Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7463
Gene name
LocationContig_942:204..1782
Strand+
Gene length (bp)1578
Transcript length (bp)1473
Coding sequence length (bp)1473
Protein length (aa) 491

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold 2.6E-42 360 467
PF15630 CENP-S CENP-S protein 4.2E-09 372 439
PF00125 Histone Core histone H2A/H2B/H3/H4 2.1E-07 371 436

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9HGK9|YHLD_SCHPO Uncharacterized protein C800.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC800.13 PE=3 SV=1 334 458 6.0E-16
sp|F1NPG5|CENPT_CHICK Centromere protein T OS=Gallus gallus GN=CENPT PE=1 SV=2 365 466 1.0E-09
sp|Q96BT3|CENPT_HUMAN Centromere protein T OS=Homo sapiens GN=CENPT PE=1 SV=2 395 462 1.0E-07
sp|Q4R5U8|CENPT_MACFA Centromere protein T OS=Macaca fascicularis GN=CENPT PE=2 SV=1 395 462 1.0E-07
sp|Q561R1|CENPT_RAT Centromere protein T OS=Rattus norvegicus GN=Cenpt PE=1 SV=1 390 462 5.0E-07

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0071821 FANCM-MHF complex Yes
GO:0097159 organic cyclic compound binding No
GO:1901363 heterocyclic compound binding No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0003676 nucleic acid binding No
GO:0140513 nuclear protein-containing complex No
GO:0005488 binding No
GO:0032991 protein-containing complex No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1441
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3994
Ophiocordyceps australis map64 (Brazil) OphauB2|7458
Ophiocordyceps camponoti-floridani Ophcf2|06242
Ophiocordyceps camponoti-rufipedis Ophun1|7463 (this protein)
Ophiocordyceps kimflemingae Ophio5|3272
Ophiocordyceps subramaniannii Hirsu2|10966

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7463
MASATPARRALSADPPSAQTPRNVNSNAPTPHAAAARRALNQRRHALFTPGKVRRRSMEKREKTFDILRSLSRTL
APGSQPVPASSPLEDSSALVPDRTRLEDDDEEELPIDKPRLSLPLDDDDDDSDLPLPRSSGLEDENYTAQSIELP
RRALSEQPRLSMARVSDFFDQNSIYPIDEAGRQSDFFTGLLEDLQARPSAGDLTLDRIDADQGRRATLGRDSDFG
LQLPAGLDEQTTFLLSEPPTDHMGDASAIDRSLAEAANAMLTHNADLTSGLDHTQATTDGLDLTQATFDGMDLTQ
TAVDGPDLTQETFDAPDLTQATVDGPELAQEAGDDWDLTAPTKDQPSRPIRKRQKRISKHGAEYPPLPPSLVKKV
AQTVLHSSGLSNPRISADTLTALTQASDWFFEQLGDDLGAYAQHAKRKTIDESDVVTLMRRQRQIGPSVSLFALA
QKHLPRELLQDLRMPVPQPSKKRRRERNHDGEGEQDTEMA*
Coding >Ophun1|7463
ATGGCCTCCGCCACGCCCGCGCGACGAGCCCTCAGCGCTGACCCCCCCTCAGCCCAGACGCCCCGAAACGTCAAC
AGCAACGCCCCCACCCCCCACGCCGCTGCCGCCCGTCGCGCCCTGAACCAGCGCCGTCACGCCCTCTTCACCCCC
GGCAAGGTCCGCCGTCGCAGCATGGAGAAGCGCGAAAAGACGTTTGATATCCTGCGCTCCCTCAGCAGGACCTTG
GCCCCCGGTAGCCAGCCTGTACCCGCGTCTTCGCCCCTCGAAGATTCCTCTGCCTTGGTGCCTGATCGGACGCGC
CTCGAGGACGATGACGAAGAGGAGCTTCCTATCGATAAGCCTCGTCTGTCCCTTCCGCTCGATGACGACGACGAC
GACTCCGACCTGCCGCTGCCGCGCTCTTCCGGTCTCGAGGACGAAAATTACACGGCTCAGTCTATAGAGCTACCA
CGACGCGCTCTGAGCGAGCAGCCCAGGCTCTCCATGGCCAGAGTCAGCGACTTCTTCGACCAGAACAGCATCTAT
CCCATCGATGAGGCAGGCCGTCAATCCGATTTCTTCACCGGCCTGCTTGAAGACCTCCAGGCCCGTCCGTCCGCC
GGCGACCTGACCCTGGACCGCATCGATGCGGACCAGGGCCGGCGCGCGACTCTCGGCCGTGACAGTGACTTTGGC
TTGCAACTCCCAGCCGGCCTCGACGAGCAAACCACCTTTTTGCTCTCTGAACCGCCAACCGATCACATGGGAGAT
GCATCCGCCATCGACCGCTCTCTCGCCGAGGCTGCCAATGCCATGCTTACCCACAACGCCGACCTGACGAGCGGA
CTCGATCACACACAAGCGACTACCGATGGCCTCGACCTTACTCAGGCAACTTTCGATGGCATGGACCTCACTCAG
ACCGCTGTCGATGGCCCGGACCTTACGCAGGAAACCTTTGATGCCCCTGATCTTACACAGGCAACCGTTGATGGC
CCTGAACTCGCACAGGAAGCCGGCGATGACTGGGATCTGACGGCTCCAACCAAAGACCAGCCCTCCCGGCCTATT
CGTAAACGCCAGAAGCGCATCTCCAAGCACGGAGCCGAGTATCCGCCGCTACCGCCCTCGCTGGTCAAAAAAGTG
GCCCAAACAGTCCTTCACTCCTCCGGCCTCAGCAACCCCCGCATCTCGGCAGACACCTTGACGGCCCTGACGCAG
GCGTCCGACTGGTTCTTTGAGCAGCTCGGGGACGACTTGGGAGCCTACGCCCAACATGCCAAACGCAAGACGATC
GACGAGAGCGACGTCGTGACTCTGATGCGCCGGCAACGCCAAATCGGACCCAGCGTGTCCCTGTTCGCGCTTGCA
CAGAAGCACCTGCCACGAGAGCTGCTTCAAGATTTGAGGATGCCCGTGCCTCAACCGTCCAAAAAGCGCCGTCGC
GAGCGGAATCACGACGGTGAGGGCGAGCAAGACACCGAGATGGCCTGA
Transcript >Ophun1|7463
ATGGCCTCCGCCACGCCCGCGCGACGAGCCCTCAGCGCTGACCCCCCCTCAGCCCAGACGCCCCGAAACGTCAAC
AGCAACGCCCCCACCCCCCACGCCGCTGCCGCCCGTCGCGCCCTGAACCAGCGCCGTCACGCCCTCTTCACCCCC
GGCAAGGTCCGCCGTCGCAGCATGGAGAAGCGCGAAAAGACGTTTGATATCCTGCGCTCCCTCAGCAGGACCTTG
GCCCCCGGTAGCCAGCCTGTACCCGCGTCTTCGCCCCTCGAAGATTCCTCTGCCTTGGTGCCTGATCGGACGCGC
CTCGAGGACGATGACGAAGAGGAGCTTCCTATCGATAAGCCTCGTCTGTCCCTTCCGCTCGATGACGACGACGAC
GACTCCGACCTGCCGCTGCCGCGCTCTTCCGGTCTCGAGGACGAAAATTACACGGCTCAGTCTATAGAGCTACCA
CGACGCGCTCTGAGCGAGCAGCCCAGGCTCTCCATGGCCAGAGTCAGCGACTTCTTCGACCAGAACAGCATCTAT
CCCATCGATGAGGCAGGCCGTCAATCCGATTTCTTCACCGGCCTGCTTGAAGACCTCCAGGCCCGTCCGTCCGCC
GGCGACCTGACCCTGGACCGCATCGATGCGGACCAGGGCCGGCGCGCGACTCTCGGCCGTGACAGTGACTTTGGC
TTGCAACTCCCAGCCGGCCTCGACGAGCAAACCACCTTTTTGCTCTCTGAACCGCCAACCGATCACATGGGAGAT
GCATCCGCCATCGACCGCTCTCTCGCCGAGGCTGCCAATGCCATGCTTACCCACAACGCCGACCTGACGAGCGGA
CTCGATCACACACAAGCGACTACCGATGGCCTCGACCTTACTCAGGCAACTTTCGATGGCATGGACCTCACTCAG
ACCGCTGTCGATGGCCCGGACCTTACGCAGGAAACCTTTGATGCCCCTGATCTTACACAGGCAACCGTTGATGGC
CCTGAACTCGCACAGGAAGCCGGCGATGACTGGGATCTGACGGCTCCAACCAAAGACCAGCCCTCCCGGCCTATT
CGTAAACGCCAGAAGCGCATCTCCAAGCACGGAGCCGAGTATCCGCCGCTACCGCCCTCGCTGGTCAAAAAAGTG
GCCCAAACAGTCCTTCACTCCTCCGGCCTCAGCAACCCCCGCATCTCGGCAGACACCTTGACGGCCCTGACGCAG
GCGTCCGACTGGTTCTTTGAGCAGCTCGGGGACGACTTGGGAGCCTACGCCCAACATGCCAAACGCAAGACGATC
GACGAGAGCGACGTCGTGACTCTGATGCGCCGGCAACGCCAAATCGGACCCAGCGTGTCCCTGTTCGCGCTTGCA
CAGAAGCACCTGCCACGAGAGCTGCTTCAAGATTTGAGGATGCCCGTGCCTCAACCGTCCAAAAAGCGCCGTCGC
GAGCGGAATCACGACGGTGAGGGCGAGCAAGACACCGAGATGGCCTGA
Gene >Ophun1|7463
ATGGCCTCCGCCACGCCCGCGCGACGAGCCCTCAGCGCTGACCCCCCCTCAGCCCAGACGCCCCGAAACGTCAAC
AGCAACGCCCCCACCCCCCACGCCGCTGCCGCCCGTCGCGCCCTGAACCAGCGCCGTCACGCCCTCTTCACCCCC
GGCAAGGTCCGCCGTCGCAGCATGGAGAAGCGCGAAAAGACGTTTGATATCCTGCGCTCCCTCAGCAGGACCTTG
GCCCCCGGTAGCCAGCCTGTACCCGCGTCTTCGCCCCTCGAAGATTCCTCTGCCTTGGTGCCTGATCGGACGCGC
CTCGAGGACGATGACGAAGAGGAGCTTCCTATCGATAAGCCTCGTCTGTCCCTTCCGCTCGATGACGACGACGAC
GACTCCGACCTGCCGCTGCCGCGCTCTTCCGGTCTCGAGGACGAAAATTACACGGCTCAGTCTATAGAGCTACCA
CGACGCGCTCTGAGCGAGCAGCCCAGGCTCTCCATGGCCAGAGTCAGCGACTTCTTCGACCAGAACAGCATCTAT
CCCATCGATGAGGCAGGCCGTCAATCCGATTTCTTCACCGGCCTGCTTGAAGACCTCCAGGCCCGTCCGTCCGCC
GGCGACCTGACCCTGGACCGGTAGGCACGACGCTTATTACCAAGCCAATTCTCGACTGACGCATACGCAGCATCG
ATGCGGACCAGGGCCGGCGCGCGACTCTCGGCCGTGACAGTGACTTTGGCTTGCAACTCCCAGCCGGCCTCGACG
AGCAAACCACCTTTTTGCTCTCTGAACCGCCAACCGATCACATGGGAGATGCATCCGCCATCGACCGCTCTCTCG
CCGAGGCTGCCAATGCCATGCTTACCCACAACGCCGACCTGACGAGCGGACTCGATCACACACAAGCGACTACCG
ATGGCCTCGACCTTACTCAGGCAACTTTCGATGGCATGGACCTCACTCAGACCGCTGTCGATGGCCCGGACCTTA
CGCAGGAAACCTTTGATGCCCCTGATCTTACACAGGCAACCGTTGATGGCCCTGAACTCGCACAGGAAGCCGGCG
ATGACTGGGATCTGACGGCTCCAACCAAAGACCAGCCCTCCCGGCCTATTCGTAAACGCCAGAAGCGCATCTCCA
AGCACGGAGCCGAGTATCCGCCGCTACCGCCCTCGCTGGTCAAAAAAGTGGCCCAAACAGTCCTTCACTCCTCCG
GCCTCAGCAACCCCCGCATCTCGGCAGACACCTTGACGGCCCTGACGCAGGCGTCCGACTGGTTCTTTGAGCAGC
TCGGGGACGACTTGGGAGCCTACGCCCAACATGCCAAACGCAAGACGATCGACGAGAGCGACGTCGTGACTCTGA
TGCGCCGGTCAGTCTGCTCCGGGTCCTCCCGGCTGTCGTTGGGAGGCTAAAACATGTCACAGGCAACGCCAAATC
GGACCCAGCGTGTCCCTGTTCGCGCTTGCACAGAAGCACCTGCCACGAGAGCTGCTTCAAGATTTGAGGATGCCC
GTGCCTCAACCGTCCAAAAAGCGCCGTCGCGAGCGGAATCACGACGGTGAGGGCGAGCAAGACACCGAGATGGCC
TGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail