Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7459
Gene name
LocationContig_94:37792..38914
Strand-
Gene length (bp)1122
Transcript length (bp)1122
Coding sequence length (bp)1122
Protein length (aa) 374

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16035 Chalcone_2 Chalcone isomerase like 3.2E-71 154 354

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6BN19|AIM18_DEBHA Altered inheritance of mitochondria protein 18, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=AIM18 PE=3 SV=1 152 358 1.0E-24
sp|Q6CWH8|AIM18_KLULA Altered inheritance of mitochondria protein 18, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=AIM18 PE=3 SV=1 153 358 1.0E-22
sp|C5DRI2|AIM18_ZYGRC Altered inheritance of mitochondria protein 18, mitochondrial OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=AIM18 PE=3 SV=1 152 358 1.0E-22
sp|A7TPW4|AIM18_VANPO Altered inheritance of mitochondria protein 18, mitochondrial OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=AIM18 PE=3 SV=1 154 361 7.0E-22
sp|Q75DU9|AIM18_ASHGO Altered inheritance of mitochondria protein 18, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=AIM18 PE=3 SV=1 154 361 1.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6BN19|AIM18_DEBHA Altered inheritance of mitochondria protein 18, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=AIM18 PE=3 SV=1 152 358 1.0E-24
sp|Q6CWH8|AIM18_KLULA Altered inheritance of mitochondria protein 18, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=AIM18 PE=3 SV=1 153 358 1.0E-22
sp|C5DRI2|AIM18_ZYGRC Altered inheritance of mitochondria protein 18, mitochondrial OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=AIM18 PE=3 SV=1 152 358 1.0E-22
sp|A7TPW4|AIM18_VANPO Altered inheritance of mitochondria protein 18, mitochondrial OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=AIM18 PE=3 SV=1 154 361 7.0E-22
sp|Q75DU9|AIM18_ASHGO Altered inheritance of mitochondria protein 18, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=AIM18 PE=3 SV=1 154 361 1.0E-20
sp|C5DFS5|AIM18_LACTC Altered inheritance of mitochondria protein 18, mitochondrial OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=AIM18 PE=3 SV=1 159 361 6.0E-17
sp|B5VKC6|AIM18_YEAS6 Altered inheritance of mitochondria protein 18, mitochondrial OS=Saccharomyces cerevisiae (strain AWRI1631) GN=AIM18 PE=3 SV=1 119 361 4.0E-16
sp|C8Z9Z8|AIM18_YEAS8 Altered inheritance of mitochondria protein 18, mitochondrial OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=AIM18 PE=3 SV=1 119 361 6.0E-16
sp|B3LSV8|AIM18_YEAS1 Altered inheritance of mitochondria protein 18, mitochondrial OS=Saccharomyces cerevisiae (strain RM11-1a) GN=AIM18 PE=3 SV=1 119 361 6.0E-16
sp|P38884|AIM18_YEAST Altered inheritance of mitochondria protein 18, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AIM18 PE=1 SV=1 119 361 6.0E-16
sp|A6ZTA4|AIM18_YEAS7 Altered inheritance of mitochondria protein 18, mitochondrial OS=Saccharomyces cerevisiae (strain YJM789) GN=AIM18 PE=3 SV=1 119 361 6.0E-16
sp|C7GRM0|AIM18_YEAS2 Altered inheritance of mitochondria protein 18, mitochondrial OS=Saccharomyces cerevisiae (strain JAY291) GN=AIM18 PE=3 SV=1 119 361 7.0E-16
sp|Q10102|YAQ1_SCHPO Uncharacterized protein C18G6.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC18G6.01c PE=4 SV=1 157 360 8.0E-14
sp|C7GRM1|AIM46_YEAS2 Altered inheritance of mitochondria protein 46, mitochondrial OS=Saccharomyces cerevisiae (strain JAY291) GN=AIM46 PE=3 SV=1 155 360 3.0E-07
sp|P38885|AIM46_YEAST Altered inheritance of mitochondria protein 46, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AIM46 PE=1 SV=1 155 360 4.0E-07
sp|C8Z9Z9|AIM46_YEAS8 Altered inheritance of mitochondria protein 46, mitochondrial OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=AIM46 PE=3 SV=1 155 360 4.0E-07
sp|B5VKC8|AIM46_YEAS6 Altered inheritance of mitochondria protein 46, mitochondrial OS=Saccharomyces cerevisiae (strain AWRI1631) GN=AIM46 PE=3 SV=1 155 360 4.0E-07
sp|B3LSV9|AIM46_YEAS1 Altered inheritance of mitochondria protein 46, mitochondrial OS=Saccharomyces cerevisiae (strain RM11-1a) GN=AIM46 PE=3 SV=1 155 360 4.0E-07
sp|A6ZTA5|AIM46_YEAS7 Altered inheritance of mitochondria protein 46, mitochondrial OS=Saccharomyces cerevisiae (strain YJM789) GN=AIM46 PE=3 SV=1 155 360 4.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0016872 intramolecular lyase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0016853 isomerase activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2423
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1560
Ophiocordyceps australis map64 (Brazil) OphauB2|4794
Ophiocordyceps camponoti-floridani Ophcf2|05276
Ophiocordyceps camponoti-rufipedis Ophun1|7459 (this protein)
Ophiocordyceps kimflemingae Ophio5|5585
Ophiocordyceps subramaniannii Hirsu2|3438

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7459
MPRLQPSLLSRPRTCLFPPLPCRRTFFDSQTGRATQQLNVQKLHSKRRDYEQHRTAFLAAGAAAGIISFVYTGWK
LKQTLDANKLRADSVPGETFKVEAGEKRKVVLIDELGREIVPTGDAVVPAFPRTLAVKMDGGQEDGRDGGLVVGA
DGVDFTLVGLGMRTVTFLGFRVYLVGFYVATQDVARLQKYLISKINPLATTLIPSEKEALRKALLDATEGEETWD
AVLREAGCRTAFRVMPVRDTDFHHLRDGFVRAVQTRSQRDSAFHDDEFGLAMERFRAMFNRGKMAKTQELLLIRG
AEGRLSVLHGDGGLDGGGRAVVGVVEDERLSRLLWLNYLAGKQVASEAARRNIIEGVMEFVARPVGSVAAQVV*
Coding >Ophun1|7459
ATGCCTCGACTCCAGCCCTCACTCCTCTCCCGACCGCGAACATGCCTCTTCCCCCCCCTCCCCTGCCGTCGAACC
TTCTTCGACAGCCAGACAGGGCGAGCGACGCAACAGCTCAACGTCCAGAAGCTACACTCGAAGCGACGCGACTAC
GAGCAGCACCGAACGGCCTTTCTCGCTGCGGGCGCGGCGGCGGGAATCATCTCCTTCGTCTACACGGGCTGGAAA
CTCAAGCAGACGCTCGACGCCAACAAGCTCCGGGCTGATTCCGTGCCGGGCGAGACGTTCAAGGTTGAGGCGGGG
GAGAAGCGCAAGGTGGTTCTCATCGATGAGCTGGGGAGGGAGATTGTGCCGACGGGGGATGCTGTTGTTCCGGCC
TTTCCGCGGACCCTGGCGGTGAAGATGGATGGGGGGCAGGAGGATGGGAGGGATGGTGGTTTGGTGGTGGGTGCG
GACGGGGTTGACTTTACGCTGGTTGGGTTGGGGATGCGGACGGTTACCTTTCTCGGGTTTCGCGTTTACCTCGTC
GGCTTTTACGTTGCTACGCAGGACGTTGCGCGATTGCAAAAGTATCTCATCAGCAAGATCAACCCGCTCGCCACG
ACGCTCATCCCCTCGGAGAAGGAGGCTCTTCGCAAGGCGCTGCTGGACGCTACCGAGGGAGAGGAGACGTGGGAT
GCGGTGCTGAGGGAGGCTGGATGTCGGACGGCCTTTCGCGTCATGCCCGTTCGCGACACCGACTTCCACCACCTG
CGCGATGGGTTCGTGCGGGCGGTGCAGACGCGGTCGCAGCGGGACTCGGCCTTTCACGACGACGAGTTTGGCCTC
GCGATGGAGAGGTTCAGGGCCATGTTCAACAGGGGGAAGATGGCGAAGACGCAGGAGCTCTTGCTGATTCGTGGG
GCGGAGGGGAGGCTTTCGGTCCTCCATGGGGATGGGGGGCTCGATGGGGGGGGGAGGGCGGTTGTGGGGGTGGTG
GAGGATGAGAGGCTTTCGCGGTTGCTTTGGTTGAATTACCTGGCTGGGAAGCAGGTTGCCTCTGAAGCGGCGAGG
CGGAATATTATCGAGGGGGTTATGGAGTTTGTGGCGAGGCCGGTTGGGAGTGTTGCTGCGCAGGTTGTGTGA
Transcript >Ophun1|7459
ATGCCTCGACTCCAGCCCTCACTCCTCTCCCGACCGCGAACATGCCTCTTCCCCCCCCTCCCCTGCCGTCGAACC
TTCTTCGACAGCCAGACAGGGCGAGCGACGCAACAGCTCAACGTCCAGAAGCTACACTCGAAGCGACGCGACTAC
GAGCAGCACCGAACGGCCTTTCTCGCTGCGGGCGCGGCGGCGGGAATCATCTCCTTCGTCTACACGGGCTGGAAA
CTCAAGCAGACGCTCGACGCCAACAAGCTCCGGGCTGATTCCGTGCCGGGCGAGACGTTCAAGGTTGAGGCGGGG
GAGAAGCGCAAGGTGGTTCTCATCGATGAGCTGGGGAGGGAGATTGTGCCGACGGGGGATGCTGTTGTTCCGGCC
TTTCCGCGGACCCTGGCGGTGAAGATGGATGGGGGGCAGGAGGATGGGAGGGATGGTGGTTTGGTGGTGGGTGCG
GACGGGGTTGACTTTACGCTGGTTGGGTTGGGGATGCGGACGGTTACCTTTCTCGGGTTTCGCGTTTACCTCGTC
GGCTTTTACGTTGCTACGCAGGACGTTGCGCGATTGCAAAAGTATCTCATCAGCAAGATCAACCCGCTCGCCACG
ACGCTCATCCCCTCGGAGAAGGAGGCTCTTCGCAAGGCGCTGCTGGACGCTACCGAGGGAGAGGAGACGTGGGAT
GCGGTGCTGAGGGAGGCTGGATGTCGGACGGCCTTTCGCGTCATGCCCGTTCGCGACACCGACTTCCACCACCTG
CGCGATGGGTTCGTGCGGGCGGTGCAGACGCGGTCGCAGCGGGACTCGGCCTTTCACGACGACGAGTTTGGCCTC
GCGATGGAGAGGTTCAGGGCCATGTTCAACAGGGGGAAGATGGCGAAGACGCAGGAGCTCTTGCTGATTCGTGGG
GCGGAGGGGAGGCTTTCGGTCCTCCATGGGGATGGGGGGCTCGATGGGGGGGGGAGGGCGGTTGTGGGGGTGGTG
GAGGATGAGAGGCTTTCGCGGTTGCTTTGGTTGAATTACCTGGCTGGGAAGCAGGTTGCCTCTGAAGCGGCGAGG
CGGAATATTATCGAGGGGGTTATGGAGTTTGTGGCGAGGCCGGTTGGGAGTGTTGCTGCGCAGGTTGTGTGA
Gene >Ophun1|7459
ATGCCTCGACTCCAGCCCTCACTCCTCTCCCGACCGCGAACATGCCTCTTCCCCCCCCTCCCCTGCCGTCGAACC
TTCTTCGACAGCCAGACAGGGCGAGCGACGCAACAGCTCAACGTCCAGAAGCTACACTCGAAGCGACGCGACTAC
GAGCAGCACCGAACGGCCTTTCTCGCTGCGGGCGCGGCGGCGGGAATCATCTCCTTCGTCTACACGGGCTGGAAA
CTCAAGCAGACGCTCGACGCCAACAAGCTCCGGGCTGATTCCGTGCCGGGCGAGACGTTCAAGGTTGAGGCGGGG
GAGAAGCGCAAGGTGGTTCTCATCGATGAGCTGGGGAGGGAGATTGTGCCGACGGGGGATGCTGTTGTTCCGGCC
TTTCCGCGGACCCTGGCGGTGAAGATGGATGGGGGGCAGGAGGATGGGAGGGATGGTGGTTTGGTGGTGGGTGCG
GACGGGGTTGACTTTACGCTGGTTGGGTTGGGGATGCGGACGGTTACCTTTCTCGGGTTTCGCGTTTACCTCGTC
GGCTTTTACGTTGCTACGCAGGACGTTGCGCGATTGCAAAAGTATCTCATCAGCAAGATCAACCCGCTCGCCACG
ACGCTCATCCCCTCGGAGAAGGAGGCTCTTCGCAAGGCGCTGCTGGACGCTACCGAGGGAGAGGAGACGTGGGAT
GCGGTGCTGAGGGAGGCTGGATGTCGGACGGCCTTTCGCGTCATGCCCGTTCGCGACACCGACTTCCACCACCTG
CGCGATGGGTTCGTGCGGGCGGTGCAGACGCGGTCGCAGCGGGACTCGGCCTTTCACGACGACGAGTTTGGCCTC
GCGATGGAGAGGTTCAGGGCCATGTTCAACAGGGGGAAGATGGCGAAGACGCAGGAGCTCTTGCTGATTCGTGGG
GCGGAGGGGAGGCTTTCGGTCCTCCATGGGGATGGGGGGCTCGATGGGGGGGGGAGGGCGGTTGTGGGGGTGGTG
GAGGATGAGAGGCTTTCGCGGTTGCTTTGGTTGAATTACCTGGCTGGGAAGCAGGTTGCCTCTGAAGCGGCGAGG
CGGAATATTATCGAGGGGGTTATGGAGTTTGTGGCGAGGCCGGTTGGGAGTGTTGCTGCGCAGGTTGTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail