Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7466
Gene name
LocationContig_943:791..2744
Strand-
Gene length (bp)1953
Transcript length (bp)1770
Coding sequence length (bp)1770
Protein length (aa) 590

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.4E-32 95 452
PF00083 Sugar_tr Sugar (and other) transporter 1.8E-09 107 287

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10084|MFS2_SCHPO Uncharacterized transporter mfs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs2 PE=3 SV=1 73 529 2.0E-76
sp|Q7Z9I0|YHA8_SCHPO Uncharacterized MFS-type transporter C409.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC409.08 PE=3 SV=1 44 524 7.0E-72
sp|O59700|YN43_SCHPO Uncharacterized transporter C36.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.03c PE=3 SV=1 61 524 2.0E-70
sp|O59738|YN22_SCHPO Uncharacterized transporter C530.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.02 PE=3 SV=1 33 529 9.0E-70
sp|O59814|YCT4_SCHPO Uncharacterized transporter C794.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.04c PE=3 SV=1 14 523 5.0E-69
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10084|MFS2_SCHPO Uncharacterized transporter mfs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs2 PE=3 SV=1 73 529 2.0E-76
sp|Q7Z9I0|YHA8_SCHPO Uncharacterized MFS-type transporter C409.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC409.08 PE=3 SV=1 44 524 7.0E-72
sp|O59700|YN43_SCHPO Uncharacterized transporter C36.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.03c PE=3 SV=1 61 524 2.0E-70
sp|O59738|YN22_SCHPO Uncharacterized transporter C530.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.02 PE=3 SV=1 33 529 9.0E-70
sp|O59814|YCT4_SCHPO Uncharacterized transporter C794.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.04c PE=3 SV=1 14 523 5.0E-69
sp|P38776|YHK8_YEAST Probable drug/proton antiporter YHK8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHK8 PE=1 SV=1 45 523 2.0E-68
sp|O74829|YN2F_SCHPO Uncharacterized MFS-type transporter C530.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.15c PE=1 SV=2 60 524 1.0E-67
sp|Q9Y7S4|YQO5_SCHPO Uncharacterized transporter C569.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC569.05c PE=3 SV=1 61 525 2.0E-67
sp|O59698|YN41_SCHPO Uncharacterized transporter C36.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.01c PE=1 SV=1 61 529 2.0E-67
sp|Q12256|TPO4_YEAST Polyamine transporter 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO4 PE=1 SV=1 46 537 2.0E-65
sp|O59699|YN42_SCHPO Uncharacterized transporter C36.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.02c PE=3 SV=1 60 525 3.0E-64
sp|Q07824|TPO1_YEAST Polyamine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO1 PE=1 SV=1 67 524 2.0E-59
sp|Q06451|TPO3_YEAST Polyamine transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO3 PE=1 SV=1 62 522 2.0E-58
sp|P53283|TPO2_YEAST Polyamine transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO2 PE=1 SV=1 65 522 4.0E-57
sp|O94528|CAF5_SCHPO Caffeine resistance protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=caf5 PE=3 SV=1 72 524 1.0E-55
sp|Q9P3V5|YI45_SCHPO Uncharacterized transporter C1348.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1348.05 PE=3 SV=1 75 520 6.0E-55
sp|O43081|YHS6_SCHPO Uncharacterized MFS-type transporter C947.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC947.06c PE=3 SV=1 66 529 7.0E-55
sp|Q10487|MFS1_SCHPO Transporter mfs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs1 PE=3 SV=1 75 524 1.0E-54
sp|Q9P3E8|YLZ2_SCHPO Uncharacterized transporter C750.02c/PB2B2.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC750.02c PE=3 SV=1 75 520 6.0E-54
sp|Q5ABU7|MDR1_CANAL Multidrug resistance protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MDR1 PE=1 SV=1 75 524 3.0E-53
sp|P28873|BMRP_CANAX Benomyl/methotrexate resistance protein OS=Candida albicans GN=MDR1 PE=3 SV=1 75 524 4.0E-53
sp|P38124|FLR1_YEAST Fluconazole resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLR1 PE=1 SV=1 67 528 9.0E-52
sp|P32071|CYHR_CANMA Cycloheximide resistance protein OS=Candida maltosa GN=CYHR PE=3 SV=1 75 524 1.0E-49
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 73 526 2.0E-49
sp|Q9HDX4|MFC1_SCHPO Uncharacterized transporter mfc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfc1 PE=3 SV=2 75 522 6.0E-41
sp|O59833|YCUD_SCHPO Uncharacterized transporter C965.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC965.13 PE=3 SV=1 4 532 3.0E-34
sp|P33532|BSU1_SCHPO Vitamin B6 transporter bsu1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bsu1 PE=3 SV=2 78 525 9.0E-26
sp|O74899|YQEH_SCHPO Uncharacterized transporter C576.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC576.17c PE=1 SV=1 78 528 2.0E-21
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 75 274 2.0E-15
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 75 278 3.0E-11
sp|P39886|TCMA_STRGA Tetracenomycin C resistance and export protein OS=Streptomyces glaucescens GN=tcmA PE=3 SV=1 68 263 2.0E-10
sp|P38125|DTR1_YEAST Dityrosine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DTR1 PE=1 SV=1 113 473 5.0E-10
sp|P53389|HOL1_YEAST Protein HOL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOL1 PE=1 SV=1 77 267 1.0E-09
sp|P28246|BCR_ECOLI Bicyclomycin resistance protein OS=Escherichia coli (strain K12) GN=bcr PE=1 SV=4 108 294 1.0E-09
sp|P96709|YDGK_BACSU Uncharacterized MFS-type transporter YdgK OS=Bacillus subtilis (strain 168) GN=ydgK PE=3 SV=1 108 253 3.0E-09
sp|P54585|YHCA_BACSU Uncharacterized MFS-type transporter YhcA OS=Bacillus subtilis (strain 168) GN=yhcA PE=3 SV=2 99 259 1.0E-08
sp|O94343|YHMA_SCHPO Uncharacterized MFS-type transporter C1271.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.10c PE=1 SV=1 64 549 1.0E-08
sp|Q6NMN6|SPNS1_ARATH Probable sphingolipid transporter spinster homolog 1 OS=Arabidopsis thaliana GN=At5g65687 PE=1 SV=1 110 353 2.0E-08
sp|P9WG89|EMRB_MYCTU Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=emrB PE=3 SV=1 93 259 5.0E-08
sp|P9WG88|EMRB_MYCTO Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=emrB PE=3 SV=1 93 259 7.0E-08
sp|P45123|BCR_HAEIN Bicyclomycin resistance protein homolog OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=bcr PE=3 SV=1 115 267 2.0E-07
sp|A4WCC3|MDTD_ENT38 Putative multidrug resistance protein MdtD OS=Enterobacter sp. (strain 638) GN=mdtD PE=3 SV=1 75 258 2.0E-07
sp|Q43975|PCAK_ACIAD 4-hydroxybenzoate transporter PcaK OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=pcaK PE=1 SV=3 83 275 6.0E-07
sp|A8GHR1|MDTD_SERP5 Putative multidrug resistance protein MdtD OS=Serratia proteamaculans (strain 568) GN=mdtD PE=3 SV=1 81 261 1.0E-06
sp|O34307|YVMA_BACSU Uncharacterized MFS-type transporter YvmA OS=Bacillus subtilis (strain 168) GN=yvmA PE=3 SV=1 94 380 1.0E-06
sp|O32182|YUSP_BACSU Uncharacterized MFS-type transporter YusP OS=Bacillus subtilis (strain 168) GN=yusP PE=3 SV=1 87 260 1.0E-06
sp|A6TBH6|MDTD_KLEP7 Putative multidrug resistance protein MdtD OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=mdtD PE=3 SV=1 75 261 3.0E-06
sp|B5XPB7|MDTD_KLEP3 Putative multidrug resistance protein MdtD OS=Klebsiella pneumoniae (strain 342) GN=mdtD PE=3 SV=1 75 261 4.0E-06
sp|Q6D2A9|MDTD_PECAS Putative multidrug resistance protein MdtD OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=mdtD PE=3 SV=1 89 255 4.0E-06
sp|Q8Z5F5|MDTD_SALTI Putative multidrug resistance protein MdtD OS=Salmonella typhi GN=mdtD PE=3 SV=1 77 261 5.0E-06
sp|A9N7L0|MDTD_SALPB Putative multidrug resistance protein MdtD OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=mdtD PE=3 SV=1 77 255 5.0E-06
sp|B4T9U3|MDTD_SALHS Putative multidrug resistance protein MdtD OS=Salmonella heidelberg (strain SL476) GN=mdtD PE=3 SV=1 77 255 5.0E-06
sp|P32482|CMLA_PSEAI Chloramphenicol resistance protein OS=Pseudomonas aeruginosa GN=cmlA PE=3 SV=2 100 243 7.0E-06
sp|B4TNI8|MDTD_SALSV Putative multidrug resistance protein MdtD OS=Salmonella schwarzengrund (strain CVM19633) GN=mdtD PE=3 SV=1 77 261 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0006810 transport No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

Domain # Start End Length
1 125 145 20
2 155 174 19
3 181 203 22
4 218 240 22
5 247 269 22
6 322 344 22
7 351 373 22
8 427 449 22
9 456 478 22
10 493 515 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7466
MSGHGAREPQSPGRATEGPGPSPWSAGELSTCATVRTIVTSGTVADKASSSAPTYATDLLVSGPPDFEVDLEPGD
VENPRSWPLWYRCWCVSVVSLSTWVATLYSTSYSASGPGLAAEFGASKTLVTLGMTTYLLGLAVGSLVVAPMSEL
YGRRVVYLVCLVAWAVFIIPCGLARSLAAIIVVRFVGACFGAVMISNAPATVVDISHPDYLARTMSLFAIAPFNG
PATGPIIGGFVYQYLGWRWADWIVLIMGAVCILLMLTVKETYAPTILRRKVARLQAQTGDARWWCRYDQQTTATF
DRLRTNLGRPFVLFATEPILWFMNFWLSIVYGILYLCFVAYPVVFSEYRRWGPGVCGLSFTGIAVGILAAIVPEP
LFRRLILAQPRDPSTGRVPPEAQALIMVLGAVSTSVGQLGFAWTCLPETIHWAVPIGFGVPFGFGNTLSFIYGSN
YLAGTYGIYAASALAGNAVIRSVFGGTLPLAGPSLYGTLTPRWAGTLLGLFQVMSIPIPLVFWRYGARIRAKSRV
VRQLLEEEDRLEASKKREEGRRGKGTSSGGSDSTLGLMRDAKSMEARIEMKTGLAKFSGEEGTG*
Coding >Ophun1|7466
ATGTCCGGCCACGGCGCCCGGGAACCGCAGAGCCCTGGCCGCGCCACCGAGGGGCCGGGTCCGTCGCCGTGGTCC
GCCGGCGAGCTCTCGACCTGTGCCACCGTCCGCACCATCGTCACGTCCGGCACCGTGGCCGACAAGGCCAGCTCC
TCGGCCCCGACCTACGCCACCGACCTTCTCGTCTCGGGGCCTCCTGATTTCGAGGTCGACTTGGAGCCGGGAGAT
GTCGAGAACCCCCGGAGCTGGCCGCTATGGTATCGCTGCTGGTGCGTCTCGGTCGTCTCCCTGTCGACCTGGGTC
GCGACGCTCTATAGCACGAGTTACAGCGCATCGGGCCCTGGTCTCGCCGCCGAGTTCGGCGCGTCAAAGACTCTG
GTGACGCTCGGCATGACGACCTACCTGCTCGGCCTGGCCGTCGGCAGCCTCGTCGTGGCTCCCATGAGCGAGCTA
TACGGCCGCCGAGTCGTCTATCTCGTCTGCCTTGTCGCCTGGGCCGTCTTCATCATTCCCTGCGGTCTCGCCCGG
TCGCTGGCTGCCATCATCGTCGTCCGCTTCGTCGGAGCCTGCTTTGGCGCCGTCATGATCTCCAACGCCCCCGCG
ACCGTCGTCGACATCTCGCACCCGGACTACCTCGCCAGGACCATGTCGCTCTTCGCCATCGCCCCTTTCAACGGC
CCCGCCACGGGCCCCATCATCGGCGGCTTCGTCTATCAGTATCTGGGATGGCGATGGGCCGACTGGATCGTCCTC
ATCATGGGCGCCGTCTGCATCTTGCTCATGCTCACCGTCAAGGAGACGTACGCGCCAACCATCTTGAGGCGCAAG
GTGGCACGTCTTCAGGCGCAGACGGGCGACGCCAGGTGGTGGTGTCGCTACGACCAGCAGACGACGGCTACCTTT
GACCGGCTCAGGACGAATCTTGGCCGGCCCTTTGTACTGTTTGCGACTGAGCCGATTCTGTGGTTCATGAACTTT
TGGCTCTCCATCGTCTACGGCATCCTCTACCTCTGCTTCGTCGCCTACCCCGTCGTCTTTTCCGAGTATCGCAGG
TGGGGCCCGGGCGTCTGCGGTCTGTCGTTTACCGGCATCGCCGTCGGAATCCTGGCCGCCATCGTGCCGGAGCCC
CTATTCCGCCGCCTCATCCTGGCGCAGCCCCGCGATCCCTCCACGGGCCGGGTACCGCCGGAAGCGCAGGCCCTC
ATCATGGTCCTGGGCGCCGTGTCGACGAGCGTGGGCCAGCTCGGCTTCGCCTGGACCTGCCTGCCCGAGACGATC
CACTGGGCCGTCCCCATCGGCTTCGGCGTCCCCTTCGGCTTCGGCAATACCCTCAGCTTCATCTACGGGTCCAAC
TACCTCGCAGGCACGTATGGCATCTACGCCGCCAGCGCGCTCGCCGGAAACGCCGTCATCCGGAGCGTCTTTGGC
GGCACACTCCCCCTCGCCGGTCCCAGCCTGTACGGGACGCTGACACCGCGCTGGGCGGGCACGCTCCTAGGCCTG
TTCCAGGTCATGAGCATCCCCATCCCCTTGGTCTTCTGGCGATACGGTGCCAGGATCCGCGCCAAGAGCAGGGTG
GTCCGTCAGCTCCTCGAGGAGGAGGACCGGCTGGAGGCGAGCAAGAAGAGGGAGGAGGGGAGACGCGGGAAGGGC
ACCTCGTCTGGCGGGAGCGACTCGACACTGGGACTAATGCGAGACGCCAAGTCGATGGAGGCGCGGATAGAGATG
AAGACGGGTTTGGCCAAGTTCTCCGGTGAGGAGGGCACTGGCTAG
Transcript >Ophun1|7466
ATGTCCGGCCACGGCGCCCGGGAACCGCAGAGCCCTGGCCGCGCCACCGAGGGGCCGGGTCCGTCGCCGTGGTCC
GCCGGCGAGCTCTCGACCTGTGCCACCGTCCGCACCATCGTCACGTCCGGCACCGTGGCCGACAAGGCCAGCTCC
TCGGCCCCGACCTACGCCACCGACCTTCTCGTCTCGGGGCCTCCTGATTTCGAGGTCGACTTGGAGCCGGGAGAT
GTCGAGAACCCCCGGAGCTGGCCGCTATGGTATCGCTGCTGGTGCGTCTCGGTCGTCTCCCTGTCGACCTGGGTC
GCGACGCTCTATAGCACGAGTTACAGCGCATCGGGCCCTGGTCTCGCCGCCGAGTTCGGCGCGTCAAAGACTCTG
GTGACGCTCGGCATGACGACCTACCTGCTCGGCCTGGCCGTCGGCAGCCTCGTCGTGGCTCCCATGAGCGAGCTA
TACGGCCGCCGAGTCGTCTATCTCGTCTGCCTTGTCGCCTGGGCCGTCTTCATCATTCCCTGCGGTCTCGCCCGG
TCGCTGGCTGCCATCATCGTCGTCCGCTTCGTCGGAGCCTGCTTTGGCGCCGTCATGATCTCCAACGCCCCCGCG
ACCGTCGTCGACATCTCGCACCCGGACTACCTCGCCAGGACCATGTCGCTCTTCGCCATCGCCCCTTTCAACGGC
CCCGCCACGGGCCCCATCATCGGCGGCTTCGTCTATCAGTATCTGGGATGGCGATGGGCCGACTGGATCGTCCTC
ATCATGGGCGCCGTCTGCATCTTGCTCATGCTCACCGTCAAGGAGACGTACGCGCCAACCATCTTGAGGCGCAAG
GTGGCACGTCTTCAGGCGCAGACGGGCGACGCCAGGTGGTGGTGTCGCTACGACCAGCAGACGACGGCTACCTTT
GACCGGCTCAGGACGAATCTTGGCCGGCCCTTTGTACTGTTTGCGACTGAGCCGATTCTGTGGTTCATGAACTTT
TGGCTCTCCATCGTCTACGGCATCCTCTACCTCTGCTTCGTCGCCTACCCCGTCGTCTTTTCCGAGTATCGCAGG
TGGGGCCCGGGCGTCTGCGGTCTGTCGTTTACCGGCATCGCCGTCGGAATCCTGGCCGCCATCGTGCCGGAGCCC
CTATTCCGCCGCCTCATCCTGGCGCAGCCCCGCGATCCCTCCACGGGCCGGGTACCGCCGGAAGCGCAGGCCCTC
ATCATGGTCCTGGGCGCCGTGTCGACGAGCGTGGGCCAGCTCGGCTTCGCCTGGACCTGCCTGCCCGAGACGATC
CACTGGGCCGTCCCCATCGGCTTCGGCGTCCCCTTCGGCTTCGGCAATACCCTCAGCTTCATCTACGGGTCCAAC
TACCTCGCAGGCACGTATGGCATCTACGCCGCCAGCGCGCTCGCCGGAAACGCCGTCATCCGGAGCGTCTTTGGC
GGCACACTCCCCCTCGCCGGTCCCAGCCTGTACGGGACGCTGACACCGCGCTGGGCGGGCACGCTCCTAGGCCTG
TTCCAGGTCATGAGCATCCCCATCCCCTTGGTCTTCTGGCGATACGGTGCCAGGATCCGCGCCAAGAGCAGGGTG
GTCCGTCAGCTCCTCGAGGAGGAGGACCGGCTGGAGGCGAGCAAGAAGAGGGAGGAGGGGAGACGCGGGAAGGGC
ACCTCGTCTGGCGGGAGCGACTCGACACTGGGACTAATGCGAGACGCCAAGTCGATGGAGGCGCGGATAGAGATG
AAGACGGGTTTGGCCAAGTTCTCCGGTGAGGAGGGCACTGGCTAG
Gene >Ophun1|7466
ATGTCCGGCCACGGCGCCCGGGAACCGCAGAGCCCTGGCCGCGCCACCGAGGGGCCGGGTCCGTCGCCGTGGTCC
GCCGGCGAGCTCTCGACCTGTGCCACCGTCCGCACCATCGTCACGTCCGGCACCGTGGCCGACAAGGCCAGCTCC
TCGGCCCCGACCTACGCCACCGACCTTCTCGTCTCGGGGCCTCCTGATTTCGAGGTCGACTTGGAGCCGGGAGAT
GTCGAGAACCCCCGGAGCTGGCCGCTATGGTATCGCTGCTGGTGCGTCTCGGTCGTCTCCCTGTCGACCTGGGTC
GCGACGCTCTATAGCACGAGTTACAGCGCATCGGGCCCTGGTCTCGCCGCCGAGTTCGGCGCGTCAAAGACTCTG
GTGACGCTCGGCATGACGACCTACCTGCTCGGCCTGGCCGTCGGCAGCCTCGTCGTGGCTCCCATGAGCGAGCTA
TACGGCCGCCGAGTCGTCTATCTCGTCTGCCTTGTCGCCTGGGCCGTCTTCATCATTCCCTGCGGTCTCGCCCGG
TCGCTGGCTGCCATCATCGTCGTCCGCTTCGTCGGGTGCGTGCGTCCATGTGCTTTCCCGGCACTCAGAGTCCCG
CTTGCTGACCGTCGACGTCGCGCAGAGCCTGCTTTGGCGCCGTCATGATCTCCAACGCCCCCGCGACCGTCGTCG
ACATCTCGCACCCGGACTACCTCGCCAGGACCATGTCGCTCTTCGCCATCGCCCCTTTCAACGGCCCCGCCACGG
GCCCCATCATCGGCGGCTTCGTCTATCAGTATCTGGGATGGCGATGGGCCGACTGGATCGTCCTCATCATGGGCG
CCGTCTGCATCTTGCTCATGCTCACCGTCAAGGAGACGTACGCGCCAACCATCTTGAGGCGCAAGGTGGCACGTC
TTCAGGCGCAGACGGGCGACGCCAGGTGGTGGTGTCGCTACGACCAGCAGACGACGGCTACCTTTGACCGGCTCA
GGACGAATCTTGGCCGGCCCTTTGTACTGTTTGCGACTGAGCCGATTCTGTGGTTCATGAACTTTTGGTCAGTCC
CCTGTTTCCCTTTGGAGCCCGGCAACACAAGTGCCTTGCTCGTCCCGTTCCGAAGGGTGCGGAAGCAGACTGGCA
AAGGATCTCATCTCCTGACGGAACCCGACCTATAGGCTCTCCATCGTCTACGGCATCCTCTACCTCTGCTTCGTC
GCCTACCCCGTCGTCTTTTCCGAGTATCGCAGGTGGGGCCCGGGCGTCTGCGGTCTGTCGTTTACCGGCATCGCC
GTCGGAATCCTGGCCGCCATCGTGCCGGAGCCCCTATTCCGCCGCCTCATCCTGGCGCAGCCCCGCGATCCCTCC
ACGGGCCGGGTACCGCCGGAAGCGCAGGCCCTCATCATGGTCCTGGGCGCCGTGTCGACGAGCGTGGGCCAGCTC
GGCTTCGCCTGGACCTGCCTGCCCGAGACGATCCACTGGGCCGTCCCCATCGGCTTCGGCGTCCCCTTCGGCTTC
GGCAATACCCTCAGCTTCATCTACGGGTCCAACTACCTCGCAGGCACGTATGGCATCTACGCCGCCAGCGCGCTC
GCCGGAAACGCCGTCATCCGGAGCGTCTTTGGCGGCACACTCCCCCTCGCCGGTCCCAGCCTGTACGGGACGCTG
ACACCGCGCTGGGCGGGCACGCTCCTAGGCCTGTTCCAGGTCATGAGCATCCCCATCCCCTTGGTCTTCTGGCGA
TACGGTGCCAGGATCCGCGCCAAGAGCAGGGTGGTCCGTCAGCTCCTCGAGGAGGAGGACCGGCTGGAGGCGAGC
AAGAAGAGGGAGGAGGGGAGACGCGGGAAGGGCACCTCGTCTGGCGGGAGCGACTCGACACTGGGACTAATGCGA
GACGCCAAGTCGATGGAGGCGCGGATAGAGATGAAGACGGGTTTGGCCAAGTTCTCCGGTGAGGAGGGCACTGGC
TAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail