Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7464
Gene name
LocationContig_942:1889..2918
Strand-
Gene length (bp)1029
Transcript length (bp)912
Coding sequence length (bp)912
Protein length (aa) 304

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02104 SURF1 SURF1 family 3.5E-52 84 289

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y810|SHY1_SCHPO Cytochrome oxidase assembly protein shy1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=shy1 PE=3 SV=1 57 288 5.0E-51
sp|Q15526|SURF1_HUMAN Surfeit locus protein 1 OS=Homo sapiens GN=SURF1 PE=1 SV=1 5 288 2.0E-41
sp|P09925|SURF1_MOUSE Surfeit locus protein 1 OS=Mus musculus GN=Surf1 PE=1 SV=3 80 292 7.0E-41
sp|Q9QXU2|SURF1_RAT Surfeit locus protein 1 OS=Rattus norvegicus GN=Surf1 PE=2 SV=1 80 292 2.0E-39
sp|Q800L1|SURF1_CHICK Surfeit locus protein 1 OS=Gallus gallus GN=SURF1 PE=3 SV=1 81 288 5.0E-37
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y810|SHY1_SCHPO Cytochrome oxidase assembly protein shy1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=shy1 PE=3 SV=1 57 288 5.0E-51
sp|Q15526|SURF1_HUMAN Surfeit locus protein 1 OS=Homo sapiens GN=SURF1 PE=1 SV=1 5 288 2.0E-41
sp|P09925|SURF1_MOUSE Surfeit locus protein 1 OS=Mus musculus GN=Surf1 PE=1 SV=3 80 292 7.0E-41
sp|Q9QXU2|SURF1_RAT Surfeit locus protein 1 OS=Rattus norvegicus GN=Surf1 PE=2 SV=1 80 292 2.0E-39
sp|Q800L1|SURF1_CHICK Surfeit locus protein 1 OS=Gallus gallus GN=SURF1 PE=3 SV=1 81 288 5.0E-37
sp|A9UWF0|SURF1_MONBE SURF1-like protein OS=Monosiga brevicollis GN=18583 PE=3 SV=1 73 288 2.0E-35
sp|Q9U4F3|SURF1_DROME SURF1-like protein OS=Drosophila melanogaster GN=Surf1 PE=2 SV=1 64 288 5.0E-35
sp|O57593|SURF1_TAKRU Surfeit locus protein 1 (Fragment) OS=Takifugu rubripes GN=surf1 PE=3 SV=1 80 292 1.0E-34
sp|A8Y2C9|SURF1_CAEBR SURF1-like protein OS=Caenorhabditis briggsae GN=sft-1 PE=3 SV=1 77 295 6.0E-33
sp|A4IHH4|SURF1_XENTR Surfeit locus protein 1 OS=Xenopus tropicalis GN=surf1 PE=2 SV=1 80 288 1.0E-32
sp|Q9N5N8|SURF1_CAEEL SURF1-like protein OS=Caenorhabditis elegans GN=sft-1 PE=3 SV=1 77 295 4.0E-31
sp|P53266|SHY1_YEAST Cytochrome oxidase assembly protein SHY1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SHY1 PE=1 SV=1 77 282 3.0E-30
sp|Q556J9|SURF1_DICDI SURF1-like protein OS=Dictyostelium discoideum GN=surf1-1 PE=3 SV=2 71 295 4.0E-29
sp|Q9SE51|SURF1_ARATH Surfeit locus protein 1 OS=Arabidopsis thaliana GN=SURF1 PE=2 SV=1 22 288 3.0E-12
sp|Q1RJM4|SURF1_RICBR SURF1-like protein OS=Rickettsia bellii (strain RML369-C) GN=RBE_0359 PE=3 SV=1 86 295 1.0E-09
sp|Q92GL0|SURF1_RICCN SURF1-like protein OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=RC1113 PE=3 SV=1 80 288 3.0E-08
sp|Q4UN32|SURF1_RICFE SURF1-like protein OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0175 PE=3 SV=1 80 288 5.0E-08
sp|P66884|Y2259_MYCBO Uncharacterized SURF1-like protein Mb2259 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb2259 PE=3 SV=1 65 243 7.0E-07
sp|P9WGA7|Y2235_MYCTU Uncharacterized SURF1-like protein Rv2235 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2235 PE=1 SV=1 65 243 7.0E-07
sp|P9WGA6|Y2235_MYCTO Uncharacterized SURF1-like protein MT2294 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2294 PE=3 SV=1 65 243 7.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

Domain # Start End Length
1 75 97 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7464
MTKMLRRVSLLRISPSPPIRPSTTLHFSPSPLPARSPSHPFTTTSARQRQPADDPTFVSILDGPPRIARIKRKHG
PGLIFLALIPITAFALGTWQVQRLRWKSDLIAKLEDRLIRDPLPLPPHVDPSALDDFDYRRVVASGYFRHDQEML
IGPRIRDGQDGFLAVTPLERVDASTVLVNRGWISKKFAHQASRPDSLPTHLVTVEGLLRKPWKKNMFTPDNKPEK
GQFYFPDVEQMAALTDSQPVWIESTTEPEFMTLLDLESRGIPIGRPPEVNLRNNHAQYIFTWYLALAPLLGNRYP
DKT*
Coding >Ophun1|7464
ATGACCAAGATGCTCCGCCGCGTGTCCCTCCTCAGAATCTCTCCATCTCCTCCAATCCGCCCCTCAACAACCCTC
CACTTCTCCCCATCTCCATTACCAGCCCGCTCCCCATCCCACCCCTTCACAACCACCTCTGCCCGCCAGAGACAA
CCAGCCGACGACCCAACCTTCGTCTCCATCCTCGACGGCCCCCCGAGAATAGCCCGCATCAAGCGCAAACACGGC
CCAGGCCTCATCTTCCTCGCCCTCATCCCAATCACCGCCTTCGCCCTCGGAACATGGCAGGTTCAACGCCTTCGC
TGGAAATCAGACCTCATCGCTAAGCTGGAGGATCGGCTCATTCGAGATCCCCTTCCCCTACCGCCGCATGTTGAC
CCGTCCGCTCTCGATGACTTCGACTACCGCCGCGTCGTTGCGTCGGGATATTTCCGTCATGATCAGGAGATGCTC
ATCGGGCCGCGGATTCGGGACGGTCAGGATGGCTTTCTCGCCGTCACGCCTCTTGAGAGGGTAGACGCCTCGACA
GTGTTGGTGAACCGCGGCTGGATCAGCAAGAAGTTTGCCCATCAGGCTTCCCGACCCGATTCGCTTCCGACCCAT
CTCGTCACCGTCGAAGGATTGCTGCGCAAGCCGTGGAAGAAGAACATGTTTACGCCCGATAACAAGCCCGAAAAG
GGCCAATTCTATTTCCCTGACGTTGAGCAAATGGCTGCCTTGACCGATAGCCAGCCTGTCTGGATCGAATCCACC
ACGGAGCCCGAGTTCATGACCTTATTAGACCTCGAGTCCCGCGGCATCCCCATCGGGCGGCCTCCCGAGGTCAAC
TTGAGAAACAACCACGCGCAGTACATCTTCACCTGGTACCTTGCCCTGGCCCCTCTACTGGGAAACCGATATCCT
GACAAGACTTAG
Transcript >Ophun1|7464
ATGACCAAGATGCTCCGCCGCGTGTCCCTCCTCAGAATCTCTCCATCTCCTCCAATCCGCCCCTCAACAACCCTC
CACTTCTCCCCATCTCCATTACCAGCCCGCTCCCCATCCCACCCCTTCACAACCACCTCTGCCCGCCAGAGACAA
CCAGCCGACGACCCAACCTTCGTCTCCATCCTCGACGGCCCCCCGAGAATAGCCCGCATCAAGCGCAAACACGGC
CCAGGCCTCATCTTCCTCGCCCTCATCCCAATCACCGCCTTCGCCCTCGGAACATGGCAGGTTCAACGCCTTCGC
TGGAAATCAGACCTCATCGCTAAGCTGGAGGATCGGCTCATTCGAGATCCCCTTCCCCTACCGCCGCATGTTGAC
CCGTCCGCTCTCGATGACTTCGACTACCGCCGCGTCGTTGCGTCGGGATATTTCCGTCATGATCAGGAGATGCTC
ATCGGGCCGCGGATTCGGGACGGTCAGGATGGCTTTCTCGCCGTCACGCCTCTTGAGAGGGTAGACGCCTCGACA
GTGTTGGTGAACCGCGGCTGGATCAGCAAGAAGTTTGCCCATCAGGCTTCCCGACCCGATTCGCTTCCGACCCAT
CTCGTCACCGTCGAAGGATTGCTGCGCAAGCCGTGGAAGAAGAACATGTTTACGCCCGATAACAAGCCCGAAAAG
GGCCAATTCTATTTCCCTGACGTTGAGCAAATGGCTGCCTTGACCGATAGCCAGCCTGTCTGGATCGAATCCACC
ACGGAGCCCGAGTTCATGACCTTATTAGACCTCGAGTCCCGCGGCATCCCCATCGGGCGGCCTCCCGAGGTCAAC
TTGAGAAACAACCACGCGCAGTACATCTTCACCTGGTACCTTGCCCTGGCCCCTCTACTGGGAAACCGATATCCT
GACAAGACTTAG
Gene >Ophun1|7464
ATGACCAAGATGCTCCGCCGCGTGTCCCTCCTCAGAATCTCTCCATCTCCTCCAATCCGCCCCTCAACAACCCTC
CACTTCTCCCCATCTCCATTACCAGCCCGCTCCCCATCCCACCCCTTCACAACCACCTCTGCCCGCCAGAGACAA
CCAGCCGACGACCCAACCTTCGTCTCCATCCTCGACGGCCCCCCGAGAATAGCCCGCATCAAGCGCAAACACGGC
CCAGGCCTCATCTTCCTCGGTACAGCCCAAGCCGAACATGACCAAGACGTTTCCTGATGCCCGCCTACAGCCCTC
ATCCCAATCACCGCCTTCGCCCTCGGAACATGGCAGGTTCAACGCCTTCGCTGGAAATCAGACCTCATCGCTAAG
CTGGAGGATCGGCTCATTCGAGATCCCCTTCCCCTACCGCCGCATGTTGACCCGTCCGCTCTCGATGACTTCGAC
TACCGCCGCGTCGTTGCGTCGGGATATTTCCGTCATGATCAGGAGATGCTCATCGGGCCGCGGATTCGGGACGGT
CAGGATGGCTTTCTCGCCGTCACGCCTCTTGAGAGGGTAGACGCCTCGACAGTGTTGGTGAACCGCGGCTGGATC
AGCAAGAAGTTTGCCCATCAGGCTTCCCGACCCGATTCGCTTCCGACCCATCTCGTCACCGTCGAAGGATTGCTG
CGCAAGCCGTGGAAGAAGAACATGTTTACGCCCGATAACAAGCCCGAAAAGGGCCAATTCTATTTCCCTGACGTT
GAGCAAATGGCTGCCTTGACCGATAGCCAGCCTGTCTGGATCGAATCCACCACGGGTATATCCTCCTCACTGCCC
CCCTCACCCCCTCCTCGGTCCTTCGTCCGACGCTAAATGACGACAGAGCCCGAGTTCATGACCTTATTAGACCTC
GAGTCCCGCGGCATCCCCATCGGGCGGCCTCCCGAGGTCAACTTGAGAAACAACCACGCGCAGTACATCTTCACC
TGGTACCTTGCCCTGGCCCCTCTACTGGGAAACCGATATCCTGACAAGACTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail