Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7452
Gene name
LocationContig_94:23103..24968
Strand-
Gene length (bp)1865
Transcript length (bp)1815
Coding sequence length (bp)1815
Protein length (aa) 605

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00144 Beta-lactamase Beta-lactamase 8.7E-51 86 438
PF11954 DUF3471 Domain of unknown function (DUF3471) 1.0E-11 499 600

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P32959|PBPE_BACSU Penicillin-binding protein 4* OS=Bacillus subtilis (strain 168) GN=pbpE PE=1 SV=1 101 334 2.0E-16
sp|P0AD70|AMPH_ECOLI D-alanyl-D-alanine-carboxypeptidase/endopeptidase AmpH OS=Escherichia coli (strain K12) GN=ampH PE=1 SV=1 81 444 1.0E-12
sp|P0AD71|AMPH_ECO57 D-alanyl-D-alanine-carboxypeptidase/endopeptidase AmpH OS=Escherichia coli O157:H7 GN=ampH PE=3 SV=1 81 444 1.0E-12
sp|Q8NUZ4|FLP_STAAW Protein flp OS=Staphylococcus aureus (strain MW2) GN=flp PE=3 SV=1 98 432 4.0E-12
sp|Q6G6M9|FLP_STAAS Protein flp OS=Staphylococcus aureus (strain MSSA476) GN=flp PE=3 SV=1 98 432 6.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P32959|PBPE_BACSU Penicillin-binding protein 4* OS=Bacillus subtilis (strain 168) GN=pbpE PE=1 SV=1 101 334 2.0E-16
sp|P0AD70|AMPH_ECOLI D-alanyl-D-alanine-carboxypeptidase/endopeptidase AmpH OS=Escherichia coli (strain K12) GN=ampH PE=1 SV=1 81 444 1.0E-12
sp|P0AD71|AMPH_ECO57 D-alanyl-D-alanine-carboxypeptidase/endopeptidase AmpH OS=Escherichia coli O157:H7 GN=ampH PE=3 SV=1 81 444 1.0E-12
sp|Q8NUZ4|FLP_STAAW Protein flp OS=Staphylococcus aureus (strain MW2) GN=flp PE=3 SV=1 98 432 4.0E-12
sp|Q6G6M9|FLP_STAAS Protein flp OS=Staphylococcus aureus (strain MSSA476) GN=flp PE=3 SV=1 98 432 6.0E-12
sp|Q5HDB2|FLP_STAAC Protein flp OS=Staphylococcus aureus (strain COL) GN=flp PE=4 SV=1 98 432 9.0E-12
sp|P05364|AMPC_ENTCL Beta-lactamase OS=Enterobacter cloacae GN=ampC PE=1 SV=1 90 433 7.0E-10
sp|P24735|AMPC_PSEAE Beta-lactamase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=ampC PE=1 SV=2 88 432 7.0E-10
sp|P05193|AMPC_CITFR Beta-lactamase OS=Citrobacter freundii GN=ampC PE=1 SV=1 90 450 8.0E-10
sp|P85302|AMPC_PSEFL Beta-lactamase OS=Pseudomonas fluorescens GN=ampC PE=1 SV=1 90 432 9.0E-09
sp|P15555|DAC_STRSR D-alanyl-D-alanine carboxypeptidase OS=Streptomyces sp. (strain R61) PE=1 SV=2 134 336 1.0E-08
sp|O31773|PBPX_BACSU Putative penicillin-binding protein PbpX OS=Bacillus subtilis (strain 168) GN=pbpX PE=2 SV=1 81 335 1.0E-08
sp|Q06317|PBP4_AMYLA Penicillin-binding protein 4 OS=Amycolatopsis lactamdurans GN=pbp PE=3 SV=1 98 336 2.0E-08
sp|P94958|AMPC_MORMO Beta-lactamase OS=Morganella morganii GN=ampC PE=3 SV=1 90 432 4.0E-08
sp|A6WYS5|DAP_OCHA4 D-aminopeptidase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=dap PE=3 SV=1 100 455 5.0E-08
sp|P18539|AMPC_SERMA Beta-lactamase OS=Serratia marcescens GN=ampC PE=3 SV=1 85 448 1.0E-07
sp|P00811|AMPC_ECOLI Beta-lactamase OS=Escherichia coli (strain K12) GN=ampC PE=1 SV=1 70 432 2.0E-07
sp|Q9ZBA9|DAP_OCHAN D-aminopeptidase OS=Ochrobactrum anthropi GN=dap PE=1 SV=3 88 452 1.0E-06
sp|B5RCU8|YFEW_SALG2 UPF0214 protein YfeW OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=yfeW PE=3 SV=1 118 277 2.0E-06
sp|Q8FV99|DAP_BRUSU D-aminopeptidase OS=Brucella suis biovar 1 (strain 1330) GN=dap PE=3 SV=1 84 553 4.0E-06
sp|A9WVV8|DAP_BRUSI D-aminopeptidase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=dap PE=3 SV=1 84 553 4.0E-06
sp|A9MCM7|DAP_BRUC2 D-aminopeptidase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=dap PE=3 SV=1 84 553 4.0E-06
sp|Q579G4|DAP_BRUAB D-aminopeptidase OS=Brucella abortus biovar 1 (strain 9-941) GN=dap PE=3 SV=1 84 553 4.0E-06
sp|Q2YLB4|DAP_BRUA2 D-aminopeptidase OS=Brucella abortus (strain 2308) GN=dap PE=3 SV=1 84 553 4.0E-06
sp|B2SD81|DAP_BRUA1 D-aminopeptidase OS=Brucella abortus (strain S19) GN=dap PE=3 SV=1 84 553 4.0E-06
sp|Q8YD27|DAP_BRUME D-aminopeptidase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=dap PE=3 SV=1 84 553 4.0E-06
sp|C0RM93|DAP_BRUMB D-aminopeptidase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=dap PE=3 SV=1 84 553 4.0E-06
sp|A5VVL2|DAP_BRUO2 D-aminopeptidase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=dap PE=3 SV=1 84 553 4.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7452
MRRLRSALRRWPAMEPKPSGRSRWFTPDYPPGRGPVRHDVAVAWDCVTADDDDDGAIIQQGLSHSPGSRSFVQQP
SIMDIVRSPDFAAYVTRLMRICHVPGLAVAVAQGDEVVSAGFGKASLDPEVECTADTLFDMASASKSLTAASVAL
LIADEGHPHVQWKAKMEDLLPGDFVMPGSDHSDVTVEDILSHRTGMPSHDNSYHGCEADNPDDARSITRNLRNLA
VVAPNRSSYMYCNMMYTVASYLVERVSGLPFGDYLEERLLQPLGMKDTSLQPARARAKGLGDRIAKGYVWDEHAA
KYEETPCNEDAPEAQGAGCVQSSVNDYIKWVQAMMNRSGPISEDIYQGLVEKRIRQSDDDVPEEVVWEAEAEAEA
QGDAPSDEPPPLYYAVGWEVREYCKHTIVSHTGSEDGFRSNHFFVPELNFGGVIVGNSGGAADVVSEVTHRLIDE
AVKGPDAGRGLLDSSSDSGSDSGSSTGSDDEDEMDPGAQLRQQLCPGIKEAQPQTMPLSAYTGRYWNEGYREMVV
EERDGELAVDAMKRSMGFHLRLQHVSDQTMYLAYLRERFDREGQPLKAEFRLQGDRAVKMGLWLEEQMKDYVWFD
RIDD*
Coding >Ophun1|7452
ATGCGCCGGCTCCGGTCGGCTTTACGGCGCTGGCCGGCCATGGAGCCGAAGCCAAGCGGCCGATCGAGATGGTTC
ACGCCGGACTATCCACCGGGCCGCGGGCCTGTGAGGCATGACGTGGCTGTGGCTTGGGATTGTGTTACAGCTGAC
GATGATGATGACGGTGCCATTATCCAACAAGGCCTCTCCCACTCCCCCGGTTCTCGCAGCTTCGTCCAGCAGCCA
AGCATCATGGATATCGTCCGCTCTCCCGACTTCGCCGCGTACGTGACGCGCCTGATGAGGATCTGCCATGTGCCA
GGTCTAGCCGTGGCCGTGGCCCAGGGTGACGAAGTCGTCTCCGCCGGCTTCGGCAAGGCATCGCTGGACCCAGAA
GTGGAATGCACGGCCGACACGCTCTTCGACATGGCCTCGGCCTCCAAGTCGCTGACAGCCGCGTCGGTAGCGCTT
CTCATCGCCGACGAAGGACATCCGCACGTGCAGTGGAAGGCCAAGATGGAGGATCTTTTGCCGGGCGACTTTGTC
ATGCCTGGCAGCGACCACTCCGATGTCACGGTCGAGGACATCCTCAGCCACCGCACGGGCATGCCATCGCACGAC
AACTCTTATCATGGCTGCGAGGCCGACAATCCAGATGACGCGCGGTCCATCACTCGAAACCTTCGCAACCTGGCC
GTCGTAGCGCCTAACCGCAGCAGCTACATGTATTGCAACATGATGTATACCGTCGCCAGTTACCTGGTAGAGCGA
GTTAGCGGGCTCCCCTTTGGCGATTATCTCGAGGAGAGGCTTCTGCAGCCGCTGGGGATGAAGGACACTTCGCTG
CAGCCGGCACGCGCCCGCGCCAAGGGTCTGGGTGACCGCATCGCCAAGGGTTACGTCTGGGACGAACATGCGGCC
AAGTACGAGGAGACGCCGTGCAACGAAGACGCGCCCGAGGCGCAAGGAGCCGGATGCGTTCAGTCGAGCGTCAAC
GACTACATCAAGTGGGTGCAGGCCATGATGAACCGGTCCGGTCCCATTTCCGAAGACATCTATCAGGGGCTCGTC
GAGAAGCGCATCCGGCAGAGCGACGATGACGTGCCGGAAGAAGTCGTCTGGGAGGCCGAAGCCGAAGCCGAGGCC
CAAGGCGACGCCCCGTCCGACGAGCCGCCGCCGCTCTACTATGCTGTCGGCTGGGAGGTGCGTGAGTATTGCAAG
CACACCATCGTGTCGCACACCGGCTCCGAGGATGGCTTCCGTTCCAATCACTTCTTCGTGCCGGAGCTCAACTTT
GGCGGCGTCATCGTTGGCAATTCGGGCGGAGCCGCCGACGTCGTCAGCGAGGTGACGCACCGCCTGATCGACGAG
GCCGTCAAGGGCCCGGATGCCGGCAGGGGGCTCCTCGACTCATCGTCTGACTCGGGCTCTGATTCCGGTTCGTCA
ACGGGCTCCGACGACGAAGACGAGATGGATCCTGGCGCCCAGCTAAGGCAGCAGCTCTGCCCCGGCATCAAGGAA
GCTCAACCGCAGACGATGCCCCTGTCGGCTTACACGGGAAGGTACTGGAACGAGGGTTACCGCGAGATGGTGGTG
GAGGAGCGCGACGGCGAGCTAGCCGTGGATGCCATGAAGCGATCCATGGGCTTCCATCTGAGGCTCCAGCATGTC
AGCGACCAGACTATGTACCTGGCATACCTGAGAGAGCGCTTCGACAGGGAGGGCCAGCCCCTGAAAGCCGAGTTC
CGACTCCAAGGCGACAGGGCGGTCAAGATGGGCCTGTGGCTGGAGGAGCAGATGAAGGACTACGTCTGGTTCGAT
CGGATTGATGACTGA
Transcript >Ophun1|7452
ATGCGCCGGCTCCGGTCGGCTTTACGGCGCTGGCCGGCCATGGAGCCGAAGCCAAGCGGCCGATCGAGATGGTTC
ACGCCGGACTATCCACCGGGCCGCGGGCCTGTGAGGCATGACGTGGCTGTGGCTTGGGATTGTGTTACAGCTGAC
GATGATGATGACGGTGCCATTATCCAACAAGGCCTCTCCCACTCCCCCGGTTCTCGCAGCTTCGTCCAGCAGCCA
AGCATCATGGATATCGTCCGCTCTCCCGACTTCGCCGCGTACGTGACGCGCCTGATGAGGATCTGCCATGTGCCA
GGTCTAGCCGTGGCCGTGGCCCAGGGTGACGAAGTCGTCTCCGCCGGCTTCGGCAAGGCATCGCTGGACCCAGAA
GTGGAATGCACGGCCGACACGCTCTTCGACATGGCCTCGGCCTCCAAGTCGCTGACAGCCGCGTCGGTAGCGCTT
CTCATCGCCGACGAAGGACATCCGCACGTGCAGTGGAAGGCCAAGATGGAGGATCTTTTGCCGGGCGACTTTGTC
ATGCCTGGCAGCGACCACTCCGATGTCACGGTCGAGGACATCCTCAGCCACCGCACGGGCATGCCATCGCACGAC
AACTCTTATCATGGCTGCGAGGCCGACAATCCAGATGACGCGCGGTCCATCACTCGAAACCTTCGCAACCTGGCC
GTCGTAGCGCCTAACCGCAGCAGCTACATGTATTGCAACATGATGTATACCGTCGCCAGTTACCTGGTAGAGCGA
GTTAGCGGGCTCCCCTTTGGCGATTATCTCGAGGAGAGGCTTCTGCAGCCGCTGGGGATGAAGGACACTTCGCTG
CAGCCGGCACGCGCCCGCGCCAAGGGTCTGGGTGACCGCATCGCCAAGGGTTACGTCTGGGACGAACATGCGGCC
AAGTACGAGGAGACGCCGTGCAACGAAGACGCGCCCGAGGCGCAAGGAGCCGGATGCGTTCAGTCGAGCGTCAAC
GACTACATCAAGTGGGTGCAGGCCATGATGAACCGGTCCGGTCCCATTTCCGAAGACATCTATCAGGGGCTCGTC
GAGAAGCGCATCCGGCAGAGCGACGATGACGTGCCGGAAGAAGTCGTCTGGGAGGCCGAAGCCGAAGCCGAGGCC
CAAGGCGACGCCCCGTCCGACGAGCCGCCGCCGCTCTACTATGCTGTCGGCTGGGAGGTGCGTGAGTATTGCAAG
CACACCATCGTGTCGCACACCGGCTCCGAGGATGGCTTCCGTTCCAATCACTTCTTCGTGCCGGAGCTCAACTTT
GGCGGCGTCATCGTTGGCAATTCGGGCGGAGCCGCCGACGTCGTCAGCGAGGTGACGCACCGCCTGATCGACGAG
GCCGTCAAGGGCCCGGATGCCGGCAGGGGGCTCCTCGACTCATCGTCTGACTCGGGCTCTGATTCCGGTTCGTCA
ACGGGCTCCGACGACGAAGACGAGATGGATCCTGGCGCCCAGCTAAGGCAGCAGCTCTGCCCCGGCATCAAGGAA
GCTCAACCGCAGACGATGCCCCTGTCGGCTTACACGGGAAGGTACTGGAACGAGGGTTACCGCGAGATGGTGGTG
GAGGAGCGCGACGGCGAGCTAGCCGTGGATGCCATGAAGCGATCCATGGGCTTCCATCTGAGGCTCCAGCATGTC
AGCGACCAGACTATGTACCTGGCATACCTGAGAGAGCGCTTCGACAGGGAGGGCCAGCCCCTGAAAGCCGAGTTC
CGACTCCAAGGCGACAGGGCGGTCAAGATGGGCCTGTGGCTGGAGGAGCAGATGAAGGACTACGTCTGGTTCGAT
CGGATTGATGACTGA
Gene >Ophun1|7452
ATGCGCCGGCTCCGGTCGGCTTTACGGCGCTGGCCGGCCATGGAGCCGAAGCCAAGCGGCCGATCGAGATGGTTC
ACGCCGGACTATCCACCGGGCCGCGGGCCTGTGAGGCATGACGTGGCTGTGGCTTGGGATTGTGTTACAGCTGAC
GATGATGATGACGGTGCCATTATCCAACAAGGCCTCTCCCACTCCCCCGGTTCTCGCAGCTTCGTCCAGCAGCCA
AGCATCATGGATATCGTCCGCTCTCCCGACTTCGCCGCGTACGTGACGCGCCTGATGAGGATCTGCCATGTGCCA
GGTCTAGCCGTGGCCGTGGCCCAGGGTGACGAAGTCGTCTCCGCCGGCTTCGGCAAGGCATCGCTGGACCCAGAA
GTGGAATGCACGGCCGACACGCTCTTCGACATGGCCTCGGCCTCCAAGTCGCTGACAGCCGCGTCGGTAGCGCTT
CTCATCGCCGACGAAGGACATCCGCACGTGCAGTGGAAGGCCAAGATGGAGGATCTTTTGCCGGGCGACTTTGTC
ATGCCTGGCAGCGACCACTCCGATGTCACGGTCGAGGACATCCTCAGCCACCGCACGGGCATGCCATCGTGAGTC
TTGTCACGCTTGCGAGAGGGACCTGCGCAGCTGATATCTCAAGGCACGACAACTCTTATCATGGCTGCGAGGCCG
ACAATCCAGATGACGCGCGGTCCATCACTCGAAACCTTCGCAACCTGGCCGTCGTAGCGCCTAACCGCAGCAGCT
ACATGTATTGCAACATGATGTATACCGTCGCCAGTTACCTGGTAGAGCGAGTTAGCGGGCTCCCCTTTGGCGATT
ATCTCGAGGAGAGGCTTCTGCAGCCGCTGGGGATGAAGGACACTTCGCTGCAGCCGGCACGCGCCCGCGCCAAGG
GTCTGGGTGACCGCATCGCCAAGGGTTACGTCTGGGACGAACATGCGGCCAAGTACGAGGAGACGCCGTGCAACG
AAGACGCGCCCGAGGCGCAAGGAGCCGGATGCGTTCAGTCGAGCGTCAACGACTACATCAAGTGGGTGCAGGCCA
TGATGAACCGGTCCGGTCCCATTTCCGAAGACATCTATCAGGGGCTCGTCGAGAAGCGCATCCGGCAGAGCGACG
ATGACGTGCCGGAAGAAGTCGTCTGGGAGGCCGAAGCCGAAGCCGAGGCCCAAGGCGACGCCCCGTCCGACGAGC
CGCCGCCGCTCTACTATGCTGTCGGCTGGGAGGTGCGTGAGTATTGCAAGCACACCATCGTGTCGCACACCGGCT
CCGAGGATGGCTTCCGTTCCAATCACTTCTTCGTGCCGGAGCTCAACTTTGGCGGCGTCATCGTTGGCAATTCGG
GCGGAGCCGCCGACGTCGTCAGCGAGGTGACGCACCGCCTGATCGACGAGGCCGTCAAGGGCCCGGATGCCGGCA
GGGGGCTCCTCGACTCATCGTCTGACTCGGGCTCTGATTCCGGTTCGTCAACGGGCTCCGACGACGAAGACGAGA
TGGATCCTGGCGCCCAGCTAAGGCAGCAGCTCTGCCCCGGCATCAAGGAAGCTCAACCGCAGACGATGCCCCTGT
CGGCTTACACGGGAAGGTACTGGAACGAGGGTTACCGCGAGATGGTGGTGGAGGAGCGCGACGGCGAGCTAGCCG
TGGATGCCATGAAGCGATCCATGGGCTTCCATCTGAGGCTCCAGCATGTCAGCGACCAGACTATGTACCTGGCAT
ACCTGAGAGAGCGCTTCGACAGGGAGGGCCAGCCCCTGAAAGCCGAGTTCCGACTCCAAGGCGACAGGGCGGTCA
AGATGGGCCTGTGGCTGGAGGAGCAGATGAAGGACTACGTCTGGTTCGATCGGATTGATGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail