Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7452
Gene name
LocationContig_94:23103..24968
Strand-
Gene length (bp)1865
Transcript length (bp)1815
Coding sequence length (bp)1815
Protein length (aa) 605

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00144 Beta-lactamase Beta-lactamase 8.7E-51 86 438
PF11954 DUF3471 Domain of unknown function (DUF3471) 1.0E-11 499 600

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P32959|PBPE_BACSU Penicillin-binding protein 4* OS=Bacillus subtilis (strain 168) GN=pbpE PE=1 SV=1 101 334 2.0E-16
sp|P0AD70|AMPH_ECOLI D-alanyl-D-alanine-carboxypeptidase/endopeptidase AmpH OS=Escherichia coli (strain K12) GN=ampH PE=1 SV=1 81 444 1.0E-12
sp|P0AD71|AMPH_ECO57 D-alanyl-D-alanine-carboxypeptidase/endopeptidase AmpH OS=Escherichia coli O157:H7 GN=ampH PE=3 SV=1 81 444 1.0E-12
sp|Q8NUZ4|FLP_STAAW Protein flp OS=Staphylococcus aureus (strain MW2) GN=flp PE=3 SV=1 98 432 4.0E-12
sp|Q6G6M9|FLP_STAAS Protein flp OS=Staphylococcus aureus (strain MSSA476) GN=flp PE=3 SV=1 98 432 6.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P32959|PBPE_BACSU Penicillin-binding protein 4* OS=Bacillus subtilis (strain 168) GN=pbpE PE=1 SV=1 101 334 2.0E-16
sp|P0AD70|AMPH_ECOLI D-alanyl-D-alanine-carboxypeptidase/endopeptidase AmpH OS=Escherichia coli (strain K12) GN=ampH PE=1 SV=1 81 444 1.0E-12
sp|P0AD71|AMPH_ECO57 D-alanyl-D-alanine-carboxypeptidase/endopeptidase AmpH OS=Escherichia coli O157:H7 GN=ampH PE=3 SV=1 81 444 1.0E-12
sp|Q8NUZ4|FLP_STAAW Protein flp OS=Staphylococcus aureus (strain MW2) GN=flp PE=3 SV=1 98 432 4.0E-12
sp|Q6G6M9|FLP_STAAS Protein flp OS=Staphylococcus aureus (strain MSSA476) GN=flp PE=3 SV=1 98 432 6.0E-12
sp|Q5HDB2|FLP_STAAC Protein flp OS=Staphylococcus aureus (strain COL) GN=flp PE=4 SV=1 98 432 9.0E-12
sp|P05364|AMPC_ENTCL Beta-lactamase OS=Enterobacter cloacae GN=ampC PE=1 SV=1 90 433 7.0E-10
sp|P24735|AMPC_PSEAE Beta-lactamase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=ampC PE=1 SV=2 88 432 7.0E-10
sp|P05193|AMPC_CITFR Beta-lactamase OS=Citrobacter freundii GN=ampC PE=1 SV=1 90 450 8.0E-10
sp|P85302|AMPC_PSEFL Beta-lactamase OS=Pseudomonas fluorescens GN=ampC PE=1 SV=1 90 432 9.0E-09
sp|P15555|DAC_STRSR D-alanyl-D-alanine carboxypeptidase OS=Streptomyces sp. (strain R61) PE=1 SV=2 134 336 1.0E-08
sp|O31773|PBPX_BACSU Putative penicillin-binding protein PbpX OS=Bacillus subtilis (strain 168) GN=pbpX PE=2 SV=1 81 335 1.0E-08
sp|Q06317|PBP4_AMYLA Penicillin-binding protein 4 OS=Amycolatopsis lactamdurans GN=pbp PE=3 SV=1 98 336 2.0E-08
sp|P94958|AMPC_MORMO Beta-lactamase OS=Morganella morganii GN=ampC PE=3 SV=1 90 432 4.0E-08
sp|A6WYS5|DAP_OCHA4 D-aminopeptidase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=dap PE=3 SV=1 100 455 5.0E-08
sp|P18539|AMPC_SERMA Beta-lactamase OS=Serratia marcescens GN=ampC PE=3 SV=1 85 448 1.0E-07
sp|P00811|AMPC_ECOLI Beta-lactamase OS=Escherichia coli (strain K12) GN=ampC PE=1 SV=1 70 432 2.0E-07
sp|Q9ZBA9|DAP_OCHAN D-aminopeptidase OS=Ochrobactrum anthropi GN=dap PE=1 SV=3 88 452 1.0E-06
sp|B5RCU8|YFEW_SALG2 UPF0214 protein YfeW OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=yfeW PE=3 SV=1 118 277 2.0E-06
sp|Q8FV99|DAP_BRUSU D-aminopeptidase OS=Brucella suis biovar 1 (strain 1330) GN=dap PE=3 SV=1 84 553 4.0E-06
sp|A9WVV8|DAP_BRUSI D-aminopeptidase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=dap PE=3 SV=1 84 553 4.0E-06
sp|A9MCM7|DAP_BRUC2 D-aminopeptidase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=dap PE=3 SV=1 84 553 4.0E-06
sp|Q579G4|DAP_BRUAB D-aminopeptidase OS=Brucella abortus biovar 1 (strain 9-941) GN=dap PE=3 SV=1 84 553 4.0E-06
sp|Q2YLB4|DAP_BRUA2 D-aminopeptidase OS=Brucella abortus (strain 2308) GN=dap PE=3 SV=1 84 553 4.0E-06
sp|B2SD81|DAP_BRUA1 D-aminopeptidase OS=Brucella abortus (strain S19) GN=dap PE=3 SV=1 84 553 4.0E-06
sp|Q8YD27|DAP_BRUME D-aminopeptidase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=dap PE=3 SV=1 84 553 4.0E-06
sp|C0RM93|DAP_BRUMB D-aminopeptidase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=dap PE=3 SV=1 84 553 4.0E-06
sp|A5VVL2|DAP_BRUO2 D-aminopeptidase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=dap PE=3 SV=1 84 553 4.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

Gene cluster ID Type of secondary metabolism gene
Cluster 31 (None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup111
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis map64 (Brazil) OphauB2|115
Ophiocordyceps camponoti-floridani Ophcf2|03858
Ophiocordyceps camponoti-floridani Ophcf2|05282
Ophiocordyceps camponoti-rufipedis Ophun1|4044
Ophiocordyceps camponoti-rufipedis Ophun1|7452 (this protein)
Ophiocordyceps kimflemingae Ophio5|1649
Ophiocordyceps kimflemingae Ophio5|4067
Ophiocordyceps subramaniannii Hirsu2|1745
Ophiocordyceps subramaniannii Hirsu2|1988
Ophiocordyceps subramaniannii Hirsu2|230
Ophiocordyceps subramaniannii Hirsu2|2822
Ophiocordyceps subramaniannii Hirsu2|5585

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7452
MRRLRSALRRWPAMEPKPSGRSRWFTPDYPPGRGPVRHDVAVAWDCVTADDDDDGAIIQQGLSHSPGSRSFVQQP
SIMDIVRSPDFAAYVTRLMRICHVPGLAVAVAQGDEVVSAGFGKASLDPEVECTADTLFDMASASKSLTAASVAL
LIADEGHPHVQWKAKMEDLLPGDFVMPGSDHSDVTVEDILSHRTGMPSHDNSYHGCEADNPDDARSITRNLRNLA
VVAPNRSSYMYCNMMYTVASYLVERVSGLPFGDYLEERLLQPLGMKDTSLQPARARAKGLGDRIAKGYVWDEHAA
KYEETPCNEDAPEAQGAGCVQSSVNDYIKWVQAMMNRSGPISEDIYQGLVEKRIRQSDDDVPEEVVWEAEAEAEA
QGDAPSDEPPPLYYAVGWEVREYCKHTIVSHTGSEDGFRSNHFFVPELNFGGVIVGNSGGAADVVSEVTHRLIDE
AVKGPDAGRGLLDSSSDSGSDSGSSTGSDDEDEMDPGAQLRQQLCPGIKEAQPQTMPLSAYTGRYWNEGYREMVV
EERDGELAVDAMKRSMGFHLRLQHVSDQTMYLAYLRERFDREGQPLKAEFRLQGDRAVKMGLWLEEQMKDYVWFD
RIDD*
Coding >Ophun1|7452
ATGCGCCGGCTCCGGTCGGCTTTACGGCGCTGGCCGGCCATGGAGCCGAAGCCAAGCGGCCGATCGAGATGGTTC
ACGCCGGACTATCCACCGGGCCGCGGGCCTGTGAGGCATGACGTGGCTGTGGCTTGGGATTGTGTTACAGCTGAC
GATGATGATGACGGTGCCATTATCCAACAAGGCCTCTCCCACTCCCCCGGTTCTCGCAGCTTCGTCCAGCAGCCA
AGCATCATGGATATCGTCCGCTCTCCCGACTTCGCCGCGTACGTGACGCGCCTGATGAGGATCTGCCATGTGCCA
GGTCTAGCCGTGGCCGTGGCCCAGGGTGACGAAGTCGTCTCCGCCGGCTTCGGCAAGGCATCGCTGGACCCAGAA
GTGGAATGCACGGCCGACACGCTCTTCGACATGGCCTCGGCCTCCAAGTCGCTGACAGCCGCGTCGGTAGCGCTT
CTCATCGCCGACGAAGGACATCCGCACGTGCAGTGGAAGGCCAAGATGGAGGATCTTTTGCCGGGCGACTTTGTC
ATGCCTGGCAGCGACCACTCCGATGTCACGGTCGAGGACATCCTCAGCCACCGCACGGGCATGCCATCGCACGAC
AACTCTTATCATGGCTGCGAGGCCGACAATCCAGATGACGCGCGGTCCATCACTCGAAACCTTCGCAACCTGGCC
GTCGTAGCGCCTAACCGCAGCAGCTACATGTATTGCAACATGATGTATACCGTCGCCAGTTACCTGGTAGAGCGA
GTTAGCGGGCTCCCCTTTGGCGATTATCTCGAGGAGAGGCTTCTGCAGCCGCTGGGGATGAAGGACACTTCGCTG
CAGCCGGCACGCGCCCGCGCCAAGGGTCTGGGTGACCGCATCGCCAAGGGTTACGTCTGGGACGAACATGCGGCC
AAGTACGAGGAGACGCCGTGCAACGAAGACGCGCCCGAGGCGCAAGGAGCCGGATGCGTTCAGTCGAGCGTCAAC
GACTACATCAAGTGGGTGCAGGCCATGATGAACCGGTCCGGTCCCATTTCCGAAGACATCTATCAGGGGCTCGTC
GAGAAGCGCATCCGGCAGAGCGACGATGACGTGCCGGAAGAAGTCGTCTGGGAGGCCGAAGCCGAAGCCGAGGCC
CAAGGCGACGCCCCGTCCGACGAGCCGCCGCCGCTCTACTATGCTGTCGGCTGGGAGGTGCGTGAGTATTGCAAG
CACACCATCGTGTCGCACACCGGCTCCGAGGATGGCTTCCGTTCCAATCACTTCTTCGTGCCGGAGCTCAACTTT
GGCGGCGTCATCGTTGGCAATTCGGGCGGAGCCGCCGACGTCGTCAGCGAGGTGACGCACCGCCTGATCGACGAG
GCCGTCAAGGGCCCGGATGCCGGCAGGGGGCTCCTCGACTCATCGTCTGACTCGGGCTCTGATTCCGGTTCGTCA
ACGGGCTCCGACGACGAAGACGAGATGGATCCTGGCGCCCAGCTAAGGCAGCAGCTCTGCCCCGGCATCAAGGAA
GCTCAACCGCAGACGATGCCCCTGTCGGCTTACACGGGAAGGTACTGGAACGAGGGTTACCGCGAGATGGTGGTG
GAGGAGCGCGACGGCGAGCTAGCCGTGGATGCCATGAAGCGATCCATGGGCTTCCATCTGAGGCTCCAGCATGTC
AGCGACCAGACTATGTACCTGGCATACCTGAGAGAGCGCTTCGACAGGGAGGGCCAGCCCCTGAAAGCCGAGTTC
CGACTCCAAGGCGACAGGGCGGTCAAGATGGGCCTGTGGCTGGAGGAGCAGATGAAGGACTACGTCTGGTTCGAT
CGGATTGATGACTGA
Transcript >Ophun1|7452
ATGCGCCGGCTCCGGTCGGCTTTACGGCGCTGGCCGGCCATGGAGCCGAAGCCAAGCGGCCGATCGAGATGGTTC
ACGCCGGACTATCCACCGGGCCGCGGGCCTGTGAGGCATGACGTGGCTGTGGCTTGGGATTGTGTTACAGCTGAC
GATGATGATGACGGTGCCATTATCCAACAAGGCCTCTCCCACTCCCCCGGTTCTCGCAGCTTCGTCCAGCAGCCA
AGCATCATGGATATCGTCCGCTCTCCCGACTTCGCCGCGTACGTGACGCGCCTGATGAGGATCTGCCATGTGCCA
GGTCTAGCCGTGGCCGTGGCCCAGGGTGACGAAGTCGTCTCCGCCGGCTTCGGCAAGGCATCGCTGGACCCAGAA
GTGGAATGCACGGCCGACACGCTCTTCGACATGGCCTCGGCCTCCAAGTCGCTGACAGCCGCGTCGGTAGCGCTT
CTCATCGCCGACGAAGGACATCCGCACGTGCAGTGGAAGGCCAAGATGGAGGATCTTTTGCCGGGCGACTTTGTC
ATGCCTGGCAGCGACCACTCCGATGTCACGGTCGAGGACATCCTCAGCCACCGCACGGGCATGCCATCGCACGAC
AACTCTTATCATGGCTGCGAGGCCGACAATCCAGATGACGCGCGGTCCATCACTCGAAACCTTCGCAACCTGGCC
GTCGTAGCGCCTAACCGCAGCAGCTACATGTATTGCAACATGATGTATACCGTCGCCAGTTACCTGGTAGAGCGA
GTTAGCGGGCTCCCCTTTGGCGATTATCTCGAGGAGAGGCTTCTGCAGCCGCTGGGGATGAAGGACACTTCGCTG
CAGCCGGCACGCGCCCGCGCCAAGGGTCTGGGTGACCGCATCGCCAAGGGTTACGTCTGGGACGAACATGCGGCC
AAGTACGAGGAGACGCCGTGCAACGAAGACGCGCCCGAGGCGCAAGGAGCCGGATGCGTTCAGTCGAGCGTCAAC
GACTACATCAAGTGGGTGCAGGCCATGATGAACCGGTCCGGTCCCATTTCCGAAGACATCTATCAGGGGCTCGTC
GAGAAGCGCATCCGGCAGAGCGACGATGACGTGCCGGAAGAAGTCGTCTGGGAGGCCGAAGCCGAAGCCGAGGCC
CAAGGCGACGCCCCGTCCGACGAGCCGCCGCCGCTCTACTATGCTGTCGGCTGGGAGGTGCGTGAGTATTGCAAG
CACACCATCGTGTCGCACACCGGCTCCGAGGATGGCTTCCGTTCCAATCACTTCTTCGTGCCGGAGCTCAACTTT
GGCGGCGTCATCGTTGGCAATTCGGGCGGAGCCGCCGACGTCGTCAGCGAGGTGACGCACCGCCTGATCGACGAG
GCCGTCAAGGGCCCGGATGCCGGCAGGGGGCTCCTCGACTCATCGTCTGACTCGGGCTCTGATTCCGGTTCGTCA
ACGGGCTCCGACGACGAAGACGAGATGGATCCTGGCGCCCAGCTAAGGCAGCAGCTCTGCCCCGGCATCAAGGAA
GCTCAACCGCAGACGATGCCCCTGTCGGCTTACACGGGAAGGTACTGGAACGAGGGTTACCGCGAGATGGTGGTG
GAGGAGCGCGACGGCGAGCTAGCCGTGGATGCCATGAAGCGATCCATGGGCTTCCATCTGAGGCTCCAGCATGTC
AGCGACCAGACTATGTACCTGGCATACCTGAGAGAGCGCTTCGACAGGGAGGGCCAGCCCCTGAAAGCCGAGTTC
CGACTCCAAGGCGACAGGGCGGTCAAGATGGGCCTGTGGCTGGAGGAGCAGATGAAGGACTACGTCTGGTTCGAT
CGGATTGATGACTGA
Gene >Ophun1|7452
ATGCGCCGGCTCCGGTCGGCTTTACGGCGCTGGCCGGCCATGGAGCCGAAGCCAAGCGGCCGATCGAGATGGTTC
ACGCCGGACTATCCACCGGGCCGCGGGCCTGTGAGGCATGACGTGGCTGTGGCTTGGGATTGTGTTACAGCTGAC
GATGATGATGACGGTGCCATTATCCAACAAGGCCTCTCCCACTCCCCCGGTTCTCGCAGCTTCGTCCAGCAGCCA
AGCATCATGGATATCGTCCGCTCTCCCGACTTCGCCGCGTACGTGACGCGCCTGATGAGGATCTGCCATGTGCCA
GGTCTAGCCGTGGCCGTGGCCCAGGGTGACGAAGTCGTCTCCGCCGGCTTCGGCAAGGCATCGCTGGACCCAGAA
GTGGAATGCACGGCCGACACGCTCTTCGACATGGCCTCGGCCTCCAAGTCGCTGACAGCCGCGTCGGTAGCGCTT
CTCATCGCCGACGAAGGACATCCGCACGTGCAGTGGAAGGCCAAGATGGAGGATCTTTTGCCGGGCGACTTTGTC
ATGCCTGGCAGCGACCACTCCGATGTCACGGTCGAGGACATCCTCAGCCACCGCACGGGCATGCCATCGTGAGTC
TTGTCACGCTTGCGAGAGGGACCTGCGCAGCTGATATCTCAAGGCACGACAACTCTTATCATGGCTGCGAGGCCG
ACAATCCAGATGACGCGCGGTCCATCACTCGAAACCTTCGCAACCTGGCCGTCGTAGCGCCTAACCGCAGCAGCT
ACATGTATTGCAACATGATGTATACCGTCGCCAGTTACCTGGTAGAGCGAGTTAGCGGGCTCCCCTTTGGCGATT
ATCTCGAGGAGAGGCTTCTGCAGCCGCTGGGGATGAAGGACACTTCGCTGCAGCCGGCACGCGCCCGCGCCAAGG
GTCTGGGTGACCGCATCGCCAAGGGTTACGTCTGGGACGAACATGCGGCCAAGTACGAGGAGACGCCGTGCAACG
AAGACGCGCCCGAGGCGCAAGGAGCCGGATGCGTTCAGTCGAGCGTCAACGACTACATCAAGTGGGTGCAGGCCA
TGATGAACCGGTCCGGTCCCATTTCCGAAGACATCTATCAGGGGCTCGTCGAGAAGCGCATCCGGCAGAGCGACG
ATGACGTGCCGGAAGAAGTCGTCTGGGAGGCCGAAGCCGAAGCCGAGGCCCAAGGCGACGCCCCGTCCGACGAGC
CGCCGCCGCTCTACTATGCTGTCGGCTGGGAGGTGCGTGAGTATTGCAAGCACACCATCGTGTCGCACACCGGCT
CCGAGGATGGCTTCCGTTCCAATCACTTCTTCGTGCCGGAGCTCAACTTTGGCGGCGTCATCGTTGGCAATTCGG
GCGGAGCCGCCGACGTCGTCAGCGAGGTGACGCACCGCCTGATCGACGAGGCCGTCAAGGGCCCGGATGCCGGCA
GGGGGCTCCTCGACTCATCGTCTGACTCGGGCTCTGATTCCGGTTCGTCAACGGGCTCCGACGACGAAGACGAGA
TGGATCCTGGCGCCCAGCTAAGGCAGCAGCTCTGCCCCGGCATCAAGGAAGCTCAACCGCAGACGATGCCCCTGT
CGGCTTACACGGGAAGGTACTGGAACGAGGGTTACCGCGAGATGGTGGTGGAGGAGCGCGACGGCGAGCTAGCCG
TGGATGCCATGAAGCGATCCATGGGCTTCCATCTGAGGCTCCAGCATGTCAGCGACCAGACTATGTACCTGGCAT
ACCTGAGAGAGCGCTTCGACAGGGAGGGCCAGCCCCTGAAAGCCGAGTTCCGACTCCAAGGCGACAGGGCGGTCA
AGATGGGCCTGTGGCTGGAGGAGCAGATGAAGGACTACGTCTGGTTCGATCGGATTGATGACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail