopsis thaliana GN=At5g64320 PE=2 SV=1 780 1026 2.0E-07
sp|Q9FIT7|PP442_ARATH Pentatricopeptide repeat-containing protein At5g61990, mitochondrial OS=Arabidopsis thaliana GN=At5g61990 PE=2 SV=1 780 982 1.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9LSL9|PP445_ARATH Pentatricopeptide repeat-containing protein At5g65560 OS=Arabidopsis thaliana GN=At5g65560 PE=2 SV=1 772 1026 2.0E-08
sp|Q9SZ52|PP344_ARATH Pentatricopeptide repeat-containing protein At4g31850, chloroplastic OS=Arabidopsis thaliana GN=PGR3 PE=1 SV=1 739 1181 1.0E-07
sp|Q5G1S8|PP241_ARATH Pentatricopeptide repeat-containing protein At3g18110, chloroplastic OS=Arabidopsis thaliana GN=EMB1270 PE=2 SV=2 692 948 1.0E-07
sp|Q9FMF6|PP444_ARATH Pentatricopeptide repeat-containing protein At5g64320, mitochondrial OS=Arabidopsis thaliana GN=At5g64320 PE=2 SV=1 780 1026 2.0E-07
sp|Q9FIT7|PP442_ARATH Pentatricopeptide repeat-containing protein At5g61990, mitochondrial OS=Arabidopsis thaliana GN=At5g61990 PE=2 SV=1 780 982 1.0E-06
sp|Q9FMQ1|PP376_ARATH Pentatricopeptide repeat-containing protein At5g12100, mitochondrial OS=Arabidopsis thaliana GN=At5g12100 PE=2 SV=1 780 962 1.0E-06
sp|Q9FJE6|PP437_ARATH Putative pentatricopeptide repeat-containing protein At5g59900 OS=Arabidopsis thaliana GN=At5g59900 PE=3 SV=1 782 979 2.0E-06
sp|Q9LSL9|PP445_ARATH Pentatricopeptide repeat-containing protein At5g65560 OS=Arabidopsis thaliana GN=At5g65560 PE=2 SV=1 805 964 3.0E-06
sp|Q9LPX2|PPR39_ARATH Pentatricopeptide repeat-containing protein At1g12775, mitochondrial OS=Arabidopsis thaliana GN=At1g12775 PE=2 SV=1 779 974 3.0E-06
sp|Q9FKR3|PP404_ARATH Pentatricopeptide repeat-containing protein At5g38730 OS=Arabidopsis thaliana GN=At5g38730 PE=2 SV=1 779 1000 5.0E-06
sp|Q9M302|PP270_ARATH Pentatricopeptide repeat-containing protein At3g48810 OS=Arabidopsis thaliana GN=At3g48810 PE=2 SV=1 803 1042 8.0E-06
sp|Q9LN69|PPR50_ARATH Putative pentatricopeptide repeat-containing protein At1g19290 OS=Arabidopsis thaliana GN=At1g19290 PE=3 SV=2 779 1015 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 44 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|747
MLGETGDASQEADVGEGATRKTSEKGARKSSEPRAAEVVANDEEAANATDVKTRQATKTIVALDVIRSPSTALAR
LQTLALVEVKSPTAIAAGAETLESPERKEVVVGKVESCEADASDASVSKPQEAPAMVDEVEQLAADAPVPDTTET
PSIGEAVIEDLEHPTANASAPETPDILARGEEFKKEVEHDVADAPVLKVPETPTIGEPVAEEVGHRPADAPIPVT
PEAATIHPEKGVVEDVQSRSARASETQETSVKGESASLEIESGSAEASVSETAVGTVVVQEVKSRSVDAPIAEKP
TEEVVQQVESPSADASVPEKAIAEVVVQEVKSRSADGPVTDTPKGEVVQQASVQEVESHSTDASGLETGAKGNLA
VEKAVKDDTAEHVPLLASPIQALRIAERGADTGVGGSTISKTDAGPAGEPETLPTDDAAAGSAAPDSTIGLPASL
TTSPEENAVERANAEPTAEVLQPDNGLLESGNASNALPASTDSPSESPVMPPDEAGQPADIAAPTAEQLQADRVL
ALIKAEDFSSAERTIKTELTQKRLAGGVEHLVAHFIRKRKWLELLKVWKDYSEYLGGKADVESYRWPQAEDVPDL
GESYLLFEHYVETEGAAEAKTLKADVLLTLRRQLAELSLSQGCPPLFAAVILEIWKDENLYERYLLLMLDKWFQR
QVTRNALTRLNDIYRNYRVLPKAKPSPALLHAMFRFCSNSKEDVNHFVADDIYRDWYKTWGGLDAEAFLGFLDLY
GEAGDIVSVRKLWTRYTTRFPEALQVSRTFRSLVVAYAQRAEPEKAEREVRIMQETYGVQPDTEIWNAVLKGYMR
MENAEVMRHCLSIIHATEGPNDSTYAIFMSLAAKRGDLDAATKIASQAQTSGIPVTAPMIRRLVTTYCQNDRLLA
AERICQEASQRGLIDVEMWNQVLKFNGIKGKLDKCNELLRVMDDIGIEWDEHTYLQLLNSMIKVHKVLPAWSLLK
KAVEERLFHVTDQHFEAVMNGASRAKFHDLVVSIASHMLQARPGPLSFNALAVLAASSLAKAPSAGRPREISQEL
LPALLELMPSDEVAKEKETEEQEDESKPPECRFGSMPLLRRKTSQIDRAVKVLVDLRDFKGAEQLINTYINIFPQ
FWDARTLPPKLAGAVMAGYLIEGKHNRALSIWDKAWKAGMARCRDSKGAVYPALRWHLTMPIHQVIHVLRDKEDP
DGIVKVVEEALAVGFCLSRNTWNLVIWAMAKLGRWERAMGWCETMLMPGWRGWKNEVSPAKMRVLQADNHLLAPV
KSTVFSLQEEWLKMRKLSAWSADVSNRIRQLERNHPLLHHAFITNDPAFLPAAWTIPRTPSFSRAIKDMLRSLTY
RELKAIKTALIRQLHLLGLRYDPVAERARHYHRKRHQRKKKNVVESPFHVVVGGVGEDGHVQTKEFSAGELEVLD
VELKKTMDKMRDSAAEASSSSSFSSADAPVGGPSSPVGGPSSATEETGSRES*
Coding >Ophun1|747
ATGCTTGGTGAGACTGGCGATGCATCGCAAGAAGCTGATGTCGGCGAGGGCGCAACCCGCAAGACATCCGAAAAA
GGGGCTCGCAAATCCTCCGAACCTAGGGCCGCAGAGGTTGTGGCAAATGACGAAGAAGCGGCGAATGCAACTGAT
GTCAAGACCCGCCAAGCTACAAAAACGATCGTAGCTTTGGACGTCATTCGCAGCCCTTCGACTGCGCTCGCAAGA
CTTCAAACCTTGGCGCTCGTTGAAGTGAAGTCTCCTACGGCTATTGCTGCGGGCGCGGAGACGTTGGAGTCGCCT
GAGAGGAAAGAAGTGGTTGTTGGAAAAGTCGAAAGCTGCGAGGCAGACGCTTCAGACGCTTCGGTCTCGAAACCG
CAGGAGGCTCCTGCGATGGTAGACGAAGTCGAACAACTTGCGGCTGATGCTCCAGTTCCTGATACGACGGAGACT
CCTTCGATAGGCGAGGCGGTCATTGAAGATCTCGAGCACCCCACGGCTAATGCTTCAGCTCCGGAAACACCGGAC
ATTCTCGCGAGAGGGGAAGAGTTCAAGAAGGAGGTCGAACATGATGTGGCCGATGCTCCAGTTCTCAAGGTGCCA
GAGACTCCGACGATAGGCGAGCCGGTCGCCGAGGAAGTCGGGCATCGTCCGGCTGATGCTCCGATTCCTGTCACG
CCGGAGGCTGCTACGATACATCCAGAGAAGGGAGTTGTCGAGGATGTCCAAAGTCGTTCGGCTCGTGCTTCCGAA
ACGCAGGAAACTTCTGTGAAGGGAGAATCGGCATCTCTGGAAATCGAGAGTGGATCGGCTGAAGCTTCGGTCTCC
GAGACGGCGGTGGGAACAGTGGTCGTTCAGGAAGTCAAAAGCCGTTCGGTTGATGCTCCTATTGCCGAGAAACCG
ACTGAAGAAGTTGTCCAACAAGTTGAAAGTCCTTCGGCTGATGCTTCGGTCCCCGAGAAGGCGATTGCAGAAGTT
GTCGTGCAGGAAGTCAAAAGCCGTTCAGCTGATGGTCCTGTTACCGACACACCGAAAGGAGAAGTTGTTCAGCAA
GCGAGCGTTCAGGAAGTCGAGAGTCATTCAACTGATGCTTCAGGCCTCGAGACTGGGGCCAAAGGGAATCTTGCC
GTAGAGAAGGCTGTCAAAGACGATACGGCGGAGCATGTTCCTCTACTCGCGAGTCCGATTCAAGCATTGCGCATT
GCCGAGAGGGGAGCAGACACCGGGGTGGGAGGAAGCACCATCTCTAAGACTGATGCGGGCCCAGCTGGGGAGCCA
GAGACCCTCCCGACAGATGATGCAGCCGCTGGCAGTGCAGCTCCGGACTCCACGATTGGACTACCAGCATCTCTC
ACAACTTCACCAGAGGAGAATGCCGTCGAGCGGGCGAATGCCGAGCCAACCGCTGAGGTTTTGCAGCCGGACAAT
GGTCTTCTGGAATCAGGAAATGCCAGCAACGCTCTACCAGCTTCCACGGACAGCCCATCAGAGTCCCCCGTGATG
CCGCCCGACGAGGCCGGACAACCAGCTGATATCGCCGCGCCTACAGCCGAACAGCTCCAGGCCGACAGGGTGCTC
GCTCTCATCAAGGCAGAAGATTTCTCGTCTGCCGAACGCACCATCAAGACCGAACTGACGCAAAAGCGCTTGGCC
GGTGGTGTCGAGCATCTTGTCGCTCACTTCATCCGCAAACGAAAATGGCTGGAGCTCCTGAAAGTCTGGAAGGAC
TATTCCGAGTATCTCGGTGGAAAAGCAGATGTCGAGAGCTATCGATGGCCGCAGGCTGAGGACGTTCCTGATCTC
GGCGAGTCGTACCTCTTATTCGAACATTACGTCGAGACGGAGGGTGCCGCCGAGGCGAAGACACTCAAGGCCGAC
GTCTTGTTAACTCTTCGGAGGCAGCTAGCAGAGTTGTCTCTGAGCCAGGGCTGCCCTCCACTGTTCGCCGCCGTC
ATACTGGAGATATGGAAGGACGAGAACCTCTACGAACGCTATCTGCTCCTCATGCTCGACAAGTGGTTCCAGAGG
CAGGTGACGAGAAACGCGCTGACAAGACTCAACGACATATACAGAAACTACAGAGTCTTGCCCAAGGCGAAGCCC
TCGCCCGCCCTGCTGCATGCCATGTTCCGATTCTGCTCGAATTCAAAGGAAGACGTGAACCATTTCGTGGCGGAT
GACATCTATCGAGACTGGTACAAGACCTGGGGTGGTCTTGACGCGGAAGCCTTCCTAGGGTTCCTCGACCTGTAC
GGCGAGGCCGGAGACATCGTGTCGGTCCGCAAACTGTGGACTCGCTACACGACCCGCTTCCCTGAGGCTCTCCAG
GTGTCGAGGACGTTCCGGAGCCTCGTGGTAGCGTACGCGCAGAGGGCCGAACCCGAAAAGGCCGAGCGGGAGGTG
CGAATTATGCAGGAGACTTATGGCGTTCAGCCTGACACGGAGATATGGAACGCGGTGCTCAAGGGCTACATGAGG
ATGGAGAATGCAGAGGTGATGCGGCACTGCTTGAGCATCATCCACGCGACTGAAGGCCCCAACGACTCGACATAC
GCCATCTTCATGTCACTCGCCGCCAAGAGAGGCGACCTCGATGCAGCGACCAAGATTGCGAGCCAGGCGCAGACA
AGCGGGATACCGGTGACGGCCCCCATGATACGCCGACTCGTGACGACGTACTGCCAGAACGACCGGTTGCTGGCG
GCAGAGCGCATCTGTCAGGAGGCTTCTCAGCGAGGATTGATTGACGTCGAGATGTGGAACCAAGTCCTGAAATTC
AACGGCATCAAGGGCAAGCTGGACAAGTGCAACGAGCTGCTACGGGTCATGGACGACATTGGAATCGAATGGGAT
GAGCATACGTACCTGCAGCTTCTCAACTCCATGATCAAGGTCCACAAGGTTCTGCCCGCCTGGTCGCTGTTGAAG
AAGGCCGTCGAGGAGAGGCTCTTTCATGTGACGGACCAGCACTTTGAAGCCGTCATGAACGGTGCCAGTCGGGCC
AAGTTCCACGACCTGGTCGTCTCCATCGCCTCGCACATGCTACAGGCACGTCCGGGACCCCTTTCGTTCAACGCG
CTGGCGGTTCTGGCAGCATCGTCGTTGGCCAAGGCGCCGTCAGCAGGTCGACCTCGGGAGATAAGCCAGGAGTTG
CTGCCAGCGCTGTTGGAGCTGATGCCGTCCGATGAAGTCGCAAAAGAGAAGGAAACCGAAGAACAAGAAGACGAG
TCAAAGCCGCCGGAATGCCGGTTCGGAAGCATGCCCCTGCTCCGGAGGAAGACGTCTCAGATAGACCGGGCCGTC
AAGGTGCTGGTCGATCTCCGCGACTTCAAGGGGGCCGAGCAGCTGATCAACACGTACATCAACATCTTCCCCCAG
TTCTGGGACGCCAGGACGCTGCCGCCCAAGCTGGCGGGCGCCGTCATGGCCGGCTACCTCATCGAGGGGAAGCAC
AACAGGGCGCTCTCCATCTGGGACAAGGCGTGGAAGGCGGGCATGGCTCGTTGCAGAGACAGCAAGGGAGCCGTC
TACCCTGCCCTTCGCTGGCACCTCACCATGCCCATCCACCAGGTCATCCACGTGCTGCGCGACAAGGAGGACCCC
GACGGCATCGTCAAGGTGGTGGAGGAGGCGCTGGCCGTGGGCTTCTGCCTCAGTCGCAACACGTGGAACCTCGTC
ATCTGGGCCATGGCCAAGCTGGGCCGCTGGGAGAGGGCAATGGGCTGGTGCGAGACGATGCTGATGCCCGGCTGG
CGAGGATGGAAGAACGAGGTCTCTCCGGCGAAGATGCGCGTCCTCCAGGCAGACAACCACCTCCTCGCGCCCGTC
AAATCCACCGTCTTCAGCCTCCAGGAAGAATGGCTCAAGATGCGCAAACTGTCCGCCTGGTCCGCCGACGTGTCC
AACCGCATCCGACAACTAGAGCGCAACCACCCTCTCCTCCACCACGCCTTCATCACCAACGACCCTGCCTTCCTC
CCCGCCGCCTGGACCATCCCCCGGACCCCCAGCTTCTCCCGCGCAATCAAGGACATGCTCCGCTCGCTGACCTAC
CGCGAGCTCAAGGCCATCAAGACAGCCCTCATCCGGCAACTCCACCTCCTGGGCCTCCGCTACGACCCGGTCGCC
GAGCGCGCCCGCCACTACCACCGCAAGAGACACCAGCGGAAGAAGAAGAATGTGGTTGAGAGTCCGTTTCATGTT
GTGGTTGGCGGGGTGGGTGAGGATGGCCATGTGCAGACCAAGGAGTTTTCGGCGGGGGAGCTCGAGGTTTTGGAT
GTCGAGTTGAAGAAGACGATGGACAAGATGAGGGATTCGGCTGCTGAGGCTTCGTCGTCTTCGTCGTTTTCTTCT
GCGGATGCTCCGGTTGGAGGTCCTTCTTCCCCGGTTGGGGGTCCTTCTTCTGCGACTGAGGAGACTGGTTCGCGG
GAGAGTTGA
Transcript >Ophun1|747
ATGCTTGGTGAGACTGGCGATGCATCGCAAGAAGCTGATGTCGGCGAGGGCGCAACCCGCAAGACATCCGAAAAA
GGGGCTCGCAAATCCTCCGAACCTAGGGCCGCAGAGGTTGTGGCAAATGACGAAGAAGCGGCGAATGCAACTGAT
GTCAAGACCCGCCAAGCTACAAAAACGATCGTAGCTTTGGACGTCATTCGCAGCCCTTCGACTGCGCTCGCAAGA
CTTCAAACCTTGGCGCTCGTTGAAGTGAAGTCTCCTACGGCTATTGCTGCGGGCGCGGAGACGTTGGAGTCGCCT
GAGAGGAAAGAAGTGGTTGTTGGAAAAGTCGAAAGCTGCGAGGCAGACGCTTCAGACGCTTCGGTCTCGAAACCG
CAGGAGGCTCCTGCGATGGTAGACGAAGTCGAACAACTTGCGGCTGATGCTCCAGTTCCTGATACGACGGAGACT
CCTTCGATAGGCGAGGCGGTCATTGAAGATCTCGAGCACCCCACGGCTAATGCTTCAGCTCCGGAAACACCGGAC
ATTCTCGCGAGAGGGGAAGAGTTCAAGAAGGAGGTCGAACATGATGTGGCCGATGCTCCAGTTCTCAAGGTGCCA
GAGACTCCGACGATAGGCGAGCCGGTCGCCGAGGAAGTCGGGCATCGTCCGGCTGATGCTCCGATTCCTGTCACG
CCGGAGGCTGCTACGATACATCCAGAGAAGGGAGTTGTCGAGGATGTCCAAAGTCGTTCGGCTCGTGCTTCCGAA
ACGCAGGAAACTTCTGTGAAGGGAGAATCGGCATCTCTGGAAATCGAGAGTGGATCGGCTGAAGCTTCGGTCTCC
GAGACGGCGGTGGGAACAGTGGTCGTTCAGGAAGTCAAAAGCCGTTCGGTTGATGCTCCTATTGCCGAGAAACCG
ACTGAAGAAGTTGTCCAACAAGTTGAAAGTCCTTCGGCTGATGCTTCGGTCCCCGAGAAGGCGATTGCAGAAGTT
GTCGTGCAGGAAGTCAAAAGCCGTTCAGCTGATGGTCCTGTTACCGACACACCGAAAGGAGAAGTTGTTCAGCAA
GCGAGCGTTCAGGAAGTCGAGAGTCATTCAACTGATGCTTCAGGCCTCGAGACTGGGGCCAAAGGGAATCTTGCC
GTAGAGAAGGCTGTCAAAGACGATACGGCGGAGCATGTTCCTCTACTCGCGAGTCCGATTCAAGCATTGCGCATT
GCCGAGAGGGGAGCAGACACCGGGGTGGGAGGAAGCACCATCTCTAAGACTGATGCGGGCCCAGCTGGGGAGCCA
GAGACCCTCCCGACAGATGATGCAGCCGCTGGCAGTGCAGCTCCGGACTCCACGATTGGACTACCAGCATCTCTC
ACAACTTCACCAGAGGAGAATGCCGTCGAGCGGGCGAATGCCGAGCCAACCGCTGAGGTTTTGCAGCCGGACAAT
GGTCTTCTGGAATCAGGAAATGCCAGCAACGCTCTACCAGCTTCCACGGACAGCCCATCAGAGTCCCCCGTGATG
CCGCCCGACGAGGCCGGACAACCAGCTGATATCGCCGCGCCTACAGCCGAACAGCTCCAGGCCGACAGGGTGCTC
GCTCTCATCAAGGCAGAAGATTTCTCGTCTGCCGAACGCACCATCAAGACCGAACTGACGCAAAAGCGCTTGGCC
GGTGGTGTCGAGCATCTTGTCGCTCACTTCATCCGCAAACGAAAATGGCTGGAGCTCCTGAAAGTCTGGAAGGAC
TATTCCGAGTATCTCGGTGGAAAAGCAGATGTCGAGAGCTATCGATGGCCGCAGGCTGAGGACGTTCCTGATCTC
GGCGAGTCGTACCTCTTATTCGAACATTACGTCGAGACGGAGGGTGCCGCCGAGGCGAAGACACTCAAGGCCGAC
GTCTTGTTAACTCTTCGGAGGCAGCTAGCAGAGTTGTCTCTGAGCCAGGGCTGCCCTCCACTGTTCGCCGCCGTC
ATACTGGAGATATGGAAGGACGAGAACCTCTACGAACGCTATCTGCTCCTCATGCTCGACAAGTGGTTCCAGAGG
CAGGTGACGAGAAACGCGCTGACAAGACTCAACGACATATACAGAAACTACAGAGTCTTGCCCAAGGCGAAGCCC
TCGCCCGCCCTGCTGCATGCCATGTTCCGATTCTGCTCGAATTCAAAGGAAGACGTGAACCATTTCGTGGCGGAT
GACATCTATCGAGACTGGTACAAGACCTGGGGTGGTCTTGACGCGGAAGCCTTCCTAGGGTTCCTCGACCTGTAC
GGCGAGGCCGGAGACATCGTGTCGGTCCGCAAACTGTGGACTCGCTACACGACCCGCTTCCCTGAGGCTCTCCAG
GTGTCGAGGACGTTCCGGAGCCTCGTGGTAGCGTACGCGCAGAGGGCCGAACCCGAAAAGGCCGAGCGGGAGGTG
CGAATTATGCAGGAGACTTATGGCGTTCAGCCTGACACGGAGATATGGAACGCGGTGCTCAAGGGCTACATGAGG
ATGGAGAATGCAGAGGTGATGCGGCACTGCTTGAGCATCATCCACGCGACTGAAGGCCCCAACGACTCGACATAC
GCCATCTTCATGTCACTCGCCGCCAAGAGAGGCGACCTCGATGCAGCGACCAAGATTGCGAGCCAGGCGCAGACA
AGCGGGATACCGGTGACGGCCCCCATGATACGCCGACTCGTGACGACGTACTGCCAGAACGACCGGTTGCTGGCG
GCAGAGCGCATCTGTCAGGAGGCTTCTCAGCGAGGATTGATTGACGTCGAGATGTGGAACCAAGTCCTGAAATTC
AACGGCATCAAGGGCAAGCTGGACAAGTGCAACGAGCTGCTACGGGTCATGGACGACATTGGAATCGAATGGGAT
GAGCATACGTACCTGCAGCTTCTCAACTCCATGATCAAGGTCCACAAGGTTCTGCCCGCCTGGTCGCTGTTGAAG
AAGGCCGTCGAGGAGAGGCTCTTTCATGTGACGGACCAGCACTTTGAAGCCGTCATGAACGGTGCCAGTCGGGCC
AAGTTCCACGACCTGGTCGTCTCCATCGCCTCGCACATGCTACAGGCACGTCCGGGACCCCTTTCGTTCAACGCG
CTGGCGGTTCTGGCAGCATCGTCGTTGGCCAAGGCGCCGTCAGCAGGTCGACCTCGGGAGATAAGCCAGGAGTTG
CTGCCAGCGCTGTTGGAGCTGATGCCGTCCGATGAAGTCGCAAAAGAGAAGGAAACCGAAGAACAAGAAGACGAG
TCAAAGCCGCCGGAATGCCGGTTCGGAAGCATGCCCCTGCTCCGGAGGAAGACGTCTCAGATAGACCGGGCCGTC
AAGGTGCTGGTCGATCTCCGCGACTTCAAGGGGGCCGAGCAGCTGATCAACACGTACATCAACATCTTCCCCCAG
TTCTGGGACGCCAGGACGCTGCCGCCCAAGCTGGCGGGCGCCGTCATGGCCGGCTACCTCATCGAGGGGAAGCAC
AACAGGGCGCTCTCCATCTGGGACAAGGCGTGGAAGGCGGGCATGGCTCGTTGCAGAGACAGCAAGGGAGCCGTC
TACCCTGCCCTTCGCTGGCACCTCACCATGCCCATCCACCAGGTCATCCACGTGCTGCGCGACAAGGAGGACCCC
GACGGCATCGTCAAGGTGGTGGAGGAGGCGCTGGCCGTGGGCTTCTGCCTCAGTCGCAACACGTGGAACCTCGTC
ATCTGGGCCATGGCCAAGCTGGGCCGCTGGGAGAGGGCAATGGGCTGGTGCGAGACGATGCTGATGCCCGGCTGG
CGAGGATGGAAGAACGAGGTCTCTCCGGCGAAGATGCGCGTCCTCCAGGCAGACAACCACCTCCTCGCGCCCGTC
AAATCCACCGTCTTCAGCCTCCAGGAAGAATGGCTCAAGATGCGCAAACTGTCCGCCTGGTCCGCCGACGTGTCC
AACCGCATCCGACAACTAGAGCGCAACCACCCTCTCCTCCACCACGCCTTCATCACCAACGACCCTGCCTTCCTC
CCCGCCGCCTGGACCATCCCCCGGACCCCCAGCTTCTCCCGCGCAATCAAGGACATGCTCCGCTCGCTGACCTAC
CGCGAGCTCAAGGCCATCAAGACAGCCCTCATCCGGCAACTCCACCTCCTGGGCCTCCGCTACGACCCGGTCGCC
GAGCGCGCCCGCCACTACCACCGCAAGAGACACCAGCGGAAGAAGAAGAATGTGGTTGAGAGTCCGTTTCATGTT
GTGGTTGGCGGGGTGGGTGAGGATGGCCATGTGCAGACCAAGGAGTTTTCGGCGGGGGAGCTCGAGGTTTTGGAT
GTCGAGTTGAAGAAGACGATGGACAAGATGAGGGATTCGGCTGCTGAGGCTTCGTCGTCTTCGTCGTTTTCTTCT
GCGGATGCTCCGGTTGGAGGTCCTTCTTCCCCGGTTGGGGGTCCTTCTTCTGCGACTGAGGAGACTGGTTCGCGG
GAGAGTTGA
Gene >Ophun1|747
ATGCTTGGTGAGACTGGCGATGCATCGCAAGAAGCTGATGTCGGCGAGGGCGCAACCCGCAAGACATCCGAAAAA
GGGGCTCGCAAATCCTCCGAACCTAGGGCCGCAGAGGTTGTGGCAAATGACGAAGAAGCGGCGAATGCAACTGAT
GTCAAGACCCGCCAAGCTACAAAAACGATCGTAGCTTTGGACGTCATTCGCAGCCCTTCGACTGCGCTCGCAAGA
CTTCAAACCTTGGCGCTCGTTGAAGTGAAGTCTCCTACGGCTATTGCTGCGGGCGCGGAGACGTTGGAGTCGCCT
GAGAGGAAAGAAGTGGTTGTTGGAAAAGTCGAAAGCTGCGAGGCAGACGCTTCAGACGCTTCGGTCTCGAAACCG
CAGGAGGCTCCTGCGATGGTAGACGAAGTCGAACAACTTGCGGCTGATGCTCCAGTTCCTGATACGACGGAGACT
CCTTCGATAGGCGAGGCGGTCATTGAAGATCTCGAGCACCCCACGGCTAATGCTTCAGCTCCGGAAACACCGGAC
ATTCTCGCGAGAGGGGAAGAGTTCAAGAAGGAGGTCGAACATGATGTGGCCGATGCTCCAGTTCTCAAGGTGCCA
GAGACTCCGACGATAGGCGAGCCGGTCGCCGAGGAAGTCGGGCATCGTCCGGCTGATGCTCCGATTCCTGTCACG
CCGGAGGCTGCTACGATACATCCAGAGAAGGGAGTTGTCGAGGATGTCCAAAGTCGTTCGGCTCGTGCTTCCGAA
ACGCAGGAAACTTCTGTGAAGGGAGAATCGGCATCTCTGGAAATCGAGAGTGGATCGGCTGAAGCTTCGGTCTCC
GAGACGGCGGTGGGAACAGTGGTCGTTCAGGAAGTCAAAAGCCGTTCGGTTGATGCTCCTATTGCCGAGAAACCG
ACTGAAGAAGTTGTCCAACAAGTTGAAAGTCCTTCGGCTGATGCTTCGGTCCCCGAGAAGGCGATTGCAGAAGTT
GTCGTGCAGGAAGTCAAAAGCCGTTCAGCTGATGGTCCTGTTACCGACACACCGAAAGGAGAAGTTGTTCAGCAA
GCGAGCGTTCAGGAAGTCGAGAGTCATTCAACTGATGCTTCAGGCCTCGAGACTGGGGCCAAAGGGAATCTTGCC
GTAGAGAAGGCTGTCAAAGACGATACGGCGGAGCATGTTCCTCTACTCGCGAGTCCGATTCAAGCATTGCGCATT
GCCGAGAGGGGAGCAGACACCGGGGTGGGAGGAAGCACCATCTCTAAGACTGATGCGGGCCCAGCTGGGGAGCCA
GAGACCCTCCCGACAGATGATGCAGCCGCTGGCAGTGCAGCTCCGGACTCCACGATTGGACTACCAGCATCTCTC
ACAACTTCACCAGAGGAGAATGCCGTCGAGCGGGCGAATGCCGAGCCAACCGCTGAGGTTTTGCAGCCGGACAAT
GGTCTTCTGGAATCAGGAAATGCCAGCAACGCTCTACCAGCTTCCACGGACAGCCCATCAGAGTCCCCCGTGATG
CCGCCCGACGAGGCCGGACAACCAGCTGATATCGCCGCGCCTACAGCCGAACAGCTCCAGGCCGACAGGGTGCTC
GCTCTCATCAAGGCAGAAGATTTCTCGTCTGCCGAACGCACCATCAAGACCGAACTGACGCAAAAGCGCTTGGCC
GGTGGTGTCGAGCATCTTGTCGCTCACTTCATCCGCAAACGAAAATGGCTGGAGCTCCTGAAAGTCTGGAAGGAC
TATTCCGAGTATCTCGGTGGAAAAGCAGATGTCGAGAGCTATCGATGGCCGCAGGCTGAGGACGTTCCTGATCTC
GGCGAGTCGTACCTCTTATTCGAACATTACGTCGAGACGGAGGGTGCCGCCGAGGCGAAGACACTCAAGGCCGAC
GTCTTGTTAACTCTTCGGAGGCAGCTAGCAGAGTTGTCTCTGAGCCAGGGCTGCCCTCCACTGTTCGCCGCCGTC
ATACTGGAGATATGGAAGGACGAGAACCTCTACGAACGCTATCTGCTCCTCATGCTCGACAAGTGGTTCCAGAGG
CAGGTGACGAGAAACGCGCTGACAAGACTCAACGACATATACAGAAACTACAGAGTCTTGCCCAAGGCGAAGCCC
TCGCCCGCCCTGCTGCATGCCATGTTCCGATTCTGCTCGAATTCAAAGGAAGACGTGAACCATTTCGTGGCGGAT
GACATCTATCGAGACTGGTACAAGACCTGGGGTGGTCTTGACGCGGAAGCCTTCCTAGGGTTCCTCGACCTGTAC
GGCGAGGCCGGAGACATCGTGTCGGTCCGCAAACTGTGGACTCGCTACACGACCCGCTTCCCTGAGGCTCTCCAG
GTGTCGAGGACGTTCCGGAGCCTCGTGGTAGCGTACGCGCAGAGGGCCGAACCCGAAAAGGCCGAGCGGGAGGTG
CGAATTATGCAGGAGACTTATGGCGTTCAGCCTGACACGGAGATATGGAACGCGGTGCTCAAGGGCTACATGAGG
ATGGAGAATGCAGAGGTGATGCGGCACTGCTTGAGCATCATCCACGCGACTGAAGGCCCCAACGACTCGACATAC
GCCATCTTCATGTCACTCGCCGCCAAGAGAGGCGACCTCGATGCAGCGACCAAGATTGCGAGCCAGGCGCAGACA
AGCGGGATACCGGTGACGGCCCCCATGATACGCCGACTCGTGACGACGTACTGCCAGAACGACCGGTTGCTGGCG
GCAGAGCGCATCTGTCAGGAGGCTTCTCAGCGAGGATTGATTGACGTCGAGATGTGGAACCAAGTCCTGAAATTC
AACGGCATCAAGGGCAAGCTGGACAAGTGCAACGAGCTGCTACGGGTCATGGACGACATTGGAATCGAATGGGAT
GAGCATACGTACCTGCAGCTTCTCAACTCCATGATCAAGGTCCACAAGGTTCTGCCCGCCTGGTCGCTGTTGAAG
AAGGCCGTCGAGGAGAGGCTCTTTCATGTGACGGACCAGCACTTTGAAGCCGTCATGAACGGTGCCAGTCGGGCC
AAGTTCCACGACCTGGTCGTCTCCATCGCCTCGCACATGCTACAGGCACGTCCGGGACCCCTTTCGTTCAACGCG
CTGGCGGTTCTGGCAGCATCGTCGTTGGCCAAGGCGCCGTCAGCAGGTCGACCTCGGGAGATAAGCCAGGAGTTG
CTGCCAGCGCTGTTGGAGCTGATGCCGTCCGATGAAGTCGCAAAAGAGAAGGAAACCGAAGAACAAGAAGACGAG
TCAAAGCCGCCGGAATGCCGGTTCGGAAGCATGCCCCTGCTCCGGAGGAAGACGTCTCAGATAGACCGGGCCGTC
AAGGTGCTGGTCGATCTCCGCGACTTCAAGGGGGCCGAGCAGCTGATCAACACGTACATCAACATCTTCCCCCAG
TTCTGGGACGCCAGGACGCTGCCGCCCAAGCTGGCGGGCGCCGTCATGGCCGGCTACCTCATCGAGGGGAAGCAC
AACAGGGCGCTCTCCATCTGGGACAAGGCGTGGAAGGCGGGCATGGCTCGTTGCAGAGACAGCAAGGGAGCCGTC
TACCCTGCCCTTCGCTGGCACCTCACCATGCCCATCCACCAGGTCATCCACGTGCTGCGCGACAAGGAGGACCCC
GACGGCATCGTCAAGGTGGTGGAGGAGGCGCTGGCCGTGGGCTTCTGCCTCAGTCGCAACACGTGGAACCTCGTC
ATCTGGGCCATGGCCAAGCTGGGCCGCTGGGAGAGGGCAATGGGCTGGTGCGAGACGATGCTGATGCCCGGCTGG
CGAGGATGGAAGAACGAGGTCTCTCCGGCGAAGATGCGCGTCCTCCAGGCAGACAACCACCTCCTCGCGCCCGTC
AAATCCACCGTCTTCAGCCTCCAGGAAGAATGGCTCAAGATGCGCAAACTGTCCGCCTGGTCCGCCGACGTGTCC
AACCGCATCCGACAACTAGAGCGCAACCACCCTCTCCTCCACCACGCCTTCATCACCAACGACCCTGCCTTCCTC
CCCGCCGCCTGGACCATCCCCCGGACCCCCAGCTTCTCCCGCGCAATCAAGGACATGCTCCGCTCGCTGACCTAC
CGCGAGCTCAAGGCCATCAAGACAGCCCTCATCCGGCAACTCCACCTCCTGGGCCTCCGCTACGACCCGGTCGCC
GAGCGCGCCCGCCACTACCACCGCAAGAGACACCAGCGGAAGAAGAAGAATGTGGTTGAGAGTCCGTTTCATGTT
GTGGTTGGCGGGGTGGGTGAGGATGGCCATGTGCAGACCAAGGAGTTTTCGGCGGGGGAGCTCGAGGTTTTGGAT
GTCGAGTTGAAGAAGACGATGGACAAGATGAGGGATTCGGCTGCTGAGGCTTCGTCGTCTTCGTCGTTTTCTTCT
GCGGATGCTCCGGTTGGAGGTCCTTCTTCCCCGGTTGGGGGTCCTTCTTCTGCGACTGAGGAGACTGGTTCGCGG
GAGAGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail