Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7451
Gene name
LocationContig_94:11144..21252
Strand-
Gene length (bp)10108
Transcript length (bp)9978
Coding sequence length (bp)9978
Protein length (aa) 3326

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00501 AMP-binding AMP-binding enzyme 2.1E-16 39 289
PF00501 AMP-binding AMP-binding enzyme 5.0E-71 997 1393
PF00501 AMP-binding AMP-binding enzyme 4.7E-69 2761 3165
PF00668 Condensation Condensation domain 3.5E-33 549 961
PF00668 Condensation Condensation domain 3.5E-37 1616 2044
PF00668 Condensation Condensation domain 6.2E-28 2085 2495
PF00550 PP-binding Phosphopantetheine attachment site 4.6E-05 443 503
PF00550 PP-binding Phosphopantetheine attachment site 3.8E-09 1526 1587

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 437 2506 0.0E+00
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 428 2493 0.0E+00
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 769 2422 0.0E+00
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 440 2407 0.0E+00
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 428 2467 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 437 2506 0.0E+00
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 428 2493 0.0E+00
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 769 2422 0.0E+00
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 440 2407 0.0E+00
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 428 2467 0.0E+00
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 937 2496 1.0E-179
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 440 1690 9.0E-175
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 440 1690 1.0E-174
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 440 1671 7.0E-169
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 439 2404 1.0E-148
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 429 2404 1.0E-138
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 426 2439 1.0E-138
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 439 2372 3.0E-138
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 410 1590 7.0E-134
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 429 1761 7.0E-134
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 433 2404 2.0E-133
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 546 1671 5.0E-131
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 979 1772 1.0E-129
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 525 2404 2.0E-129
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 433 2488 1.0E-128
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 920 2492 1.0E-126
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 547 1760 6.0E-125
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 532 1922 9.0E-125
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 1547 2463 8.0E-124
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 2509 3315 9.0E-124
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 2735 3316 4.0E-122
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 403 1611 3.0E-120
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 419 2404 1.0E-119
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 550 1589 9.0E-119
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 917 2492 7.0E-118
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 543 1748 6.0E-115
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 552 1803 5.0E-114
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 434 2070 7.0E-114
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 427 2037 1.0E-112
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 539 1684 8.0E-110
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 440 1963 3.0E-107
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 434 1590 4.0E-107
sp|P0C061|GRSA_ANEMI Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 980 2061 2.0E-106
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 547 1803 4.0E-106
sp|P0C062|GRSA_BREBE Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 980 2061 6.0E-106
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 2512 3318 8.0E-106
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 433 2051 8.0E-106
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 434 2080 4.0E-105
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 2510 3319 2.0E-104
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 443 2062 2.0E-104
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 922 1586 6.0E-104
sp|P09095|TYCA_BREPA Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 965 2061 7.0E-104
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2510 3315 1.0E-103
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 933 1587 3.0E-103
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 430 2074 8.0E-102
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 2506 3319 1.0E-101
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 439 2034 5.0E-101
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 439 2033 5.0E-101
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 2506 3319 9.0E-101
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2486 3287 1.0E-98
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 546 1759 7.0E-98
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 547 1817 3.0E-97
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 543 1759 2.0E-96
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 543 1759 6.0E-96
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 987 1671 7.0E-96
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 546 1758 1.0E-94
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 956 1590 6.0E-94
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 430 2069 8.0E-94
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 432 1817 4.0E-93
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 542 1835 1.0E-92
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2331 3315 2.0E-92
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 2753 3315 1.0E-91
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 2753 3315 1.0E-91
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 2753 3315 2.0E-91
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 545 1783 2.0E-91
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 499 1779 1.0E-90
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 547 1759 1.0E-90
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 2690 3315 4.0E-90
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 547 2041 1.0E-89
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 2691 3316 2.0E-89
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 2528 3316 2.0E-89
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 515 1515 3.0E-89
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 988 1779 8.0E-89
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 988 1625 1.0E-88
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 988 1625 2.0E-88
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 438 1799 2.0E-88
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 2690 3318 6.0E-88
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 543 1755 1.0E-87
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 2750 3315 5.0E-87
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2753 3319 7.0E-86
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 986 1759 1.0E-85
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 543 1786 4.0E-85
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 543 1761 1.0E-84
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 546 1599 3.0E-84
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 499 1590 4.0E-84
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 545 2087 5.0E-84
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 2610 3321 6.0E-84
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 434 1930 7.0E-84
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 546 1786 2.0E-83
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 953 1774 1.0E-82
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2678 3318 9.0E-82
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2742 3319 2.0E-81
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 436 1760 4.0E-81
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 546 1588 6.0E-81
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 437 1789 2.0E-80
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 545 1586 2.0E-80
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 571 1598 4.0E-80
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 434 1789 8.0E-79
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 2686 3286 1.0E-78
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 437 984 1.0E-78
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 437 1965 4.0E-78
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 2691 3318 2.0E-77
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 434 1783 2.0E-77
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 434 1789 5.0E-77
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2742 3315 2.0E-76
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 539 1609 4.0E-76
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2753 3315 2.0E-75
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 437 1785 3.0E-75
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 552 1896 1.0E-74
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 2578 3316 2.0E-74
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 437 1768 2.0E-74
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 431 1789 3.0E-74
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2578 3317 4.0E-74
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 428 1783 4.0E-74
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 434 1783 8.0E-74
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 439 1682 2.0E-73
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2746 3315 3.0E-73
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 437 1759 3.0E-72
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 1012 1965 6.0E-72
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2578 3316 7.0E-72
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 434 1789 1.0E-71
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 458 1761 5.0E-71
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 440 1601 1.0E-70
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 671 1785 2.0E-70
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 2539 3319 3.0E-70
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 994 1783 6.0E-70
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 436 1783 1.0E-69
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 448 1759 5.0E-69
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 433 1780 6.0E-69
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 974 1782 6.0E-69
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 436 1783 6.0E-69
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 414 1560 2.0E-68
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 438 2050 3.0E-68
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 438 2050 3.0E-68
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 437 1970 2.0E-67
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 437 1970 5.0E-67
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 412 1760 9.0E-67
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2512 3281 6.0E-66
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 440 1565 2.0E-64
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 446 1609 6.0E-64
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 446 1609 1.0E-63
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 647 1761 1.0E-63
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 432 1671 5.0E-63
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 985 1779 6.0E-63
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 448 1560 1.0E-62
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 713 1591 3.0E-62
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 1012 2049 5.0E-62
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 412 1586 9.0E-62
sp|Q9L9G0|NOVH_STRNV Novobiocin biosynthesis protein H OS=Streptomyces niveus GN=novH PE=1 SV=2 972 1588 1.0E-61
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 1443 2404 2.0E-61
sp|P09095|TYCA_BREPA Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 2732 3317 4.0E-61
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 2753 3317 6.0E-61
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 2753 3317 7.0E-61
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 436 1772 8.0E-61
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2651 3317 1.0E-60
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 896 1761 1.0E-60
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 650 1748 4.0E-60
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 2492 3315 2.0E-59
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 2528 3317 4.0E-59
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 552 1586 4.0E-59
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 2578 3317 9.0E-59
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 2677 3316 4.0E-58
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2492 3317 4.0E-58
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 2578 3317 5.0E-58
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 2687 3317 1.0E-57
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2658 3316 2.0E-57
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2524 3317 3.0E-57
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 2689 3314 1.0E-56
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 2578 3315 1.0E-56
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 1632 2045 2.0E-56
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 2652 3316 4.0E-56
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 2696 3318 4.0E-56
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 2668 3317 1.0E-55
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 2689 3313 1.0E-55
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 2513 3316 2.0E-55
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 2607 3316 2.0E-55
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 438 1586 2.0E-55
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 2520 3325 4.0E-55
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 2578 3317 9.0E-55
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 2652 3316 1.0E-54
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 775 1586 1.0E-54
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 2684 3317 2.0E-54
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 549 1418 2.0E-54
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 2750 3315 3.0E-54
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2677 3315 7.0E-54
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 2609 3319 1.0E-53
sp|Q9L9G0|NOVH_STRNV Novobiocin biosynthesis protein H OS=Streptomyces niveus GN=novH PE=1 SV=2 2761 3317 1.0E-53
sp|P0C061|GRSA_ANEMI Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 2754 3317 2.0E-53
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 2764 3318 2.0E-53
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 2687 3317 7.0E-53
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2081 2494 9.0E-53
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 2578 3317 1.0E-52
sp|P0C062|GRSA_BREBE Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 2754 3317 1.0E-52
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 2687 3322 1.0E-52
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 2766 3317 1.0E-52
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 2677 3316 1.0E-52
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 965 1761 3.0E-52
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 965 1761 3.0E-52
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 2596 3316 5.0E-52
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 2677 3316 6.0E-52
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 2578 3314 8.0E-52
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 2629 3315 8.0E-52
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2688 3315 1.0E-51
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 2578 3321 1.0E-51
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 2578 3316 2.0E-51
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 2766 3317 2.0E-51
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 2652 3316 2.0E-51
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 2766 3317 3.0E-51
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 2652 3316 7.0E-51
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 2528 3287 7.0E-51
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2766 3315 1.0E-50
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2619 3322 1.0E-50
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 2763 3316 2.0E-50
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 1037 1759 3.0E-50
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2619 3322 3.0E-50
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2684 3315 7.0E-50
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 2766 3324 1.0E-49
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 2763 3317 1.0E-49
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 2762 3317 2.0E-49
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 2762 3317 4.0E-49
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 2529 3315 5.0E-49
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 2763 3316 7.0E-49
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 2717 3313 2.0E-48
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 2686 3317 3.0E-48
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2689 3316 7.0E-48
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 910 1756 9.0E-48
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 2578 3316 1.0E-47
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 2578 3317 1.0E-47
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 2625 3175 1.0E-47
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 2578 3317 2.0E-47
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 2578 3315 3.0E-47
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 999 1588 3.0E-47
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 2762 3314 4.0E-47
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2070 2495 5.0E-47
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 2754 3316 9.0E-47
sp|P11454|ENTF_ECOLI Enterobactin synthase component F OS=Escherichia coli (strain K12) GN=entF PE=1 SV=3 980 1588 1.0E-46
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 2751 3317 2.0E-46
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 2614 3315 2.0E-46
sp|P29698|ENTF_SHIFL Enterobactin synthase component F OS=Shigella flexneri GN=entF PE=3 SV=2 980 1588 2.0E-46
sp|Q8XBV9|ENTF_ECO57 Enterobactin synthase component F OS=Escherichia coli O157:H7 GN=entF PE=3 SV=1 980 1588 2.0E-46
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 2628 3317 4.0E-46
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 2688 3317 5.0E-46
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 2609 3315 6.0E-46
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2668 3324 1.0E-45
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 1010 1758 1.0E-45
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 2578 3313 7.0E-45
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 2717 3317 8.0E-45
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 2718 3313 1.0E-44
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 2578 3273 2.0E-44
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 2618 3313 3.0E-44
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 1016 1585 5.0E-44
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 2717 3317 9.0E-44
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 2741 3315 1.0E-43
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 2689 3315 4.0E-43
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 979 1783 5.0E-43
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 2766 3313 2.0E-42
sp|Q7TYQ4|MBTB_MYCBO Phenyloxazoline synthase MbtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mbtB PE=3 SV=1 980 1609 2.0E-42
sp|P9WQ63|MBTB_MYCTU Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mbtB PE=1 SV=1 980 1609 2.0E-42
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 2778 3308 3.0E-42
sp|P9WQ62|MBTB_MYCTO Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mbtB PE=1 SV=1 980 1609 3.0E-42
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 1016 1682 1.0E-41
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 2764 3316 3.0E-41
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 422 1470 7.0E-41
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 934 1620 1.0E-40
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 1014 1587 4.0E-40
sp|P35854|DLTA_LACRH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus rhamnosus GN=dltA PE=1 SV=1 2765 3277 6.0E-40
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 2692 3319 7.0E-40
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 2607 3318 1.0E-39
sp|B3WC77|DLTA_LACCB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain BL23) GN=dltA PE=3 SV=1 2765 3277 1.0E-39
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 2754 3272 2.0E-39
sp|Q6W4T3|ANGR_VIBA7 Anguibactin system regulator OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=angR PE=1 SV=1 916 1586 2.0E-39
sp|P0DJH0|ANGR_VIBAN Anguibactin system regulator OS=Vibrio anguillarum GN=angR PE=3 SV=1 916 1586 2.0E-39
sp|P39581|DLTA_BACSU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus subtilis (strain 168) GN=dltA PE=1 SV=1 2758 3274 3.0E-39
sp|Q03AZ2|DLTA_LACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain ATCC 334) GN=dltA PE=3 SV=1 2765 3277 4.0E-39
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 2762 3271 1.0E-38
sp|B7HK95|DLTA_BACC7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH187) GN=dltA PE=3 SV=1 2762 3271 2.0E-38
sp|Q6HLH7|DLTA_BACHK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=dltA PE=3 SV=1 2762 3271 2.0E-38
sp|C1EM80|DLTA_BACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain 03BB102) GN=dltA PE=3 SV=1 2762 3271 2.0E-38
sp|B7JFV5|DLTA_BACC0 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH820) GN=dltA PE=3 SV=1 2762 3271 2.0E-38
sp|A0RBJ0|DLTA_BACAH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis (strain Al Hakam) GN=dltA PE=3 SV=1 2762 3271 2.0E-38
sp|B9IUW2|DLTA_BACCQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain Q1) GN=dltA PE=3 SV=1 2762 3271 2.0E-38
sp|Q73BD2|DLTA_BACC1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=dltA PE=3 SV=1 2762 3271 3.0E-38
sp|Q81G39|DLTA_BACCR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dltA PE=1 SV=1 2766 3271 3.0E-38
sp|B7HHC6|DLTA_BACC4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain B4264) GN=dltA PE=3 SV=1 2766 3271 3.0E-38
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 2754 3317 4.0E-38
sp|B7IN64|DLTA_BACC2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain G9842) GN=dltA PE=3 SV=1 2762 3271 5.0E-38
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 2663 3315 6.0E-38
sp|A7GMR0|DLTA_BACCN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dltA PE=3 SV=1 2766 3271 6.0E-38
sp|Q63E02|DLTA_BACCZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ZK / E33L) GN=dltA PE=3 SV=1 2762 3271 6.0E-38
sp|Q81T97|DLTA_BACAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis GN=dltA PE=3 SV=1 2762 3271 8.0E-38
sp|C3LAH8|DLTA_BACAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=dltA PE=3 SV=1 2762 3271 8.0E-38
sp|C3P4I7|DLTA_BACAA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain A0248) GN=dltA PE=3 SV=1 2762 3271 8.0E-38
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 2762 3315 1.0E-37
sp|Q1B6A7|MBTB_MYCSS Phenyloxazoline synthase MbtB OS=Mycobacterium sp. (strain MCS) GN=mbtB PE=3 SV=1 988 1606 1.0E-37
sp|Q73XY1|MBTB_MYCPA Phenyloxazoline synthase MbtB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mbtB PE=3 SV=1 980 1590 1.0E-37
sp|Q01757|ACVS_STRCL N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase (Fragment) OS=Streptomyces clavuligerus GN=pcbAB PE=3 SV=1 2688 3273 2.0E-37
sp|A9VKV6|DLTA_BACWK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus weihenstephanensis (strain KBAB4) GN=dltA PE=3 SV=1 2762 3271 2.0E-37
sp|Q6W4T3|ANGR_VIBA7 Anguibactin system regulator OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=angR PE=1 SV=1 2677 3317 9.0E-37
sp|P0DJH0|ANGR_VIBAN Anguibactin system regulator OS=Vibrio anguillarum GN=angR PE=3 SV=1 2677 3317 1.0E-36
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 2687 3313 3.0E-36
sp|A7ZA74|DLTA_BACMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dltA PE=3 SV=1 2756 3274 3.0E-36
sp|Q7TYQ4|MBTB_MYCBO Phenyloxazoline synthase MbtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mbtB PE=3 SV=1 2753 3314 5.0E-36
sp|P9WQ63|MBTB_MYCTU Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mbtB PE=1 SV=1 2753 3314 5.0E-36
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 983 1585 6.0E-36
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 2578 3314 6.0E-36
sp|P9WQ62|MBTB_MYCTO Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mbtB PE=1 SV=1 2753 3314 6.0E-36
sp|Q8Y8D4|DLTA_LISMO D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dltA PE=3 SV=1 2750 3274 6.0E-36
sp|Q81G39|DLTA_BACCR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dltA PE=1 SV=1 995 1496 7.0E-36
sp|B7HHC6|DLTA_BACC4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain B4264) GN=dltA PE=3 SV=1 995 1496 7.0E-36
sp|Q01757|ACVS_STRCL N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase (Fragment) OS=Streptomyces clavuligerus GN=pcbAB PE=3 SV=1 941 1496 7.0E-36
sp|Q6HLH7|DLTA_BACHK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=dltA PE=3 SV=1 995 1496 8.0E-36
sp|C1EM80|DLTA_BACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain 03BB102) GN=dltA PE=3 SV=1 995 1496 8.0E-36
sp|B7JFV5|DLTA_BACC0 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH820) GN=dltA PE=3 SV=1 995 1496 8.0E-36
sp|A0RBJ0|DLTA_BACAH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis (strain Al Hakam) GN=dltA PE=3 SV=1 995 1496 8.0E-36
sp|Q63E02|DLTA_BACCZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ZK / E33L) GN=dltA PE=3 SV=1 995 1496 8.0E-36
sp|Q81T97|DLTA_BACAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis GN=dltA PE=3 SV=1 995 1496 8.0E-36
sp|C3LAH8|DLTA_BACAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=dltA PE=3 SV=1 995 1496 8.0E-36
sp|C3P4I7|DLTA_BACAA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain A0248) GN=dltA PE=3 SV=1 995 1496 8.0E-36
sp|Q73BD2|DLTA_BACC1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=dltA PE=3 SV=1 995 1496 1.0E-35
sp|B7IN64|DLTA_BACC2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain G9842) GN=dltA PE=3 SV=1 994 1496 1.0E-35
sp|Q92D47|DLTA_LISIN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dltA PE=3 SV=1 2750 3274 1.0E-35
sp|B7HK95|DLTA_BACC7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH187) GN=dltA PE=3 SV=1 995 1496 2.0E-35
sp|B9IUW2|DLTA_BACCQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain Q1) GN=dltA PE=3 SV=1 995 1496 2.0E-35
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 2754 3319 3.0E-35
sp|A9VKV6|DLTA_BACWK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus weihenstephanensis (strain KBAB4) GN=dltA PE=3 SV=1 1001 1496 4.0E-35
sp|Q6FMI5|LYS2_CANGA L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 2548 3313 4.0E-35
sp|Q6GIF6|DLTA_STAAR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MRSA252) GN=dltA PE=3 SV=1 1002 1499 4.0E-35
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 1012 1697 5.0E-35
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 2766 3316 8.0E-35
sp|B3WC77|DLTA_LACCB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain BL23) GN=dltA PE=3 SV=1 995 1498 1.0E-34
sp|B8DEG2|DLTA_LISMH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dltA PE=3 SV=1 2750 3274 1.0E-34
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 2525 3320 3.0E-34
sp|C1L1P5|DLTA_LISMC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dltA PE=3 SV=1 2750 3274 3.0E-34
sp|Q721J2|DLTA_LISMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dltA PE=3 SV=1 2750 3274 3.0E-34
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 2752 3313 4.0E-34
sp|Q65DH1|DLTA_BACLD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=dltA PE=3 SV=1 2756 3274 6.0E-34
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 979 1596 7.0E-34
sp|P29698|ENTF_SHIFL Enterobactin synthase component F OS=Shigella flexneri GN=entF PE=3 SV=2 2766 3316 9.0E-34
sp|Q8XBV9|ENTF_ECO57 Enterobactin synthase component F OS=Escherichia coli O157:H7 GN=entF PE=3 SV=1 2766 3316 1.0E-33
sp|A7GMR0|DLTA_BACCN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dltA PE=3 SV=1 995 1496 1.0E-33
sp|A0AH92|DLTA_LISW6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dltA PE=3 SV=1 2750 3274 1.0E-33
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 2688 3267 2.0E-33
sp|P11454|ENTF_ECOLI Enterobactin synthase component F OS=Escherichia coli (strain K12) GN=entF PE=1 SV=3 2766 3316 2.0E-33
sp|Q03AZ2|DLTA_LACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain ATCC 334) GN=dltA PE=3 SV=1 995 1498 2.0E-33
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 2754 3319 4.0E-33
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2678 3319 5.0E-33
sp|P35854|DLTA_LACRH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus rhamnosus GN=dltA PE=1 SV=1 995 1498 5.0E-33
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2728 3319 8.0E-33
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 924 1606 8.0E-33
sp|P59591|DLTA_STRA5 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=dltA PE=3 SV=1 2753 3271 8.0E-33
sp|Q3JZ94|DLTA_STRA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=dltA PE=3 SV=1 2753 3271 8.0E-33
sp|Q8VM67|DLTA_STRA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=dltA PE=3 SV=2 2753 3271 1.0E-32
sp|Q2YWQ8|DLTA_STAAB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dltA PE=3 SV=1 1003 1499 1.0E-32
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 449 1464 1.0E-32
sp|P68878|DLTA_STAAW D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MW2) GN=dltA PE=3 SV=1 1003 1499 1.0E-32
sp|A8Z1J1|DLTA_STAAT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dltA PE=3 SV=1 1003 1499 1.0E-32
sp|Q6GAZ4|DLTA_STAAS D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MSSA476) GN=dltA PE=3 SV=1 1003 1499 1.0E-32
sp|A6QFE3|DLTA_STAAE D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Newman) GN=dltA PE=3 SV=1 1003 1499 1.0E-32
sp|Q5HHF2|DLTA_STAAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain COL) GN=dltA PE=3 SV=1 1003 1499 1.0E-32
sp|Q2FZW6|DLTA_STAA8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain NCTC 8325) GN=dltA PE=3 SV=1 1003 1499 1.0E-32
sp|Q2FIE3|DLTA_STAA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300) GN=dltA PE=3 SV=1 1003 1499 1.0E-32
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2066 2494 2.0E-32
sp|P39581|DLTA_BACSU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus subtilis (strain 168) GN=dltA PE=1 SV=1 993 1496 2.0E-32
sp|Q88VM6|DLTA_LACPL D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=dltA PE=3 SV=1 2764 3274 2.0E-32
sp|P0C397|DLTA_STAAU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus GN=dltA PE=3 SV=1 1003 1499 2.0E-32
sp|P99107|DLTA_STAAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain N315) GN=dltA PE=1 SV=1 1003 1499 2.0E-32
sp|P68876|DLTA_STAAM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dltA PE=3 SV=1 1003 1499 2.0E-32
sp|A5IRB0|DLTA_STAA9 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH9) GN=dltA PE=3 SV=1 1003 1499 2.0E-32
sp|A6U039|DLTA_STAA2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH1) GN=dltA PE=3 SV=1 1003 1499 2.0E-32
sp|A7X0D6|DLTA_STAA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dltA PE=3 SV=1 1003 1499 2.0E-32
sp|E2JA29|DDAD_ENTAG Dapdiamide synthesis protein DdaD OS=Enterobacter agglomerans GN=ddaD PE=1 SV=1 996 1587 2.0E-32
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 2772 3276 3.0E-32
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 2752 3313 3.0E-32
sp|Q65DH1|DLTA_BACLD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=dltA PE=3 SV=1 995 1497 5.0E-32
sp|Q5HQN0|DLTA_STAEQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dltA PE=3 SV=1 2762 3273 1.0E-31
sp|Q75BB3|LYS2_ASHGO L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 2752 3272 1.0E-31
sp|E2JA29|DDAD_ENTAG Dapdiamide synthesis protein DdaD OS=Enterobacter agglomerans GN=ddaD PE=1 SV=1 2775 3313 2.0E-31
sp|Q12572|LYS2_CANAX L-2-aminoadipate reductase large subunit OS=Candida albicans GN=LYS2 PE=3 SV=2 2669 3313 2.0E-31
sp|Q1B6A7|MBTB_MYCSS Phenyloxazoline synthase MbtB OS=Mycobacterium sp. (strain MCS) GN=mbtB PE=3 SV=1 2753 3313 3.0E-31
sp|P59591|DLTA_STRA5 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=dltA PE=3 SV=1 990 1498 3.0E-31
sp|Q3JZ94|DLTA_STRA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=dltA PE=3 SV=1 990 1498 3.0E-31
sp|Q8VM67|DLTA_STRA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=dltA PE=3 SV=2 990 1498 6.0E-31
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 2773 3288 1.0E-30
sp|Q9CG49|DLTA_LACLA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dltA PE=3 SV=1 2756 3277 1.0E-30
sp|Q92D47|DLTA_LISIN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dltA PE=3 SV=1 1003 1498 2.0E-30
sp|Q6GIF6|DLTA_STAAR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MRSA252) GN=dltA PE=3 SV=1 2754 3273 2.0E-30
sp|Q8CT93|DLTA_STAES D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dltA PE=3 SV=1 2762 3273 2.0E-30
sp|C1L1P5|DLTA_LISMC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dltA PE=3 SV=1 1003 1498 4.0E-30
sp|Q721J2|DLTA_LISMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dltA PE=3 SV=1 1003 1498 4.0E-30
sp|C0MBD6|DLTA_STRE4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus equi subsp. equi (strain 4047) GN=dltA PE=3 SV=1 2756 3277 4.0E-30
sp|Q8Y8D4|DLTA_LISMO D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dltA PE=3 SV=1 1003 1498 5.0E-30
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 409 853 7.0E-30
sp|A7ZA74|DLTA_BACMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dltA PE=3 SV=1 1002 1496 7.0E-30
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 432 858 1.0E-29
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2770 3316 1.0E-29
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2770 3316 1.0E-29
sp|P68878|DLTA_STAAW D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MW2) GN=dltA PE=3 SV=1 2754 3273 1.0E-29
sp|A8Z1J1|DLTA_STAAT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dltA PE=3 SV=1 2754 3273 1.0E-29
sp|Q6GAZ4|DLTA_STAAS D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MSSA476) GN=dltA PE=3 SV=1 2754 3273 1.0E-29
sp|A6QFE3|DLTA_STAAE D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Newman) GN=dltA PE=3 SV=1 2754 3273 1.0E-29
sp|Q5HHF2|DLTA_STAAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain COL) GN=dltA PE=3 SV=1 2754 3273 1.0E-29
sp|Q2FZW6|DLTA_STAA8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain NCTC 8325) GN=dltA PE=3 SV=1 2754 3273 1.0E-29
sp|Q2FIE3|DLTA_STAA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300) GN=dltA PE=3 SV=1 2754 3273 1.0E-29
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 437 868 2.0E-29
sp|B8DEG2|DLTA_LISMH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dltA PE=3 SV=1 1003 1498 2.0E-29
sp|Q2YWQ8|DLTA_STAAB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dltA PE=3 SV=1 2754 3273 2.0E-29
sp|Q4L4U5|DLTA_STAHJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=dltA PE=3 SV=1 2763 3273 3.0E-29
sp|B5XLX5|DLTA_STRPZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=dltA PE=3 SV=1 2757 3271 3.0E-29
sp|Q48SZ3|DLTA_STRPM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=dltA PE=3 SV=1 2749 3271 3.0E-29
sp|C1CB20|DLTA_STRP7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain 70585) GN=dltA PE=3 SV=1 2757 3271 3.0E-29
sp|A0AH92|DLTA_LISW6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dltA PE=3 SV=1 1015 1496 4.0E-29
sp|A2RE45|DLTA_STRPG D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=dltA PE=3 SV=1 2749 3271 4.0E-29
sp|Q1JGF0|DLTA_STRPD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=dltA PE=3 SV=1 2749 3271 4.0E-29
sp|Q8P0J9|DLTA_STRP8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=dltA PE=3 SV=1 2749 3271 4.0E-29
sp|Q1J667|DLTA_STRPF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=dltA PE=3 SV=1 2749 3271 4.0E-29
sp|P0C397|DLTA_STAAU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus GN=dltA PE=3 SV=1 2754 3273 5.0E-29
sp|P99107|DLTA_STAAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain N315) GN=dltA PE=1 SV=1 2754 3273 5.0E-29
sp|P68876|DLTA_STAAM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dltA PE=3 SV=1 2754 3273 5.0E-29
sp|A5IRB0|DLTA_STAA9 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH9) GN=dltA PE=3 SV=1 2754 3273 5.0E-29
sp|A6U039|DLTA_STAA2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH1) GN=dltA PE=3 SV=1 2754 3273 5.0E-29
sp|A7X0D6|DLTA_STAA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dltA PE=3 SV=1 2754 3273 5.0E-29
sp|Q8CT93|DLTA_STAES D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dltA PE=3 SV=1 993 1499 6.0E-29
sp|Q6FMI5|LYS2_CANGA L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 990 1623 7.0E-29
sp|C1CNE9|DLTA_STRZP D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain P1031) GN=dltA PE=3 SV=1 2757 3271 8.0E-29
sp|P0A399|DLTA_STRR6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=dltA PE=3 SV=1 2757 3271 8.0E-29
sp|P0A398|DLTA_STRPN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dltA PE=3 SV=1 2757 3271 8.0E-29
sp|Q04HZ7|DLTA_STRP2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=dltA PE=3 SV=1 2757 3271 8.0E-29
sp|P0DA65|DLTA_STRPQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=dltA PE=3 SV=1 2749 3271 9.0E-29
sp|P0DA64|DLTA_STRP3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=dltA PE=3 SV=1 2749 3271 9.0E-29
sp|Q1JLB7|DLTA_STRPC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=dltA PE=3 SV=1 2749 3271 1.0E-28
sp|Q5XBN5|DLTA_STRP6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=dltA PE=1 SV=1 2749 3271 1.0E-28
sp|Q99ZA6|DLTA_STRP1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M1 GN=dltA PE=1 SV=1 2749 3271 1.0E-28
sp|Q53526|DLTA_STRMU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dltA PE=3 SV=4 2779 3271 1.0E-28
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 31 297 2.0E-28
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 28 380 2.0E-28
sp|Q5HQN0|DLTA_STAEQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dltA PE=3 SV=1 993 1499 2.0E-28
sp|Q4L4U5|DLTA_STAHJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=dltA PE=3 SV=1 1007 1496 2.0E-28
sp|Q73XY1|MBTB_MYCPA Phenyloxazoline synthase MbtB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mbtB PE=3 SV=1 2743 3274 3.0E-28
sp|C1CU95|DLTA_STRZT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=dltA PE=3 SV=1 2757 3271 6.0E-28
sp|B8ZQ14|DLTA_STRPJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=dltA PE=3 SV=1 2757 3271 6.0E-28
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 2612 3227 9.0E-28
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 2701 3244 1.0E-27
sp|Q53526|DLTA_STRMU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dltA PE=3 SV=4 1013 1496 2.0E-27
sp|Q75BB3|LYS2_ASHGO L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 1015 1586 5.0E-27
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 31 386 1.0E-26
sp|C1CB20|DLTA_STRP7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain 70585) GN=dltA PE=3 SV=1 995 1496 2.0E-26
sp|C1CNE9|DLTA_STRZP D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain P1031) GN=dltA PE=3 SV=1 995 1496 2.0E-26
sp|P0A399|DLTA_STRR6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=dltA PE=3 SV=1 995 1496 2.0E-26
sp|P0A398|DLTA_STRPN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dltA PE=3 SV=1 995 1496 2.0E-26
sp|Q04HZ7|DLTA_STRP2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=dltA PE=3 SV=1 995 1496 2.0E-26
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 2762 3314 3.0E-26
sp|Q9CG49|DLTA_LACLA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dltA PE=3 SV=1 1014 1496 3.0E-26
sp|Q9X2N4|DLTA_STAXY D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus xylosus GN=dltA PE=3 SV=1 1015 1496 3.0E-26
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 1303 1590 4.0E-26
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 2740 3278 1.0E-25
sp|C1CU95|DLTA_STRZT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=dltA PE=3 SV=1 995 1496 1.0E-25
sp|B8ZQ14|DLTA_STRPJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=dltA PE=3 SV=1 995 1496 1.0E-25
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 405 818 2.0E-25
sp|Q4L235|ACSF4_HUMAN Acyl-CoA synthetase family member 4 OS=Homo sapiens GN=AASDH PE=1 SV=3 1140 1562 2.0E-25
sp|Q88VM6|DLTA_LACPL D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=dltA PE=3 SV=1 1016 1496 1.0E-24
sp|Q00868|ESYN_GIBPU Enniatin synthase (Fragment) OS=Gibberella pulicaris PE=3 SV=2 1057 1406 3.0E-24
sp|B5XLX5|DLTA_STRPZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=dltA PE=3 SV=1 1142 1496 4.0E-24
sp|Q48SZ3|DLTA_STRPM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=dltA PE=3 SV=1 1142 1496 4.0E-24
sp|A2RE45|DLTA_STRPG D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=dltA PE=3 SV=1 1142 1496 4.0E-24
sp|Q1JGF0|DLTA_STRPD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=dltA PE=3 SV=1 1142 1496 4.0E-24
sp|Q8P0J9|DLTA_STRP8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=dltA PE=3 SV=1 1142 1496 4.0E-24
sp|Q1J667|DLTA_STRPF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=dltA PE=3 SV=1 1142 1496 4.0E-24
sp|P0DA65|DLTA_STRPQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=dltA PE=3 SV=1 1142 1496 5.0E-24
sp|P0DA64|DLTA_STRP3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=dltA PE=3 SV=1 1142 1496 5.0E-24
sp|Q1JLB7|DLTA_STRPC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=dltA PE=3 SV=1 1142 1496 5.0E-24
sp|Q5XBN5|DLTA_STRP6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=dltA PE=1 SV=1 1142 1496 5.0E-24
sp|Q99ZA6|DLTA_STRP1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M1 GN=dltA PE=1 SV=1 1142 1496 5.0E-24
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 433 853 8.0E-24
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 3044 3318 9.0E-24
sp|P41636|4CL_PINTA 4-coumarate--CoA ligase OS=Pinus taeda GN=4CL PE=2 SV=1 2748 3281 5.0E-23
sp|Q00868|ESYN_GIBPU Enniatin synthase (Fragment) OS=Gibberella pulicaris PE=3 SV=2 2821 3175 1.0E-22
sp|Q80WC9|ACSF4_MOUSE Acyl-CoA synthetase family member 4 OS=Mus musculus GN=Aasdh PE=2 SV=1 1140 1562 2.0E-22
sp|Q12572|LYS2_CANAX L-2-aminoadipate reductase large subunit OS=Candida albicans GN=LYS2 PE=3 SV=2 1038 1569 4.0E-22
sp|C0MBD6|DLTA_STRE4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus equi subsp. equi (strain 4047) GN=dltA PE=3 SV=1 1142 1496 5.0E-22
sp|Q9X2N4|DLTA_STAXY D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus xylosus GN=dltA PE=3 SV=1 2758 3273 3.0E-21
sp|F4K1G2|AEE19_ARATH Putative acyl-activating enzyme 19 OS=Arabidopsis thaliana GN=At5g35930 PE=2 SV=1 1053 1560 5.0E-21
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 438 853 1.0E-20
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 545 955 3.0E-20
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 19 293 3.0E-20
sp|F4K1G2|AEE19_ARATH Putative acyl-activating enzyme 19 OS=Arabidopsis thaliana GN=At5g35930 PE=2 SV=1 2812 3271 3.0E-20
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 21 283 4.0E-20
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 35 276 6.0E-20
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 457 874 1.0E-19
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 417 871 3.0E-19
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 6 270 5.0E-19
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 29 294 1.0E-18
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 21 265 1.0E-18
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 541 996 1.0E-18
sp|Q5RG49|ACSF4_DANRE Acyl-CoA synthetase family member 4 OS=Danio rerio GN=aasdh PE=3 SV=1 1140 1560 2.0E-18
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 551 872 3.0E-18
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 25 293 4.0E-18
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 549 878 4.0E-18
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 2083 2404 8.0E-18
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 31 283 9.0E-18
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 2761 3316 1.0E-17
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 2088 2422 2.0E-17
sp|Q84P24|4CLL6_ARATH 4-coumarate--CoA ligase-like 6 OS=Arabidopsis thaliana GN=4CLL6 PE=2 SV=2 2767 3272 2.0E-17
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 26 311 3.0E-17
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 35 276 3.0E-17
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 35 276 4.0E-17
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 2079 2374 4.0E-17
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 27 336 5.0E-17
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 7 294 5.0E-17
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 2083 2494 5.0E-17
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 2087 2422 2.0E-16
sp|Q4L235|ACSF4_HUMAN Acyl-CoA synthetase family member 4 OS=Homo sapiens GN=AASDH PE=1 SV=3 2906 3318 2.0E-16
sp|Q84P21|4CLL5_ARATH 4-coumarate--CoA ligase-like 5 OS=Arabidopsis thaliana GN=4CLL5 PE=1 SV=2 2771 3271 2.0E-16
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 429 834 3.0E-16
sp|Q1AXQ5|ACSA_RUBXD Acetyl-coenzyme A synthetase OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=acsA PE=3 SV=1 2734 3272 4.0E-16
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 2056 2435 5.0E-16
sp|Q8DKH2|ACSA_THEEB Acetyl-coenzyme A synthetase OS=Thermosynechococcus elongatus (strain BP-1) GN=acsA PE=3 SV=1 2778 3272 1.0E-15
sp|Q80WC9|ACSF4_MOUSE Acyl-CoA synthetase family member 4 OS=Mus musculus GN=Aasdh PE=2 SV=1 2906 3273 2.0E-15
sp|Q84P23|4CLL9_ARATH 4-coumarate--CoA ligase-like 9 OS=Arabidopsis thaliana GN=4CLL9 PE=1 SV=2 2777 3273 2.0E-15
sp|C8VTR6|Y0074_EMENI Putative acyl-coenzyme A synthetase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN10074 PE=3 SV=1 1035 1497 3.0E-15
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 26 293 4.0E-15
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 2082 2406 4.0E-15
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 553 871 5.0E-15
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 433 851 7.0E-15
sp|Q9S725|4CL2_ARATH 4-coumarate--CoA ligase 2 OS=Arabidopsis thaliana GN=4CL2 PE=1 SV=2 991 1498 9.0E-15
sp|Q10S72|4CLL4_ORYSJ 4-coumarate--CoA ligase-like 4 OS=Oryza sativa subsp. japonica GN=4CLL4 PE=2 SV=1 1137 1418 1.0E-14
sp|Q9AJS8|3HBCL_THAAR 3-hydroxybenzoate--CoA/4-hydroxybenzoate--CoA ligase OS=Thauera aromatica GN=hcl PE=1 SV=1 2778 3273 1.0E-14
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 420 851 2.0E-14
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 437 853 2.0E-14
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2084 2404 2.0E-14
sp|Q54P78|4CL2_DICDI Probable 4-coumarate--CoA ligase 2 OS=Dictyostelium discoideum GN=4cl2 PE=3 SV=1 2839 3273 2.0E-14
sp|O07610|LCFB_BACSU Long-chain-fatty-acid--CoA ligase OS=Bacillus subtilis (strain 168) GN=lcfB PE=2 SV=2 2765 3273 3.0E-14
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2084 2404 4.0E-14
sp|Q84P24|4CLL6_ARATH 4-coumarate--CoA ligase-like 6 OS=Arabidopsis thaliana GN=4CLL6 PE=2 SV=2 1038 1406 4.0E-14
sp|O74976|FAT2_SCHPO Putative peroxisomal-coenzyme A synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.03c PE=1 SV=1 1137 1494 4.0E-14
sp|B7NVY2|AAS_ECO7I Bifunctional protein Aas OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=aas PE=3 SV=1 1143 1498 5.0E-14
sp|B1LR34|AAS_ECOSM Bifunctional protein Aas OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=aas PE=3 SV=1 1143 1498 5.0E-14
sp|Q83JV7|AAS_SHIFL Bifunctional protein Aas OS=Shigella flexneri GN=aas PE=3 SV=1 1143 1498 5.0E-14
sp|Q0T128|AAS_SHIF8 Bifunctional protein Aas OS=Shigella flexneri serotype 5b (strain 8401) GN=aas PE=3 SV=1 1143 1498 5.0E-14
sp|B7N768|AAS_ECOLU Bifunctional protein Aas OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=aas PE=3 SV=1 1143 1498 5.0E-14
sp|Q8FEA6|AAS_ECOL6 Bifunctional protein Aas OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=aas PE=3 SV=1 1143 1498 5.0E-14
sp|B7UHQ4|AAS_ECO27 Bifunctional protein Aas OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=aas PE=3 SV=1 1143 1498 5.0E-14
sp|B5Z4F4|AAS_ECO5E Bifunctional protein Aas OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=aas PE=3 SV=1 1143 1498 6.0E-14
sp|Q8X6J8|AAS_ECO57 Bifunctional protein Aas OS=Escherichia coli O157:H7 GN=aas PE=3 SV=1 1143 1498 6.0E-14
sp|B7LNJ2|AAS_ESCF3 Bifunctional protein Aas OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=aas PE=3 SV=1 1143 1498 6.0E-14
sp|Q3YY21|AAS_SHISS Bifunctional protein Aas OS=Shigella sonnei (strain Ss046) GN=aas PE=3 SV=1 1143 1498 6.0E-14
sp|B6I6W1|AAS_ECOSE Bifunctional protein Aas OS=Escherichia coli (strain SE11) GN=aas PE=3 SV=1 1143 1498 6.0E-14
sp|B7LF13|AAS_ECO55 Bifunctional protein Aas OS=Escherichia coli (strain 55989 / EAEC) GN=aas PE=3 SV=1 1143 1498 6.0E-14
sp|Q0TDZ6|AAS_ECOL5 Bifunctional protein Aas OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=aas PE=3 SV=1 1143 1498 6.0E-14
sp|P31119|AAS_ECOLI Bifunctional protein Aas OS=Escherichia coli (strain K12) GN=aas PE=1 SV=2 1143 1498 6.0E-14
sp|B1XDP2|AAS_ECODH Bifunctional protein Aas OS=Escherichia coli (strain K12 / DH10B) GN=aas PE=3 SV=1 1143 1498 6.0E-14
sp|C4ZZY9|AAS_ECOBW Bifunctional protein Aas OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=aas PE=3 SV=1 1143 1498 6.0E-14
sp|B1IU08|AAS_ECOLC Bifunctional protein Aas OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=aas PE=3 SV=1 1143 1498 6.0E-14
sp|A8A3X0|AAS_ECOHS Bifunctional protein Aas OS=Escherichia coli O9:H4 (strain HS) GN=aas PE=3 SV=1 1143 1498 6.0E-14
sp|A7ZQU2|AAS_ECO24 Bifunctional protein Aas OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=aas PE=3 SV=1 1143 1498 6.0E-14
sp|Q84HC5|NCSB2_STRCZ 2-hydroxy-7-methoxy-5-methyl-1-naphthoate--CoA ligase OS=Streptomyces carzinostaticus GN=ncsB2 PE=1 SV=1 2778 3279 7.0E-14
sp|B2TYQ5|AAS_SHIB3 Bifunctional protein Aas OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=aas PE=3 SV=1 1143 1498 7.0E-14
sp|Q1R7H5|AAS_ECOUT Bifunctional protein Aas OS=Escherichia coli (strain UTI89 / UPEC) GN=aas PE=3 SV=1 1143 1498 7.0E-14
sp|A1AF47|AAS_ECOK1 Bifunctional protein Aas OS=Escherichia coli O1:K1 / APEC GN=aas PE=3 SV=1 1143 1498 7.0E-14
sp|B7MLI2|AAS_ECO45 Bifunctional protein Aas OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=aas PE=3 SV=1 1143 1498 7.0E-14
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 2082 2372 9.0E-14
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 438 851 1.0E-13
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 21 297 1.0E-13
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 2083 2404 1.0E-13
sp|P17814|4CL1_ORYSJ Probable 4-coumarate--CoA ligase 1 OS=Oryza sativa subsp. japonica GN=4CL1 PE=2 SV=2 1052 1497 1.0E-13
sp|Q336M7|4CLL2_ORYSJ 4-coumarate--CoA ligase-like 2 OS=Oryza sativa subsp. japonica GN=4CLL2 PE=3 SV=3 1143 1420 1.0E-13
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 438 851 2.0E-13
sp|C8VTR6|Y0074_EMENI Putative acyl-coenzyme A synthetase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN10074 PE=3 SV=1 2778 3282 2.0E-13
sp|Q9M0X9|4CLL7_ARATH 4-coumarate--CoA ligase-like 7 OS=Arabidopsis thaliana GN=4CLL7 PE=1 SV=1 2761 3274 2.0E-13
sp|Q8RU95|4CLL6_ORYSJ 4-coumarate--CoA ligase-like 6 OS=Oryza sativa subsp. japonica GN=4CLL6 PE=2 SV=2 1143 1418 2.0E-13
sp|P9WQE1|PPSE_MYCTU Phthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsE PE=1 SV=1 1509 1966 2.0E-13
sp|P9WQE0|PPSE_MYCTO Phthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsE PE=3 SV=1 1509 1966 2.0E-13
sp|Q7TXL6|PPSE_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsE PE=1 SV=1 1509 1966 3.0E-13
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 433 853 4.0E-13
sp|Q1AXQ5|ACSA_RUBXD Acetyl-coenzyme A synthetase OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=acsA PE=3 SV=1 1140 1499 4.0E-13
sp|Q8ZES9|LCFA_YERPE Long-chain-fatty-acid--CoA ligase OS=Yersinia pestis GN=fadD PE=3 SV=1 2736 3274 4.0E-13
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 1 273 5.0E-13
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 29 273 5.0E-13
sp|Q9AJS8|3HBCL_THAAR 3-hydroxybenzoate--CoA/4-hydroxybenzoate--CoA ligase OS=Thauera aromatica GN=hcl PE=1 SV=1 1002 1497 5.0E-13
sp|P63521|LCFA_SALTY Long-chain-fatty-acid--CoA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fadD PE=3 SV=1 1006 1497 5.0E-13
sp|P63522|LCFA_SALTI Long-chain-fatty-acid--CoA ligase OS=Salmonella typhi GN=fadD PE=3 SV=1 1006 1497 5.0E-13
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 2084 2372 6.0E-13
sp|P46450|LCFA_HAEIN Long-chain-fatty-acid--CoA ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fadD PE=3 SV=1 997 1497 6.0E-13
sp|Q8RU95|4CLL6_ORYSJ 4-coumarate--CoA ligase-like 6 OS=Oryza sativa subsp. japonica GN=4CLL6 PE=2 SV=2 2907 3281 7.0E-13
sp|O24145|4CL1_TOBAC 4-coumarate--CoA ligase 1 OS=Nicotiana tabacum GN=4CL1 PE=2 SV=1 1137 1498 7.0E-13
sp|Q6ZAC1|4CL5_ORYSJ Probable 4-coumarate--CoA ligase 5 OS=Oryza sativa subsp. japonica GN=4CL5 PE=2 SV=1 2754 3274 8.0E-13
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 436 968 9.0E-13
sp|Q91VE0|S27A4_MOUSE Long-chain fatty acid transport protein 4 OS=Mus musculus GN=Slc27a4 PE=1 SV=1 2762 3275 9.0E-13
sp|Q8XBV3|ENTE_ECO57 Enterobactin synthase component E OS=Escherichia coli O157:H7 GN=entE PE=3 SV=1 1012 1497 1.0E-12
sp|B4T503|AAS_SALNS Bifunctional protein Aas OS=Salmonella newport (strain SL254) GN=aas PE=3 SV=1 1137 1498 1.0E-12
sp|B5BFH6|AAS_SALPK Bifunctional protein Aas OS=Salmonella paratyphi A (strain AKU_12601) GN=aas PE=3 SV=1 1137 1498 1.0E-12
sp|Q5PEN7|AAS_SALPA Bifunctional protein Aas OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=aas PE=3 SV=1 1137 1498 1.0E-12
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2138 2372 2.0E-12
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 32 282 2.0E-12
sp|P41636|4CL_PINTA 4-coumarate--CoA ligase OS=Pinus taeda GN=4CL PE=2 SV=1 1063 1498 2.0E-12
sp|A6TDH2|AAS_KLEP7 Bifunctional protein Aas OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=aas PE=3 SV=1 1137 1497 2.0E-12
sp|B5F4V4|AAS_SALA4 Bifunctional protein Aas OS=Salmonella agona (strain SL483) GN=aas PE=3 SV=1 1137 1498 2.0E-12
sp|B5RDY6|AAS_SALG2 Bifunctional protein Aas OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=aas PE=3 SV=1 1137 1498 2.0E-12
sp|A9N3H8|AAS_SALPB Bifunctional protein Aas OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=aas PE=3 SV=1 1137 1498 2.0E-12
sp|Q8ZMA4|AAS_SALTY Bifunctional protein Aas OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=aas PE=3 SV=1 1137 1498 2.0E-12
sp|B4TUM9|AAS_SALSV Bifunctional protein Aas OS=Salmonella schwarzengrund (strain CVM19633) GN=aas PE=3 SV=1 1137 1498 2.0E-12
sp|B4TGR5|AAS_SALHS Bifunctional protein Aas OS=Salmonella heidelberg (strain SL476) GN=aas PE=3 SV=1 1137 1498 2.0E-12
sp|B5QWU2|AAS_SALEP Bifunctional protein Aas OS=Salmonella enteritidis PT4 (strain P125109) GN=aas PE=3 SV=1 1137 1498 2.0E-12
sp|Q8Z406|AAS_SALTI Bifunctional protein Aas OS=Salmonella typhi GN=aas PE=3 SV=1 1137 1498 2.0E-12
sp|Q6ETN3|4CL3_ORYSJ Probable 4-coumarate--CoA ligase 3 OS=Oryza sativa subsp. japonica GN=4CL3 PE=2 SV=1 2759 3272 2.0E-12
sp|C0PXJ8|AAS_SALPC Bifunctional protein Aas OS=Salmonella paratyphi C (strain RKS4594) GN=aas PE=3 SV=1 1143 1498 2.0E-12
sp|Q57KA7|AAS_SALCH Bifunctional protein Aas OS=Salmonella choleraesuis (strain SC-B67) GN=aas PE=3 SV=1 1143 1498 2.0E-12
sp|Q42982|4CL2_ORYSJ Probable 4-coumarate--CoA ligase 2 OS=Oryza sativa subsp. japonica GN=4CL2 PE=2 SV=2 1135 1498 2.0E-12
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 21 246 3.0E-12
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 2087 2424 3.0E-12
sp|Q8ZES9|LCFA_YERPE Long-chain-fatty-acid--CoA ligase OS=Yersinia pestis GN=fadD PE=3 SV=1 1006 1497 3.0E-12
sp|Q6ZAC1|4CL5_ORYSJ Probable 4-coumarate--CoA ligase 5 OS=Oryza sativa subsp. japonica GN=4CL5 PE=2 SV=1 993 1498 3.0E-12
sp|P80436|TRS1_STRTI Triostin synthetase I OS=Streptomyces triostinicus GN=trsA PE=1 SV=2 1132 1502 3.0E-12
sp|B5FUB9|AAS_SALDC Bifunctional protein Aas OS=Salmonella dublin (strain CT_02021853) GN=aas PE=3 SV=1 1137 1498 3.0E-12
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 2507 2769 4.0E-12
sp|Q10S72|4CLL4_ORYSJ 4-coumarate--CoA ligase-like 4 OS=Oryza sativa subsp. japonica GN=4CLL4 PE=2 SV=1 2802 3175 4.0E-12
sp|A8AP56|AAS_CITK8 Bifunctional protein Aas OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=aas PE=3 SV=1 1137 1498 4.0E-12
sp|P08659|LUCI_PHOPY Luciferin 4-monooxygenase OS=Photinus pyralis PE=1 SV=1 1143 1499 4.0E-12
sp|C5D6U5|MENE_GEOSW 2-succinylbenzoate--CoA ligase OS=Geobacillus sp. (strain WCH70) GN=menE PE=3 SV=1 2766 3273 4.0E-12
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 19 273 5.0E-12
sp|Q8Z406|AAS_SALTI Bifunctional protein Aas OS=Salmonella typhi GN=aas PE=3 SV=1 2901 3272 5.0E-12
sp|Q6ETN3|4CL3_ORYSJ Probable 4-coumarate--CoA ligase 3 OS=Oryza sativa subsp. japonica GN=4CL3 PE=2 SV=1 1016 1455 6.0E-12
sp|P38135|FADK_ECOLI Short-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadK PE=1 SV=3 1016 1497 6.0E-12
sp|Q9I4X3|PQSA_PSEAE Anthranilate--CoA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pqsA PE=1 SV=1 1137 1512 6.0E-12
sp|Q54P77|4CL1_DICDI Probable 4-coumarate--CoA ligase 1 OS=Dictyostelium discoideum GN=4cl1 PE=3 SV=1 2839 3273 7.0E-12
sp|Q84P23|4CLL9_ARATH 4-coumarate--CoA ligase-like 9 OS=Arabidopsis thaliana GN=4CLL9 PE=1 SV=2 1143 1501 8.0E-12
sp|P10378|ENTE_ECOLI Enterobactin synthase component E OS=Escherichia coli (strain K12) GN=entE PE=1 SV=3 1012 1497 8.0E-12
sp|P69451|LCFA_ECOLI Long-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadD PE=1 SV=1 1006 1497 8.0E-12
sp|P69452|LCFA_ECOL6 Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fadD PE=3 SV=1 1006 1497 8.0E-12
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 2067 2429 9.0E-12
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 26 408 1.0E-11
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 32 273 1.0E-11
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 29 245 1.0E-11
sp|B4T503|AAS_SALNS Bifunctional protein Aas OS=Salmonella newport (strain SL254) GN=aas PE=3 SV=1 2901 3272 1.0E-11
sp|B5BFH6|AAS_SALPK Bifunctional protein Aas OS=Salmonella paratyphi A (strain AKU_12601) GN=aas PE=3 SV=1 2901 3272 1.0E-11
sp|Q5PEN7|AAS_SALPA Bifunctional protein Aas OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=aas PE=3 SV=1 2901 3272 1.0E-11
sp|C0PXJ8|AAS_SALPC Bifunctional protein Aas OS=Salmonella paratyphi C (strain RKS4594) GN=aas PE=3 SV=1 2901 3272 1.0E-11
sp|Q57KA7|AAS_SALCH Bifunctional protein Aas OS=Salmonella choleraesuis (strain SC-B67) GN=aas PE=3 SV=1 2901 3272 1.0E-11
sp|Q5REV5|ACSM3_PONAB Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Pongo abelii GN=ACSM3 PE=2 SV=1 1138 1497 1.0E-11
sp|B5XUP2|AAS_KLEP3 Bifunctional protein Aas OS=Klebsiella pneumoniae (strain 342) GN=aas PE=3 SV=1 1137 1497 1.0E-11
sp|Q6AYT9|ACSM5_RAT Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Rattus norvegicus GN=Acsm5 PE=2 SV=1 2903 3274 1.0E-11
sp|Q53FZ2|ACSM3_HUMAN Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Homo sapiens GN=ACSM3 PE=1 SV=2 1138 1497 1.0E-11
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 29 273 2.0E-11
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 29 273 2.0E-11
sp|O24145|4CL1_TOBAC 4-coumarate--CoA ligase 1 OS=Nicotiana tabacum GN=4CL1 PE=2 SV=1 2727 3272 2.0E-11
sp|B5F4V4|AAS_SALA4 Bifunctional protein Aas OS=Salmonella agona (strain SL483) GN=aas PE=3 SV=1 2901 3272 2.0E-11
sp|B5RDY6|AAS_SALG2 Bifunctional protein Aas OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=aas PE=3 SV=1 2901 3272 2.0E-11
sp|A9N3H8|AAS_SALPB Bifunctional protein Aas OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=aas PE=3 SV=1 2901 3272 2.0E-11
sp|Q8ZMA4|AAS_SALTY Bifunctional protein Aas OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=aas PE=3 SV=1 2901 3272 2.0E-11
sp|B4TUM9|AAS_SALSV Bifunctional protein Aas OS=Salmonella schwarzengrund (strain CVM19633) GN=aas PE=3 SV=1 2901 3272 2.0E-11
sp|B4TGR5|AAS_SALHS Bifunctional protein Aas OS=Salmonella heidelberg (strain SL476) GN=aas PE=3 SV=1 2901 3272 2.0E-11
sp|B5QWU2|AAS_SALEP Bifunctional protein Aas OS=Salmonella enteritidis PT4 (strain P125109) GN=aas PE=3 SV=1 2901 3272 2.0E-11
sp|P69451|LCFA_ECOLI Long-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadD PE=1 SV=1 2736 3274 2.0E-11
sp|P69452|LCFA_ECOL6 Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fadD PE=3 SV=1 2736 3274 2.0E-11
sp|Q65FT5|MENE_BACLD 2-succinylbenzoate--CoA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=menE PE=3 SV=1 995 1496 2.0E-11
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 2079 2406 3.0E-11
sp|P9WQ55|FAD10_MYCTU Putative fatty-acid--CoA ligase FadD10 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD10 PE=1 SV=1 2748 3169 3.0E-11
sp|P9WQ54|FAD10_MYCTO Putative fatty-acid--CoA ligase FadD10 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD10 PE=4 SV=1 2748 3169 3.0E-11
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 28 293 4.0E-11
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 1137 1587 4.0E-11
sp|Q6NUN0|ACSM5_HUMAN Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Homo sapiens GN=ACSM5 PE=1 SV=2 1141 1498 4.0E-11
sp|Q8XDR6|LCFA_ECO57 Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O157:H7 GN=fadD PE=3 SV=1 2736 3274 4.0E-11
sp|Q67W82|4CL4_ORYSJ Probable 4-coumarate--CoA ligase 4 OS=Oryza sativa subsp. japonica GN=4CL4 PE=2 SV=1 2763 3274 5.0E-11
sp|A7Z809|MENE_BACMF 2-succinylbenzoate--CoA ligase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=menE PE=3 SV=1 995 1499 5.0E-11
sp|Q67W82|4CL4_ORYSJ Probable 4-coumarate--CoA ligase 4 OS=Oryza sativa subsp. japonica GN=4CL4 PE=2 SV=1 1135 1498 6.0E-11
sp|Q6HC29|MENE_BACHK 2-succinylbenzoate--CoA ligase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=menE PE=3 SV=1 2766 3273 6.0E-11
sp|B7JDD6|MENE_BACC0 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain AH820) GN=menE PE=3 SV=1 2766 3273 6.0E-11
sp|P09095|TYCA_BREPA Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 7 246 7.0E-11
sp|Q9S777|4CL3_ARATH 4-coumarate--CoA ligase 3 OS=Arabidopsis thaliana GN=4CL3 PE=1 SV=1 1145 1498 7.0E-11
sp|B5FUB9|AAS_SALDC Bifunctional protein Aas OS=Salmonella dublin (strain CT_02021853) GN=aas PE=3 SV=1 2901 3272 8.0E-11
sp|Q6YYZ2|4CLL3_ORYSJ 4-coumarate--CoA ligase-like 3 OS=Oryza sativa subsp. japonica GN=4CLL3 PE=3 SV=1 2896 3280 8.0E-11
sp|C3LB87|MENE_BACAC 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=menE PE=3 SV=1 2766 3273 8.0E-11
sp|C3PCK3|MENE_BACAA 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis (strain A0248) GN=menE PE=3 SV=1 2766 3273 8.0E-11
sp|P10378|ENTE_ECOLI Enterobactin synthase component E OS=Escherichia coli (strain K12) GN=entE PE=1 SV=3 2752 3273 9.0E-11
sp|Q81K97|MENE_BACAN 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis GN=menE PE=3 SV=1 2766 3273 9.0E-11
sp|P9WQD1|ACSA_MYCTU Acetyl-coenzyme A synthetase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=acsA PE=1 SV=1 2905 3286 9.0E-11
sp|P9WQD0|ACSA_MYCTO Acetyl-coenzyme A synthetase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=acsA PE=3 SV=1 2905 3286 9.0E-11
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 2083 2445 1.0E-10
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 29 204 1.0E-10
sp|Q8XBV3|ENTE_ECO57 Enterobactin synthase component E OS=Escherichia coli O157:H7 GN=entE PE=3 SV=1 2752 3273 1.0E-10
sp|P80436|TRS1_STRTI Triostin synthetase I OS=Streptomyces triostinicus GN=trsA PE=1 SV=2 2778 3272 1.0E-10
sp|P59871|ACSA_MYCBO Acetyl-coenzyme A synthetase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=acsA PE=3 SV=1 2905 3286 1.0E-10
sp|Q5LRT0|DMDB_RUEPO 3-methylmercaptopropionyl-CoA ligase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=dmdB PE=1 SV=1 1138 1497 1.0E-10
sp|P14913|4CL2_PETCR 4-coumarate--CoA ligase 1 OS=Petroselinum crispum GN=4CL2 PE=2 SV=1 2754 3274 1.0E-10
sp|O93730|ACSA_PYRAE Acetyl-coenzyme A synthetase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=acsA PE=3 SV=2 2778 3286 1.0E-10
sp|Q01576|ACSA_PHYB8 Acetyl-coenzyme A synthetase OS=Phycomyces blakesleeanus (strain ATCC 8743b / FGSC 10004 / NBRC 33097 / NRRL 1555) GN=facA PE=2 SV=1 1141 1499 1.0E-10
sp|Q3UNX5|ACSM3_MOUSE Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Mus musculus GN=Acsm3 PE=1 SV=2 1140 1497 1.0E-10
sp|P27095|ACSA_METCN Acetyl-coenzyme A synthetase OS=Methanosaeta concilii GN=acsA PE=1 SV=1 2778 3286 1.0E-10
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 2083 2404 2.0E-10
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 2079 2406 2.0E-10
sp|P63521|LCFA_SALTY Long-chain-fatty-acid--CoA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fadD PE=3 SV=1 2736 3274 2.0E-10
sp|P63522|LCFA_SALTI Long-chain-fatty-acid--CoA ligase OS=Salmonella typhi GN=fadD PE=3 SV=1 2736 3274 2.0E-10
sp|P58730|MENE_LISMO 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=menE PE=3 SV=2 2907 3276 2.0E-10
sp|Q55404|ACSA_SYNY3 Acetyl-coenzyme A synthetase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=acsA PE=3 SV=1 1092 1499 2.0E-10
sp|P14912|4CL1_PETCR 4-coumarate--CoA ligase 1 OS=Petroselinum crispum GN=4CL1 PE=2 SV=1 2754 3272 2.0E-10
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 27 277 3.0E-10
sp|Q336M7|4CLL2_ORYSJ 4-coumarate--CoA ligase-like 2 OS=Oryza sativa subsp. japonica GN=4CLL2 PE=3 SV=3 2799 3175 3.0E-10
sp|P46450|LCFA_HAEIN Long-chain-fatty-acid--CoA ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fadD PE=3 SV=1 2762 3274 3.0E-10
sp|Q6NUN0|ACSM5_HUMAN Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Homo sapiens GN=ACSM5 PE=1 SV=2 2903 3274 3.0E-10
sp|Q8XDR6|LCFA_ECO57 Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O157:H7 GN=fadD PE=3 SV=1 1006 1497 3.0E-10
sp|Q3UNX5|ACSM3_MOUSE Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Mus musculus GN=Acsm3 PE=1 SV=2 2903 3274 3.0E-10
sp|Q499N5|ACSF2_RAT Acyl-CoA synthetase family member 2, mitochondrial OS=Rattus norvegicus GN=Acsf2 PE=2 SV=1 2869 3274 3.0E-10
sp|A0RK73|MENE_BACAH 2-succinylbenzoate--CoA ligase OS=Bacillus thuringiensis (strain Al Hakam) GN=menE PE=3 SV=1 2766 3273 3.0E-10
sp|P94547|LCFA_BACSU Long-chain-fatty-acid--CoA ligase OS=Bacillus subtilis (strain 168) GN=lcfA PE=3 SV=1 1129 1496 3.0E-10
sp|Q5REV5|ACSM3_PONAB Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Pongo abelii GN=ACSM3 PE=2 SV=1 2902 3274 4.0E-10
sp|Q6AYT9|ACSM5_RAT Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Rattus norvegicus GN=Acsm5 PE=2 SV=1 1141 1497 4.0E-10
sp|B7HTW3|MENE_BACC7 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain AH187) GN=menE PE=3 SV=1 2766 3273 4.0E-10
sp|B9J2F2|MENE_BACCQ 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain Q1) GN=menE PE=3 SV=1 2766 3273 4.0E-10
sp|Q72YK9|MENE_BACC1 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=menE PE=3 SV=1 2766 3273 4.0E-10
sp|Q9LU36|4CL4_ARATH 4-coumarate--CoA ligase 4 OS=Arabidopsis thaliana GN=4CL4 PE=1 SV=1 1131 1498 4.0E-10
sp|Q9M0X9|4CLL7_ARATH 4-coumarate--CoA ligase-like 7 OS=Arabidopsis thaliana GN=4CLL7 PE=1 SV=1 1015 1496 5.0E-10
sp|Q632I5|MENE_BACCZ 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ZK / E33L) GN=menE PE=3 SV=1 2766 3273 5.0E-10
sp|A8FNJ7|ACSA_CAMJ8 Acetyl-coenzyme A synthetase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=acsA PE=3 SV=1 1090 1499 5.0E-10
sp|A0B8F1|ACSA_METTP Acetyl-coenzyme A synthetase OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=acsA PE=1 SV=1 1137 1498 5.0E-10
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 21 245 6.0E-10
sp|Q53FZ2|ACSM3_HUMAN Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Homo sapiens GN=ACSM3 PE=1 SV=2 2902 3274 6.0E-10
sp|A1W1D6|ACSA_CAMJJ Acetyl-coenzyme A synthetase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=acsA PE=3 SV=1 1090 1499 6.0E-10
sp|Q9PMD2|ACSA_CAMJE Acetyl-coenzyme A synthetase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=acsA PE=3 SV=1 1090 1499 6.0E-10
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 29 246 7.0E-10
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 17 298 7.0E-10
sp|Q8BGA8|ACSM5_MOUSE Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Mus musculus GN=Acsm5 PE=1 SV=1 2903 3274 7.0E-10
sp|Q9BEA2|ACSM1_BOVIN Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Bos taurus GN=ACSM1 PE=1 SV=2 2903 3274 7.0E-10
sp|Q54P79|4CL3_DICDI Probable 4-coumarate--CoA ligase 3 OS=Dictyostelium discoideum GN=4cl3 PE=3 SV=2 2839 3273 8.0E-10
sp|Q9S725|4CL2_ARATH 4-coumarate--CoA ligase 2 OS=Arabidopsis thaliana GN=4CL2 PE=1 SV=2 2754 3272 9.0E-10
sp|Q42982|4CL2_ORYSJ Probable 4-coumarate--CoA ligase 2 OS=Oryza sativa subsp. japonica GN=4CL2 PE=2 SV=2 2754 3274 9.0E-10
sp|Q8BGA8|ACSM5_MOUSE Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Mus musculus GN=Acsm5 PE=1 SV=1 1143 1497 9.0E-10
sp|Q6SKG1|ACSM3_RAT Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Rattus norvegicus GN=Acsm3 PE=2 SV=1 2902 3274 9.0E-10
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 2067 2408 1.0E-09
sp|O74976|FAT2_SCHPO Putative peroxisomal-coenzyme A synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.03c PE=1 SV=1 2901 3269 1.0E-09
sp|C0SPB0|YTCI_BACSU Uncharacterized acyl--CoA ligase YtcI OS=Bacillus subtilis (strain 168) GN=ytcI PE=3 SV=1 2779 3284 1.0E-09
sp|Q84P25|4CLL2_ARATH 4-coumarate--CoA ligase-like 2 OS=Arabidopsis thaliana GN=4CLL2 PE=2 SV=2 2758 3175 1.0E-09
sp|Q6D107|AAS_PECAS Bifunctional protein Aas OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=aas PE=3 SV=1 2901 3273 1.0E-09
sp|Q750T7|ACS2_ASHGO Acetyl-coenzyme A synthetase 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ACS2 PE=3 SV=1 2722 3273 1.0E-09
sp|Q27757|LUCI_PHOPE Luciferin 4-monooxygenase OS=Photuris pensylvanica PE=2 SV=2 2750 3273 1.0E-09
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 2125 2406 2.0E-09
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 2078 2451 2.0E-09
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 452 698 2.0E-09
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 30 255 2.0E-09
sp|A6TDH2|AAS_KLEP7 Bifunctional protein Aas OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=aas PE=3 SV=1 2901 3176 2.0E-09
sp|Q65FT5|MENE_BACLD 2-succinylbenzoate--CoA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=menE PE=3 SV=1 2763 3271 2.0E-09
sp|Q84P25|4CLL2_ARATH 4-coumarate--CoA ligase-like 2 OS=Arabidopsis thaliana GN=4CLL2 PE=2 SV=2 1143 1406 2.0E-09
sp|C6DE43|AAS_PECCP Bifunctional protein Aas OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=aas PE=3 SV=1 2901 3267 2.0E-09
sp|Q7TN78|ACSM4_RAT Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Rattus norvegicus GN=Acsm4 PE=2 SV=1 1141 1497 2.0E-09
sp|Q71YZ5|MENE_LISMF 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=menE PE=3 SV=1 2779 3276 2.0E-09
sp|B5XUP2|AAS_KLEP3 Bifunctional protein Aas OS=Klebsiella pneumoniae (strain 342) GN=aas PE=3 SV=1 2901 3176 3.0E-09
sp|B2VFS7|AAS_ERWT9 Bifunctional protein Aas OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=aas PE=3 SV=1 1137 1499 3.0E-09
sp|P31685|4CL2_SOLTU 4-coumarate--CoA ligase 2 OS=Solanum tuberosum GN=4CL2 PE=3 SV=1 1137 1498 3.0E-09
sp|P31684|4CL1_SOLTU 4-coumarate--CoA ligase 1 OS=Solanum tuberosum GN=4CL1 PE=3 SV=1 1137 1498 3.0E-09
sp|Q69RG7|4CLL7_ORYSJ 4-coumarate--CoA ligase-like 7 OS=Oryza sativa subsp. japonica GN=4CLL7 PE=2 SV=1 1132 1424 3.0E-09
sp|P0C5B6|4CLL4_ARATH 4-coumarate--CoA ligase-like 4 OS=Arabidopsis thaliana GN=4CLL4 PE=2 SV=1 2741 3175 3.0E-09
sp|Q4R4Z9|ACSF2_MACFA Acyl-CoA synthetase family member 2, mitochondrial OS=Macaca fascicularis GN=ACSF2 PE=2 SV=1 1111 1497 3.0E-09
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 21 327 4.0E-09
sp|P17814|4CL1_ORYSJ Probable 4-coumarate--CoA ligase 1 OS=Oryza sativa subsp. japonica GN=4CL1 PE=2 SV=2 2888 3278 4.0E-09
sp|P9WQ55|FAD10_MYCTU Putative fatty-acid--CoA ligase FadD10 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD10 PE=1 SV=1 995 1493 4.0E-09
sp|P9WQ54|FAD10_MYCTO Putative fatty-acid--CoA ligase FadD10 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD10 PE=4 SV=1 995 1493 4.0E-09
sp|B5BL55|CAIC_SALPK Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi A (strain AKU_12601) GN=caiC PE=3 SV=1 2897 3272 4.0E-09
sp|Q5PIL0|CAIC_SALPA Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=caiC PE=3 SV=1 2897 3272 4.0E-09
sp|Q42524|4CL1_ARATH 4-coumarate--CoA ligase 1 OS=Arabidopsis thaliana GN=4CL1 PE=1 SV=1 1135 1498 4.0E-09
sp|A8ALR6|CAIC_CITK8 Probable crotonobetaine/carnitine-CoA ligase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=caiC PE=3 SV=1 2778 3272 4.0E-09
sp|Q816I1|MENE_BACCR 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=menE PE=3 SV=1 2766 3273 4.0E-09
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 27 244 5.0E-09
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 2083 2494 5.0E-09
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 2087 2469 5.0E-09
sp|Q83JV7|AAS_SHIFL Bifunctional protein Aas OS=Shigella flexneri GN=aas PE=3 SV=1 2901 3272 5.0E-09
sp|Q0T128|AAS_SHIF8 Bifunctional protein Aas OS=Shigella flexneri serotype 5b (strain 8401) GN=aas PE=3 SV=1 2901 3272 5.0E-09
sp|A8AP56|AAS_CITK8 Bifunctional protein Aas OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=aas PE=3 SV=1 2901 3272 5.0E-09
sp|O31826|YNGI_BACSU Putative acyl-CoA synthetase YngI OS=Bacillus subtilis (strain 168) GN=yngI PE=3 SV=1 1139 1504 5.0E-09
sp|O24146|4CL2_TOBAC 4-coumarate--CoA ligase 2 OS=Nicotiana tabacum GN=4CL2 PE=2 SV=1 1137 1498 5.0E-09
sp|A1JPF0|AAS_YERE8 Bifunctional protein Aas OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=aas PE=3 SV=1 1143 1492 5.0E-09
sp|C0SPB0|YTCI_BACSU Uncharacterized acyl--CoA ligase YtcI OS=Bacillus subtilis (strain 168) GN=ytcI PE=3 SV=1 1016 1509 6.0E-09
sp|P86832|CBCL2_ARTSP 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA2 PE=1 SV=1 994 1516 6.0E-09
sp|P86831|CBCL1_ARTSP 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA1 PE=1 SV=1 994 1516 6.0E-09
sp|A0R5G1|ACSA_MYCS2 Acetyl-coenzyme A synthetase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=acsA PE=3 SV=1 1141 1499 6.0E-09
sp|Q5SKN9|LCFCS_THET8 Long-chain-fatty-acid--CoA ligase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=TTHA0604 PE=1 SV=1 1143 1497 6.0E-09
sp|Q80W40|ACSM4_MOUSE Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Mus musculus GN=Acsm4 PE=2 SV=1 2881 3274 7.0E-09
sp|Q80W40|ACSM4_MOUSE Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Mus musculus GN=Acsm4 PE=2 SV=1 1143 1497 7.0E-09
sp|P0C7M7|ACSM4_HUMAN Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Homo sapiens GN=ACSM4 PE=2 SV=1 2905 3274 7.0E-09
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 30 251 8.0E-09
sp|Q84P21|4CLL5_ARATH 4-coumarate--CoA ligase-like 5 OS=Arabidopsis thaliana GN=4CLL5 PE=1 SV=2 991 1418 9.0E-09
sp|Q0TDZ6|AAS_ECOL5 Bifunctional protein Aas OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=aas PE=3 SV=1 2901 3272 9.0E-09
sp|P08659|LUCI_PHOPY Luciferin 4-monooxygenase OS=Photinus pyralis PE=1 SV=1 2778 3273 9.0E-09
sp|Q8VCW8|ACSF2_MOUSE Acyl-CoA synthetase family member 2, mitochondrial OS=Mus musculus GN=Acsf2 PE=1 SV=1 1111 1497 9.0E-09
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 2077 2363 1.0E-08
sp|B1LR34|AAS_ECOSM Bifunctional protein Aas OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=aas PE=3 SV=1 2901 3272 1.0E-08
sp|B7N768|AAS_ECOLU Bifunctional protein Aas OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=aas PE=3 SV=1 2901 3272 1.0E-08
sp|Q8FEA6|AAS_ECOL6 Bifunctional protein Aas OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=aas PE=3 SV=1 2901 3272 1.0E-08
sp|B7UHQ4|AAS_ECO27 Bifunctional protein Aas OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=aas PE=3 SV=1 2901 3272 1.0E-08
sp|B5Z4F4|AAS_ECO5E Bifunctional protein Aas OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=aas PE=3 SV=1 2901 3272 1.0E-08
sp|Q8X6J8|AAS_ECO57 Bifunctional protein Aas OS=Escherichia coli O157:H7 GN=aas PE=3 SV=1 2901 3272 1.0E-08
sp|Q3YY21|AAS_SHISS Bifunctional protein Aas OS=Shigella sonnei (strain Ss046) GN=aas PE=3 SV=1 2901 3272 1.0E-08
sp|B6I6W1|AAS_ECOSE Bifunctional protein Aas OS=Escherichia coli (strain SE11) GN=aas PE=3 SV=1 2901 3272 1.0E-08
sp|B7LF13|AAS_ECO55 Bifunctional protein Aas OS=Escherichia coli (strain 55989 / EAEC) GN=aas PE=3 SV=1 2901 3272 1.0E-08
sp|P31119|AAS_ECOLI Bifunctional protein Aas OS=Escherichia coli (strain K12) GN=aas PE=1 SV=2 2901 3272 1.0E-08
sp|B1XDP2|AAS_ECODH Bifunctional protein Aas OS=Escherichia coli (strain K12 / DH10B) GN=aas PE=3 SV=1 2901 3272 1.0E-08
sp|C4ZZY9|AAS_ECOBW Bifunctional protein Aas OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=aas PE=3 SV=1 2901 3272 1.0E-08
sp|B1IU08|AAS_ECOLC Bifunctional protein Aas OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=aas PE=3 SV=1 2901 3272 1.0E-08
sp|A8A3X0|AAS_ECOHS Bifunctional protein Aas OS=Escherichia coli O9:H4 (strain HS) GN=aas PE=3 SV=1 2901 3272 1.0E-08
sp|A7ZQU2|AAS_ECO24 Bifunctional protein Aas OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=aas PE=3 SV=1 2901 3272 1.0E-08
sp|Q1R7H5|AAS_ECOUT Bifunctional protein Aas OS=Escherichia coli (strain UTI89 / UPEC) GN=aas PE=3 SV=1 2901 3272 1.0E-08
sp|A1AF47|AAS_ECOK1 Bifunctional protein Aas OS=Escherichia coli O1:K1 / APEC GN=aas PE=3 SV=1 2901 3272 1.0E-08
sp|B7MLI2|AAS_ECO45 Bifunctional protein Aas OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=aas PE=3 SV=1 2901 3272 1.0E-08
sp|Q9I4X3|PQSA_PSEAE Anthranilate--CoA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pqsA PE=1 SV=1 2901 3273 1.0E-08
sp|Q9S777|4CL3_ARATH 4-coumarate--CoA ligase 3 OS=Arabidopsis thaliana GN=4CL3 PE=1 SV=1 2779 3274 1.0E-08
sp|Q9VLL0|ACSF4_DROME Acyl-CoA synthetase family member 4 homolog OS=Drosophila melanogaster GN=U26 PE=2 SV=3 1136 1415 1.0E-08
sp|O07619|YHFT_BACSU Uncharacterized acyl--CoA ligase YhfT OS=Bacillus subtilis (strain 168) GN=yhfT PE=2 SV=1 1132 1497 1.0E-08
sp|Q96CM8|ACSF2_HUMAN Acyl-CoA synthetase family member 2, mitochondrial OS=Homo sapiens GN=ACSF2 PE=1 SV=2 2832 3274 1.0E-08
sp|O07899|VIBE_VIBCH Vibriobactin-specific 2,3-dihydroxybenzoate-AMP ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=vibE PE=3 SV=1 1137 1503 1.0E-08
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 25 198 2.0E-08
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 27 222 2.0E-08
sp|B7NVY2|AAS_ECO7I Bifunctional protein Aas OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=aas PE=3 SV=1 2901 3272 2.0E-08
sp|B2TYQ5|AAS_SHIB3 Bifunctional protein Aas OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=aas PE=3 SV=1 2901 3272 2.0E-08
sp|Q499N5|ACSF2_RAT Acyl-CoA synthetase family member 2, mitochondrial OS=Rattus norvegicus GN=Acsf2 PE=2 SV=1 1111 1497 2.0E-08
sp|Q9LU36|4CL4_ARATH 4-coumarate--CoA ligase 4 OS=Arabidopsis thaliana GN=4CL4 PE=1 SV=1 2767 3281 2.0E-08
sp|O31826|YNGI_BACSU Putative acyl-CoA synthetase YngI OS=Bacillus subtilis (strain 168) GN=yngI PE=3 SV=1 2766 3274 2.0E-08
sp|O24146|4CL2_TOBAC 4-coumarate--CoA ligase 2 OS=Nicotiana tabacum GN=4CL2 PE=2 SV=1 2722 3274 2.0E-08
sp|Q3E6Y4|4CLL3_ARATH 4-coumarate--CoA ligase-like 3 OS=Arabidopsis thaliana GN=4CLL3 PE=2 SV=2 1038 1406 2.0E-08
sp|A9MYJ6|CAIC_SALPB Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=caiC PE=3 SV=1 2897 3272 2.0E-08
sp|B1JQC1|AAS_YERPY Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=aas PE=3 SV=1 1130 1492 2.0E-08
sp|Q667F1|AAS_YERPS Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=aas PE=3 SV=1 1130 1492 2.0E-08
sp|B2JZ75|AAS_YERPB Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=aas PE=3 SV=1 1130 1492 2.0E-08
sp|A7FFD1|AAS_YERP3 Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=aas PE=3 SV=1 1130 1492 2.0E-08
sp|B4TWR4|CAIC_SALSV Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella schwarzengrund (strain CVM19633) GN=caiC PE=3 SV=1 2897 3272 2.0E-08
sp|B4T6J6|CAIC_SALNS Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella newport (strain SL254) GN=caiC PE=3 SV=1 2897 3272 2.0E-08
sp|A4WJG1|ACSA_PYRAR Acetyl-coenzyme A synthetase OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=acsA PE=3 SV=1 2780 3314 2.0E-08
sp|Q57TJ0|CAIC_SALCH Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella choleraesuis (strain SC-B67) GN=caiC PE=3 SV=1 2897 3272 2.0E-08
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 9 290 3.0E-08
sp|B7LNJ2|AAS_ESCF3 Bifunctional protein Aas OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=aas PE=3 SV=1 2901 3272 3.0E-08
sp|Q9BEA2|ACSM1_BOVIN Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Bos taurus GN=ACSM1 PE=1 SV=2 1123 1497 3.0E-08
sp|A1JPF0|AAS_YERE8 Bifunctional protein Aas OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=aas PE=3 SV=1 2903 3267 3.0E-08
sp|Q8Z9L4|CAIC_SALTI Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella typhi GN=caiC PE=3 SV=1 2897 3272 3.0E-08
sp|C0Q4L3|CAIC_SALPC Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi C (strain RKS4594) GN=caiC PE=3 SV=1 2897 3272 3.0E-08
sp|P40871|DHBE_BACSU 2,3-dihydroxybenzoate-AMP ligase OS=Bacillus subtilis (strain 168) GN=dhbE PE=1 SV=2 2895 3273 3.0E-08
sp|P13129|LUCI_LUCCR Luciferin 4-monooxygenase OS=Luciola cruciata PE=1 SV=1 1143 1499 3.0E-08
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 27 244 4.0E-08
sp|Q7TN78|ACSM4_RAT Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Rattus norvegicus GN=Acsm4 PE=2 SV=1 2905 3274 4.0E-08
sp|Q69RG7|4CLL7_ORYSJ 4-coumarate--CoA ligase-like 7 OS=Oryza sativa subsp. japonica GN=4CLL7 PE=2 SV=1 2909 3286 4.0E-08
sp|P13129|LUCI_LUCCR Luciferin 4-monooxygenase OS=Luciola cruciata PE=1 SV=1 2779 3180 4.0E-08
sp|Q68CK6|ACS2B_HUMAN Acyl-coenzyme A synthetase ACSM2B, mitochondrial OS=Homo sapiens GN=ACSM2B PE=1 SV=2 2907 3284 4.0E-08
sp|Q9L9F6|NOVL_STRNV 8-demethylnovobiocic acid synthase OS=Streptomyces niveus GN=novL PE=1 SV=1 1116 1499 4.0E-08
sp|B5R1R0|CAIC_SALEP Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella enteritidis PT4 (strain P125109) GN=caiC PE=3 SV=1 2897 3272 4.0E-08
sp|B5F750|CAIC_SALA4 Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella agona (strain SL483) GN=caiC PE=3 SV=1 2897 3272 4.0E-08
sp|Q8EYG2|ACSA_LEPIN Acetyl-coenzyme A synthetase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=acsA PE=3 SV=1 1141 1499 4.0E-08
sp|Q72LY9|ACSA_LEPIC Acetyl-coenzyme A synthetase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=acsA PE=3 SV=1 1141 1499 5.0E-08
sp|Q74RZ6|AAS_YERPE Bifunctional protein Aas OS=Yersinia pestis GN=aas PE=3 SV=2 1130 1492 5.0E-08
sp|Q1CAS8|AAS_YERPA Bifunctional protein Aas OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=aas PE=3 SV=1 1130 1492 5.0E-08
sp|A4TLD3|AAS_YERPP Bifunctional protein Aas OS=Yersinia pestis (strain Pestoides F) GN=aas PE=3 SV=1 1130 1492 5.0E-08
sp|A9R2S1|AAS_YERPG Bifunctional protein Aas OS=Yersinia pestis bv. Antiqua (strain Angola) GN=aas PE=3 SV=1 1130 1492 5.0E-08
sp|Q7NSY7|ACSA_CHRVO Acetyl-coenzyme A synthetase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=acsA PE=3 SV=1 1141 1524 5.0E-08
sp|P0C061|GRSA_ANEMI Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 17 209 6.0E-08
sp|P0C062|GRSA_BREBE Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 17 209 6.0E-08
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 2126 2406 6.0E-08
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 2074 2367 6.0E-08
sp|B5FHG5|CAIC_SALDC Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella dublin (strain CT_02021853) GN=caiC PE=3 SV=1 2897 3272 6.0E-08
sp|O60011|ACS1_KLULA Acetyl-coenzyme A synthetase 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ACS1 PE=3 SV=2 2778 3290 6.0E-08
sp|Q8GQN9|BCLA_THAAR Benzoate--CoA ligase OS=Thauera aromatica GN=bclA PE=1 SV=1 1051 1498 6.0E-08
sp|Q6YYZ2|4CLL3_ORYSJ 4-coumarate--CoA ligase-like 3 OS=Oryza sativa subsp. japonica GN=4CLL3 PE=3 SV=1 985 1497 7.0E-08
sp|A8FGK6|MENE_BACP2 2-succinylbenzoate--CoA ligase OS=Bacillus pumilus (strain SAFR-032) GN=menE PE=3 SV=1 2766 3275 7.0E-08
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 21 207 8.0E-08
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 2030 2433 8.0E-08
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 2084 2350 8.0E-08
sp|A8FGK6|MENE_BACP2 2-succinylbenzoate--CoA ligase OS=Bacillus pumilus (strain SAFR-032) GN=menE PE=3 SV=1 995 1500 8.0E-08
sp|Q01158|LUCI_LUCLA Luciferin 4-monooxygenase OS=Luciola lateralis PE=2 SV=1 2779 3180 8.0E-08
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 23 379 9.0E-08
sp|Q84HC5|NCSB2_STRCZ 2-hydroxy-7-methoxy-5-methyl-1-naphthoate--CoA ligase OS=Streptomyces carzinostaticus GN=ncsB2 PE=1 SV=1 1145 1498 9.0E-08
sp|A9VM74|MENE_BACWK 2-succinylbenzoate--CoA ligase OS=Bacillus weihenstephanensis (strain KBAB4) GN=menE PE=3 SV=1 2766 3273 9.0E-08
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 2075 2372 1.0E-07
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 6 244 1.0E-07
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 737 857 1.0E-07
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 35 274 1.0E-07
sp|Q8DKH2|ACSA_THEEB Acetyl-coenzyme A synthetase OS=Thermosynechococcus elongatus (strain BP-1) GN=acsA PE=3 SV=1 1140 1499 1.0E-07
sp|A0R5G1|ACSA_MYCS2 Acetyl-coenzyme A synthetase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=acsA PE=3 SV=1 2778 3273 1.0E-07
sp|Q8ZRX4|CAIC_SALTY Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=caiC PE=3 SV=1 2897 3272 1.0E-07
sp|B4TIH0|CAIC_SALHS Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella heidelberg (strain SL476) GN=caiC PE=3 SV=1 2897 3272 1.0E-07
sp|Q32K60|CAIC_SHIDS Probable crotonobetaine/carnitine-CoA ligase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=caiC PE=3 SV=2 2897 3272 1.0E-07
sp|O24540|4CL_VANPL 4-coumarate--CoA ligase OS=Vanilla planifolia GN=4CL PE=3 SV=1 1111 1455 1.0E-07
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 25 206 2.0E-07
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 32 294 2.0E-07
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 13 198 2.0E-07
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 27 379 2.0E-07
sp|P9WQD1|ACSA_MYCTU Acetyl-coenzyme A synthetase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=acsA PE=1 SV=1 1141 1499 2.0E-07
sp|P9WQD0|ACSA_MYCTO Acetyl-coenzyme A synthetase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=acsA PE=3 SV=1 1141 1499 2.0E-07
sp|P59871|ACSA_MYCBO Acetyl-coenzyme A synthetase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=acsA PE=3 SV=1 1141 1499 2.0E-07
sp|P31685|4CL2_SOLTU 4-coumarate--CoA ligase 2 OS=Solanum tuberosum GN=4CL2 PE=3 SV=1 2748 3272 2.0E-07
sp|P31684|4CL1_SOLTU 4-coumarate--CoA ligase 1 OS=Solanum tuberosum GN=4CL1 PE=3 SV=1 2748 3272 2.0E-07
sp|Q82EL5|ACSA_STRAW Acetyl-coenzyme A synthetase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=acsA PE=3 SV=1 1141 1529 2.0E-07
sp|B2HPY8|FAA30_MYCMM Long-chain-fatty-acid--AMP ligase FadD30 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD30 PE=3 SV=1 3074 3268 2.0E-07
sp|Q91VA0|ACSM1_MOUSE Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Mus musculus GN=Acsm1 PE=1 SV=1 1143 1497 2.0E-07
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 29 198 3.0E-07
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 17 313 3.0E-07
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 2066 2409 3.0E-07
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 2086 2372 3.0E-07
sp|A7Z809|MENE_BACMF 2-succinylbenzoate--CoA ligase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=menE PE=3 SV=1 2758 3273 3.0E-07
sp|C6DE43|AAS_PECCP Bifunctional protein Aas OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=aas PE=3 SV=1 1128 1497 3.0E-07
sp|Q68CK6|ACS2B_HUMAN Acyl-coenzyme A synthetase ACSM2B, mitochondrial OS=Homo sapiens GN=ACSM2B PE=1 SV=2 1143 1497 3.0E-07
sp|Q17QJ1|ACSF2_BOVIN Acyl-CoA synthetase family member 2, mitochondrial OS=Bos taurus GN=ACSF2 PE=2 SV=1 1111 1497 3.0E-07
sp|B4EY25|CAIC_PROMH Probable crotonobetaine/carnitine-CoA ligase OS=Proteus mirabilis (strain HI4320) GN=caiC PE=3 SV=1 2903 3272 3.0E-07
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2270 2494 4.0E-07
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 27 281 4.0E-07
sp|Q3E6Y4|4CLL3_ARATH 4-coumarate--CoA ligase-like 3 OS=Arabidopsis thaliana GN=4CLL3 PE=2 SV=2 2757 3175 4.0E-07
sp|A8G8G7|ACSA_SERP5 Acetyl-coenzyme A synthetase OS=Serratia proteamaculans (strain 568) GN=acs PE=3 SV=1 1141 1499 4.0E-07
sp|B7UI83|CAIC_ECO27 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=caiC PE=3 SV=1 2897 3272 4.0E-07
sp|A8AN29|ACSA_CITK8 Acetyl-coenzyme A synthetase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=acs PE=3 SV=1 1141 1499 4.0E-07
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 14 195 5.0E-07
sp|Q01158|LUCI_LUCLA Luciferin 4-monooxygenase OS=Luciola lateralis PE=2 SV=1 1143 1499 5.0E-07
sp|Q0DV32|4CLL1_ORYSJ 4-coumarate--CoA ligase-like 1 OS=Oryza sativa subsp. japonica GN=4CLL1 PE=2 SV=2 2779 3274 5.0E-07
sp|Q87C00|ACSA_XYLFT Acetyl-coenzyme A synthetase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=acsA PE=3 SV=1 1141 1499 5.0E-07
sp|B1IRD9|CAIC_ECOLC Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=caiC PE=3 SV=2 2897 3272 5.0E-07
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 1424 1590 6.0E-07
sp|Q82EL5|ACSA_STRAW Acetyl-coenzyme A synthetase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=acsA PE=3 SV=1 2905 3287 6.0E-07
sp|B1LFX0|CAIC_ECOSM Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=caiC PE=3 SV=1 2897 3272 6.0E-07
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 21 333 7.0E-07
sp|Q27757|LUCI_PHOPE Luciferin 4-monooxygenase OS=Photuris pensylvanica PE=2 SV=2 1143 1499 7.0E-07
sp|Q9PB89|ACSA_XYLFA Acetyl-coenzyme A synthetase OS=Xylella fastidiosa (strain 9a5c) GN=acsA PE=3 SV=1 1003 1499 7.0E-07
sp|P38135|FADK_ECOLI Short-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadK PE=1 SV=3 2907 3273 8.0E-07
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 31 277 1.0E-06
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 443 862 1.0E-06
sp|Q6D107|AAS_PECAS Bifunctional protein Aas OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=aas PE=3 SV=1 1137 1521 1.0E-06
sp|Q9VLL0|ACSF4_DROME Acyl-CoA synthetase family member 4 homolog OS=Drosophila melanogaster GN=U26 PE=2 SV=3 2887 3271 1.0E-06
sp|P23971|MENE_BACSU 2-succinylbenzoate--CoA ligase OS=Bacillus subtilis (strain 168) GN=menE PE=1 SV=2 995 1497 1.0E-06
sp|Q0S7V5|FAD3_RHOJR 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Rhodococcus jostii (strain RHA1) GN=fadD3 PE=1 SV=1 2769 3274 1.0E-06
sp|Q8VYJ1|MENE_ARATH 2-succinylbenzoate--CoA ligase, chloroplastic/peroxisomal OS=Arabidopsis thaliana GN=AAE14 PE=1 SV=1 1134 1497 1.0E-06
sp|Q98ET8|ACSA_RHILO Acetyl-coenzyme A synthetase OS=Rhizobium loti (strain MAFF303099) GN=acsA PE=3 SV=1 1141 1499 1.0E-06
sp|Q0AAW0|ACSA_ALKEH Acetyl-coenzyme A synthetase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=acsA PE=3 SV=1 992 1502 1.0E-06
sp|Q8GB18|CAIC_PROSL Probable crotonobetaine/carnitine-CoA ligase OS=Proteus sp. (strain LE138) GN=caiC PE=3 SV=1 2903 3272 1.0E-06
sp|O53551|FAC17_MYCTU Long-chain-fatty-acid--CoA ligase FadD17 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD17 PE=1 SV=1 1138 1502 1.0E-06
sp|Q7TWC5|FAC17_MYCBO Long-chain-fatty-acid--CoA ligase FadD17 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD17 PE=3 SV=1 1138 1502 1.0E-06
sp|Q8K0L3|ACSM2_MOUSE Acyl-coenzyme A synthetase ACSM2, mitochondrial OS=Mus musculus GN=Acsm2 PE=1 SV=1 1143 1498 1.0E-06
sp|B7M0D4|CAIC_ECO8A Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O8 (strain IAI1) GN=caiC PE=3 SV=2 2897 3272 1.0E-06
sp|B7N7R2|CAIC_ECOLU Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=caiC PE=3 SV=2 2897 3272 1.0E-06
sp|B5YYD1|CAIC_ECO5E Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=caiC PE=3 SV=1 2897 3272 1.0E-06
sp|Q8XA34|CAIC_ECO57 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O157:H7 GN=caiC PE=3 SV=2 2897 3272 1.0E-06
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 26 322 2.0E-06
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 21 244 2.0E-06
sp|P14912|4CL1_PETCR 4-coumarate--CoA ligase 1 OS=Petroselinum crispum GN=4CL1 PE=2 SV=1 1130 1498 2.0E-06
sp|A8FNJ7|ACSA_CAMJ8 Acetyl-coenzyme A synthetase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=acsA PE=3 SV=1 2779 3272 2.0E-06
sp|A1W1D6|ACSA_CAMJJ Acetyl-coenzyme A synthetase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=acsA PE=3 SV=1 2779 3272 2.0E-06
sp|Q9PMD2|ACSA_CAMJE Acetyl-coenzyme A synthetase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=acsA PE=3 SV=1 2779 3272 2.0E-06
sp|P9WQ37|FAC13_MYCTU Long-chain-fatty-acid--CoA ligase FadD13 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD13 PE=1 SV=1 2760 3281 2.0E-06
sp|P9WQ36|FAC13_MYCTO Long-chain-fatty-acid--CoA ligase FadD13 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD13 PE=3 SV=1 2760 3281 2.0E-06
sp|Q83MG9|CAIC_SHIFL Probable crotonobetaine/carnitine-CoA ligase OS=Shigella flexneri GN=caiC PE=3 SV=2 2897 3272 2.0E-06
sp|Q9SMT7|4CLLA_ARATH Oxalate--CoA ligase OS=Arabidopsis thaliana GN=AAE3 PE=1 SV=1 2777 3269 2.0E-06
sp|Q92AY8|MENE_LISIN 2-succinylbenzoate--CoA ligase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=menE PE=3 SV=2 2779 3277 2.0E-06
sp|Q8FAY8|ACSA_ECOL6 Acetyl-coenzyme A synthetase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=acs PE=3 SV=1 1141 1499 2.0E-06
sp|P27550|ACSA_ECOLI Acetyl-coenzyme A synthetase OS=Escherichia coli (strain K12) GN=acs PE=1 SV=2 1141 1499 2.0E-06
sp|Q5KVX9|MENE_GEOKA 2-succinylbenzoate--CoA ligase OS=Geobacillus kaustophilus (strain HTA426) GN=menE PE=3 SV=1 2779 3272 2.0E-06
sp|B7L4G0|CAIC_ECO55 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain 55989 / EAEC) GN=caiC PE=3 SV=2 2897 3272 2.0E-06
sp|A7ZVY7|CAIC_ECOHS Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O9:H4 (strain HS) GN=caiC PE=3 SV=2 2897 3272 2.0E-06
sp|A1SZA2|ACSA_PSYIN Acetyl-coenzyme A synthetase OS=Psychromonas ingrahamii (strain 37) GN=acsA PE=3 SV=1 1118 1499 2.0E-06
sp|C5D6U5|MENE_GEOSW 2-succinylbenzoate--CoA ligase OS=Geobacillus sp. (strain WCH70) GN=menE PE=3 SV=1 995 1499 3.0E-06
sp|Q08AH3|ACS2A_HUMAN Acyl-coenzyme A synthetase ACSM2A, mitochondrial OS=Homo sapiens GN=ACSM2A PE=1 SV=2 2907 3281 3.0E-06
sp|Q3Z5X2|CAIC_SHISS Probable crotonobetaine/carnitine-CoA ligase OS=Shigella sonnei (strain Ss046) GN=caiC PE=3 SV=2 2897 3272 3.0E-06
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 31 291 4.0E-06
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 3223 3316 4.0E-06
sp|P14913|4CL2_PETCR 4-coumarate--CoA ligase 1 OS=Petroselinum crispum GN=4CL2 PE=2 SV=1 1130 1498 4.0E-06
sp|P31552|CAIC_ECOLI Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain K12) GN=caiC PE=1 SV=2 2897 3272 4.0E-06
sp|B1XBG2|CAIC_ECODH Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain K12 / DH10B) GN=caiC PE=3 SV=2 2897 3272 4.0E-06
sp|C4ZPW3|CAIC_ECOBW Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=caiC PE=3 SV=2 2897 3272 4.0E-06
sp|B6HYY8|CAIC_ECOSE Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain SE11) GN=caiC PE=3 SV=2 2897 3272 4.0E-06
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 25 302 5.0E-06
sp|Q42524|4CL1_ARATH 4-coumarate--CoA ligase 1 OS=Arabidopsis thaliana GN=4CL1 PE=1 SV=1 2754 3121 5.0E-06
sp|Q53005|4HBCL_RHOPA 4-hydroxybenzoate--CoA/benzoate--CoA ligase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=hbaA PE=1 SV=1 1140 1499 5.0E-06
sp|B7MNP4|CAIC_ECO81 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O81 (strain ED1a) GN=caiC PE=3 SV=2 2897 3272 5.0E-06
sp|A7ZHC8|CAIC_ECO24 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=caiC PE=3 SV=2 2897 3272 5.0E-06
sp|O70490|ACSM2_RAT Acyl-coenzyme A synthetase ACSM2, mitochondrial OS=Rattus norvegicus GN=Acsm2 PE=2 SV=2 1143 1498 5.0E-06
sp|P9WQ49|FAD21_MYCTU Putative fatty-acid--CoA ligase FadD21 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD21 PE=1 SV=1 3033 3274 6.0E-06
sp|P9WQ48|FAD21_MYCTO Putative fatty-acid--CoA ligase fadD21 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD21 PE=3 SV=1 3033 3274 6.0E-06
sp|P63524|FAD21_MYCBO Putative fatty-acid--CoA ligase fadD21 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD21 PE=3 SV=1 3033 3274 6.0E-06
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 434 837 7.0E-06
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 6 244 7.0E-06
sp|O94049|ACS1_CANAX Acetyl-coenzyme A synthetase 1 OS=Candida albicans GN=ACS1 PE=3 SV=1 1141 1499 7.0E-06
sp|B7NHE1|CAIC_ECO7I Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=caiC PE=3 SV=2 2897 3272 7.0E-06
sp|Q7U226|FAA30_MYCBO Long-chain-fatty-acid--AMP ligase FadD30 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD30 PE=3 SV=1 3072 3286 8.0E-06
sp|Q8FLA5|CAIC_ECOL6 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=caiC PE=3 SV=2 2897 3272 8.0E-06
sp|Q0TLV2|CAIC_ECOL5 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=caiC PE=3 SV=2 2897 3272 8.0E-06
sp|Q4FVA1|ACSA_PSYA2 Acetyl-coenzyme A synthetase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=acsA PE=3 SV=1 1141 1499 8.0E-06
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 416 696 9.0E-06
sp|Q08AH3|ACS2A_HUMAN Acyl-coenzyme A synthetase ACSM2A, mitochondrial OS=Homo sapiens GN=ACSM2A PE=1 SV=2 1143 1497 9.0E-06
sp|P9WQ57|FAA30_MYCTU Long-chain-fatty-acid--AMP ligase FadD30 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD30 PE=1 SV=1 3072 3286 9.0E-06
sp|P9WQ56|FAA30_MYCTO Long-chain-fatty-acid--AMP ligase FadD30 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD30 PE=3 SV=1 3072 3286 9.0E-06
sp|P77495|PRPE_ECOLI Propionate--CoA ligase OS=Escherichia coli (strain K12) GN=prpE PE=3 SV=1 2907 3272 9.0E-06
sp|Q5SKN9|LCFCS_THET8 Long-chain-fatty-acid--CoA ligase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=TTHA0604 PE=1 SV=1 2779 3274 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7451
MGSPAERLVNGLSDLSMHALDAVRAEPIEACVHGLIKLHAAQRPSAPAICSRDGELSYAQLDVLSSRLSRQWGLR
PATPAVLCVEGSLLAPIAALAVIKSGAVAVVLDLEQPQDRLRAIISRLTDPVVISCSNNAPIARKLGPGPVIVID
VDTLSAPAHDHSTASLPVVVSPSDTLCLIFLPDASDNPTGAAISHRDMSSAIVYQQRNLGYAVDCRTLDVAPRGS
YSAWCNLLHTLANGGCLCVPSHWDRRKDVWSSAATLRANTAHVTPDLALDLLHKSGPAGRMRLTLVGQPSAAPTQ
GRDSCSDEKLASLGDGVCAFLSDPQSSHPLGRIVSQLRPEGPLFGPEPASLTILTPPSIASFWSGCDGWISSIGD
VVRGSDGKCFVRGTSTNSIDGEAKSQSRQDSEPSEDSIDNLQFSSESEETLDTPEAEQADASETEQLLLPVWAQA
LHISSEKISGDDDFYELGGDAAKGLRLHALARDQGLHFSLRDLFRGTSLRHLAMRTSQGRPNSTPGVPPFSLLAS
ITHMEESRAQVAQLCRAQTSQVVDILPCSPLQEGLLALTQRLPGSYVAQHIYEIDEGISLSRLRRAWDQVVAMNP
VLRTRVVSLPGQGLVQVVLEQGASWSSATDLNDYQRQHSEADQQMGLGTPLSRFAILDAGAGARPCLLWEIHHAL
YDGWSLPLVMGEVESAYYGEAGQDLEPMTGFIKYIRDRDEVAAKEFWRGQFAGIQEAHFPRPRPTTAASPSAAQM
SLTVPNLGWGRSDFTPATMARAAWAVVTARGAGSDEALYGVTVTGRQAPVDGIERMAGPAIATVPMRVPVDWEGS
VQRLLEAVQRQSTDMIPFEQTGLQNIRRMGSEAAMACGFRSLMVVQPGASGSDGDGESRPFLSKPSIGGEDDEQQ
EKELAPTTYPIEVECHLGADEARLRLDFNPDAVDRREMEAIAESFTNVLRKLADRSLAQEKVGSLVATQPDRVEK
ALSWNATVPEPVEQCVHHIIARRVHERPLAPALRAWDGELTYRDLDERSTALALRLVSRGVGGTLVPVLFEKSAW
MPVAVLAVLKAGGALVALETKDPEDRLRTIASQATSPVFLSSVRNAALARRLAGEGKMEVEVVGGSQNEQADAEP
QHALSLLPTVVPSSLLYVVFTSGSTGTPKGVMISHRSFCSAIAYQQSFLDYNQNARVLDFASCAFDVSWSNLFNT
LTSGACLCIPSPEERENDLAGCLSKYDITFADLTPSVARALGPDVLSGLSTMILGGEAPLPSDASLAGGKTHIIN
AYGPAECTPTATLSTLNATDVCIGRGLGICTWIVDVDGADSLTPVGDVGELWIEGPLVGDGYLNDAERTATAFIR
DPAWLQRAVGRRGVVYRTGDLVRYRDDGTLVFIGRKDTQVKIRGQRVELAEVESCVRRLMDSDDVQVVAEAIQPP
GANNPVLVAMIALSGAEAMADDELDKAVRKATEGLSDRLRQAVPSYMVPAAYIPVREMPVTTAGKTDRRRLRAIG
VSLWAQHRADKKTESTQPATEMESILQKVWMSVLNLTAEEASVEAGFASLGGDSISAMQLVSRCRLHNVMFTVSD
ILQSNTIRKLASLYKPVASTTGSELLKAIEQDEEDDPTAEFDLSPMQHSFFRDYPDGLNHFNQSFLLDLGQDVTT
RALKDALVALVDRHAMLRARFQKDSKSGVWKQRIEEEGPDSFAFSEHKVANRDEVGIIGQRRQNKLDICKGPVFA
CDLFRLPDGGQVVLLSAHHLVIDLVSWRILWNDVEEHVRLGEPLTQKTLSFRSWCAAQAKIGSSLSPLSVLPYPI
PEPELDFWGLAPEKNTFGDCDTLDVSLSREVSKLLFGKCNDSLKTEALDLILGALSFSFAQTFPERSVPAIWIEG
HGREQLEADLPTDVSGTIGWFTTMYPLAVPITPGQPVTHAVRLVKDTRRRVPRMGLPFYACQHYSESGRQAFQGH
DVYEIVFNFTGRFQQLEREEGLFKSSQGSDESDVKIVEIAKSARRFLMLEIGAGVADNMLSVTFNYHKSMKHLDR
LREWSHNFVDVLESAVTELAASPVGFTLSDLPLTQLSYRGLDSLLTEQLPRMGIEPRQIQNIYPCSPLQEGMLLS
SVKGAASYITYTIWRCNSTGPDAQPVSPSRLEEAWKKVVSRHSILSTVFALHPEGNGFLQIVLDKPSIRVTQLEA
GSDAPTDILSRLPESTFADNEPEHAFIICRSDQTGEVACRLDMSHALTDAHSASLLLTELGTAYNGTGELAVAPA
FVEIIRYINSTPRSQIVSTWTSLLDKVKPCEFPLSPLAVEGDEEKFTELSCNAELHMSINEFCKRTELMPSAVIQ
VAWGMTMSHMTGMNDVCFGYLVSGRDAPVKGVESLVGPLANLLISRVDLGASARQVLETTSERLKQHMSIQHVSL
AEIQHHLGHSGRRLFNTSLALRANEKEKVGVESGLSFDILSGGDSHEFDVKCNASIGGADIDISVEFREPHVSRK
AALEARDTLERAIGYILTNTYPSTDIQDDIDVETTTLYDGFFKHMTGVEDSAARSFWTDQFASTQGIHFPLPKPG
LSHAVLDGSVQLDIGQLDWQSGDFDAETLIRSAWSVLAARLMCSDESLFGAMSKHSVEPMPIRVVVDWEKSVGSL
LEEVQRQTTAMKPFGRMSLDRIRRFNEDAALACGFQTLLTDEETKEGRVSHSLEVIVRGEGITIRFDSRVMEEVR
VSRLVHQFEHVLGQMLDPDMRQKKLRQVTAASKRDIDDVWRWNAEVPPMISGCIHDDIVANVETRPDASAIDAWD
GGMTYKQLEEASRKLAIRLMKSGVGVGSIVPLCFEKSMWMPVAALAVMRAGGASVAVDTTQPMERIGTMTSQVFA
ALPRPKVILSSVANEAMVGQLQADEVIVIGRDTLDSLEEDDKSYELPAVAPTDVLYVVFTSGSTGKPKGVVITHQ
NFYTATHTQRTLLGIKSDSRVFDFSSYAFDVAWLNLLKALTAGACLCIPSAAEREDDLGGCLTKYGITVVDLTPA
VARVIEPRGVLSTLDTLILGGEAVSSSDADLVGDKTQVMVAYGPAECTPTCSIMNLTQTRSPGIGHGVSMCLWVV
DLENADELAPVGATGELWLEGPLVGLGYLNEPEKTAASFFQDPAWLTRGSADGKRPGRRGRVYRTGDLVQQLEDG
SFLFVGRKDTQVKIRGQRVELGDIEHHVQQTLEEVGTLAKVNVAAETIQPRGVESKMLVAFVAAEGTTSTTTTIE
EEIQRASAAAMEKLAKALPVYMVPTLFIPIPALPMSPTGKIDRRRLKEQGSHLTAKEVATLSRRGDGQRRAPQTE
SERVLRSLWAEVLGVEEESGVWVLG*
Coding >Ophun1|7451
ATGGGCTCGCCCGCAGAACGACTGGTCAACGGCCTATCCGACCTATCCATGCACGCCCTTGATGCCGTCCGGGCC
GAACCCATCGAGGCATGCGTCCACGGCCTCATCAAGCTTCACGCTGCCCAACGCCCCTCGGCCCCCGCCATCTGC
TCCAGGGACGGAGAGCTCAGCTATGCACAGCTCGACGTGCTCTCTAGCCGCCTGTCCCGTCAATGGGGCCTGCGT
CCGGCTACGCCCGCTGTCCTCTGCGTGGAAGGATCTCTGCTGGCACCCATCGCTGCCCTGGCCGTTATCAAGTCG
GGCGCCGTCGCCGTGGTCCTTGATCTCGAGCAGCCCCAGGACCGACTTAGGGCCATTATATCCCGCCTGACGGAC
CCCGTCGTCATCTCTTGCTCCAATAATGCCCCCATCGCCCGCAAGCTCGGTCCCGGGCCCGTCATAGTCATTGAC
GTCGATACGCTGTCGGCCCCGGCCCACGACCACTCAACCGCCAGCCTGCCGGTCGTCGTCAGTCCCTCCGATACC
CTCTGTTTGATTTTCCTGCCCGACGCCTCAGACAATCCCACGGGGGCCGCCATTTCCCACCGAGACATGAGCAGC
GCCATTGTCTACCAACAACGCAATCTCGGGTACGCTGTTGATTGTCGCACTCTCGACGTTGCTCCTAGGGGCTCT
TACTCCGCCTGGTGTAACCTGCTGCACACCTTGGCCAATGGCGGCTGTCTCTGTGTCCCGTCACACTGGGACCGC
CGAAAGGACGTCTGGAGTTCGGCTGCAACGCTGCGGGCAAACACGGCGCACGTGACGCCGGACCTGGCCCTGGAT
CTGCTCCACAAGTCCGGTCCGGCCGGCCGGATGCGCCTCACGCTGGTGGGTCAGCCGTCAGCCGCCCCCACCCAG
GGCCGGGACTCTTGTTCCGACGAGAAGCTAGCCAGCCTCGGCGATGGCGTCTGCGCTTTTCTCTCCGATCCGCAA
TCCTCACACCCCCTCGGCCGTATCGTGAGCCAGCTCCGGCCCGAGGGTCCCCTGTTCGGCCCCGAGCCGGCTTCT
CTTACCATCCTAACTCCGCCGTCGATCGCATCCTTCTGGTCAGGCTGTGACGGCTGGATCTCTTCCATCGGCGAT
GTCGTACGAGGCTCAGATGGCAAGTGTTTCGTCCGCGGCACGTCTACAAACTCGATCGACGGTGAGGCCAAGAGC
CAGAGCCGGCAGGACAGCGAGCCGTCCGAGGACAGCATCGACAACCTACAATTCTCATCCGAGAGCGAAGAGACG
CTCGACACTCCCGAGGCAGAGCAGGCTGACGCTTCGGAGACGGAGCAGCTTCTGTTGCCTGTCTGGGCCCAAGCC
CTTCACATCAGCTCGGAAAAGATCTCCGGCGATGACGACTTCTATGAGCTCGGTGGCGATGCTGCCAAGGGTCTG
CGTCTTCATGCCCTGGCCCGCGACCAGGGCCTTCACTTCTCGCTGCGTGACCTCTTCCGGGGCACCAGCCTTCGC
CACCTTGCAATGCGGACCAGTCAAGGTAGACCGAACTCGACCCCGGGCGTTCCCCCTTTCTCCCTACTGGCTTCC
ATCACCCACATGGAAGAATCACGCGCCCAAGTCGCTCAGCTCTGTCGCGCCCAGACCTCACAGGTCGTCGACATT
CTCCCCTGCTCGCCCCTTCAGGAGGGTCTGCTGGCACTCACCCAGAGACTCCCGGGCAGCTATGTAGCTCAGCAC
ATCTACGAGATCGACGAGGGTATCAGCCTTTCACGCCTGCGCCGTGCCTGGGACCAGGTCGTGGCCATGAACCCC
GTGCTGAGGACCCGCGTTGTCAGTCTTCCCGGTCAGGGACTCGTCCAGGTCGTGCTGGAGCAAGGAGCTTCGTGG
TCGTCGGCTACCGATCTCAACGACTATCAGCGCCAACACAGCGAAGCGGACCAACAGATGGGACTCGGCACCCCC
TTGTCGAGGTTTGCCATTCTCGATGCCGGCGCGGGCGCCCGTCCCTGTCTCCTGTGGGAGATCCACCATGCTTTG
TATGATGGATGGTCTCTGCCGCTGGTGATGGGCGAGGTTGAAAGCGCCTACTACGGTGAGGCCGGCCAGGACCTG
GAGCCCATGACGGGCTTCATCAAGTACATCCGAGACCGCGACGAGGTAGCGGCCAAGGAGTTCTGGCGAGGCCAG
TTTGCTGGAATTCAGGAGGCCCACTTCCCCCGGCCTCGACCGACAACGGCAGCTTCACCATCAGCAGCACAAATG
TCCCTGACGGTCCCGAATCTCGGCTGGGGCCGCAGCGACTTTACACCGGCTACCATGGCCCGCGCCGCTTGGGCC
GTCGTCACGGCACGCGGAGCCGGCTCTGATGAGGCTCTGTACGGCGTCACCGTGACGGGCCGTCAGGCGCCAGTC
GACGGCATCGAGCGCATGGCTGGTCCGGCTATCGCGACGGTGCCCATGAGGGTGCCTGTGGACTGGGAGGGTAGC
GTACAGCGGCTGCTTGAAGCGGTACAGCGACAATCGACGGACATGATTCCCTTTGAGCAGACCGGACTGCAGAAC
ATCCGCCGGATGGGCAGCGAGGCCGCCATGGCCTGTGGTTTCCGCTCGCTCATGGTGGTTCAGCCTGGGGCCAGC
GGCAGTGACGGTGATGGAGAATCCCGGCCTTTCTTGAGCAAGCCCAGCATCGGCGGCGAGGATGACGAACAGCAG
GAAAAGGAGCTCGCTCCTACGACATACCCCATCGAGGTGGAATGCCATCTGGGCGCCGACGAGGCCCGGTTGCGT
CTCGACTTCAACCCCGATGCCGTCGATCGTCGCGAGATGGAGGCCATTGCTGAGAGCTTCACGAACGTTCTCCGC
AAGTTGGCGGACCGGAGTTTGGCGCAGGAAAAGGTCGGATCCCTGGTCGCTACCCAACCAGACCGCGTCGAGAAA
GCTCTCTCGTGGAACGCCACCGTCCCCGAGCCCGTGGAGCAGTGCGTCCATCACATTATCGCTCGCCGCGTCCAC
GAGCGCCCTCTGGCCCCTGCCCTCCGCGCCTGGGACGGCGAGCTCACCTATCGGGATCTGGACGAGCGGTCGACG
GCCCTGGCGCTCCGGCTCGTGTCCCGGGGCGTTGGCGGGACTCTGGTTCCAGTGCTGTTTGAGAAGTCGGCCTGG
ATGCCCGTCGCCGTGTTGGCCGTGTTGAAGGCCGGTGGCGCCCTGGTCGCGTTGGAAACGAAGGATCCCGAGGAC
AGACTGCGGACTATTGCTTCTCAGGCCACGTCTCCCGTGTTCTTATCGTCAGTTCGCAACGCTGCTCTGGCTCGT
CGCCTGGCTGGAGAGGGCAAGATGGAGGTTGAAGTCGTTGGAGGCTCTCAGAACGAGCAGGCCGACGCTGAACCG
CAACACGCGCTCTCCCTTCTCCCGACCGTTGTTCCGTCCAGCCTGCTCTACGTCGTCTTTACCTCTGGCAGTACG
GGAACACCGAAGGGAGTCATGATCTCTCACAGGAGCTTCTGCAGTGCCATTGCCTACCAGCAGTCTTTTCTGGAC
TACAATCAAAATGCCCGCGTGCTGGACTTTGCCTCGTGTGCGTTCGACGTCTCCTGGTCCAACCTTTTCAATACC
CTTACCTCTGGAGCCTGCCTCTGCATCCCGTCGCCCGAAGAGCGGGAGAACGACTTGGCAGGGTGCCTTTCCAAG
TATGACATTACCTTTGCCGACTTGACGCCTTCGGTTGCTCGTGCTCTTGGCCCCGACGTGCTTTCAGGGTTGTCG
ACTATGATTCTGGGTGGTGAAGCTCCCCTGCCGAGTGACGCCTCGCTAGCTGGCGGCAAGACTCACATCATCAAC
GCCTATGGCCCGGCTGAATGCACACCTACTGCAACGCTTTCGACGCTCAACGCCACCGACGTCTGCATAGGCCGT
GGACTCGGAATCTGCACATGGATCGTCGACGTCGACGGTGCTGATTCGCTGACGCCGGTCGGGGACGTGGGCGAG
CTCTGGATCGAGGGCCCGCTCGTGGGCGACGGATACCTCAACGATGCTGAGCGGACGGCGACAGCCTTCATCCGA
GATCCAGCGTGGCTTCAGCGGGCTGTTGGCCGGCGAGGCGTCGTCTACCGTACCGGTGATCTCGTGCGGTATAGG
GATGACGGAACGCTCGTCTTCATCGGACGCAAAGACACACAAGTCAAGATCCGCGGTCAGCGCGTTGAATTGGCC
GAGGTCGAGAGCTGCGTTCGCCGGCTGATGGACAGTGACGATGTTCAGGTAGTGGCTGAGGCCATCCAGCCGCCT
GGAGCCAACAATCCCGTGCTCGTGGCCATGATTGCTCTTTCAGGGGCCGAGGCCATGGCTGACGACGAGCTCGAC
AAGGCCGTGAGGAAGGCCACCGAGGGACTCTCTGACCGGCTACGTCAGGCGGTCCCGTCATACATGGTTCCGGCT
GCCTACATCCCGGTGCGGGAGATGCCGGTGACGACGGCCGGGAAGACGGACCGGCGCCGGCTCCGGGCCATCGGC
GTCTCGCTGTGGGCTCAGCACCGGGCCGACAAGAAGACCGAGTCTACGCAACCGGCGACGGAGATGGAGAGCATC
CTGCAAAAGGTGTGGATGTCGGTGCTAAACTTGACTGCCGAGGAGGCGTCGGTCGAAGCCGGCTTTGCCAGTCTC
GGAGGCGATTCCATCTCGGCCATGCAGCTGGTGTCTCGCTGCCGGCTTCACAACGTCATGTTCACCGTCAGCGAC
ATCCTTCAGTCCAACACGATCCGCAAGCTCGCTTCTTTGTACAAGCCGGTGGCGTCGACGACTGGGAGCGAGCTT
CTCAAGGCCATCGAGCAGGATGAAGAGGACGATCCGACGGCCGAGTTTGACCTCTCGCCTATGCAGCATTCCTTC
TTCCGCGACTATCCTGATGGCCTCAACCACTTCAACCAATCCTTCCTCCTTGATCTTGGCCAAGACGTCACGACT
CGCGCGCTCAAGGACGCGCTCGTGGCTCTTGTCGACCGCCACGCCATGCTCCGCGCTCGTTTCCAGAAAGATAGC
AAGAGCGGTGTTTGGAAGCAGAGAATCGAGGAAGAGGGCCCTGACTCGTTTGCTTTCTCCGAGCACAAGGTGGCC
AACCGCGACGAAGTCGGCATCATCGGCCAGCGTCGCCAGAACAAGCTCGACATTTGCAAGGGGCCCGTCTTTGCT
TGCGATCTGTTCCGCCTGCCAGACGGCGGCCAGGTGGTTCTACTCTCGGCTCATCATCTGGTCATCGACCTGGTA
TCGTGGCGGATTCTCTGGAACGATGTCGAGGAGCACGTTCGCCTCGGAGAGCCCCTGACGCAGAAGACGCTCTCG
TTCCGATCCTGGTGCGCGGCACAGGCCAAGATTGGCAGCAGTCTCTCGCCCCTATCGGTGCTGCCCTACCCGATC
CCGGAGCCGGAGCTGGACTTTTGGGGTCTGGCTCCGGAGAAGAACACGTTTGGCGACTGTGATACGCTGGACGTG
AGTCTCTCGCGGGAAGTGAGCAAGCTTCTCTTTGGGAAATGCAACGACAGCCTCAAGACGGAAGCGCTCGACCTC
ATCCTCGGTGCTCTTTCGTTTTCCTTCGCCCAGACGTTCCCTGAGCGTTCGGTGCCCGCCATCTGGATCGAGGGC
CATGGCAGGGAGCAGCTAGAGGCTGATCTCCCGACTGACGTCTCGGGCACCATCGGCTGGTTCACCACCATGTAC
CCCCTGGCCGTGCCCATCACCCCTGGCCAGCCGGTGACGCACGCAGTCCGGCTCGTCAAGGATACCAGGAGGAGA
GTCCCGCGCATGGGCTTGCCCTTTTACGCGTGCCAGCACTACAGTGAGTCTGGACGACAGGCCTTCCAGGGTCAC
GACGTGTACGAGATTGTCTTCAACTTTACCGGCCGATTTCAGCAGCTGGAACGGGAGGAGGGTCTGTTCAAGTCG
TCGCAGGGATCTGACGAGAGCGACGTCAAGATTGTCGAGATTGCAAAGTCGGCTCGACGCTTCCTTATGCTCGAG
ATTGGCGCGGGTGTGGCAGATAACATGCTGTCTGTCACTTTCAACTACCACAAGAGCATGAAGCATCTCGACCGG
CTGCGGGAATGGTCGCACAATTTCGTCGATGTTCTTGAATCGGCTGTTACTGAGCTCGCTGCCAGTCCTGTCGGC
TTCACCCTGAGCGATCTGCCCCTGACGCAACTCTCTTACCGCGGTCTCGATTCGCTGTTGACGGAGCAGCTGCCG
CGGATGGGCATCGAGCCGCGCCAGATTCAGAACATCTACCCCTGCTCGCCTCTTCAGGAGGGCATGCTGTTGAGT
TCGGTCAAGGGGGCAGCGTCGTACATCACGTACACCATCTGGCGTTGCAACTCGACCGGTCCTGACGCTCAGCCC
GTATCGCCCTCGCGGCTAGAGGAGGCGTGGAAGAAGGTGGTCAGCCGTCATAGCATTCTCTCGACTGTCTTTGCC
CTGCATCCAGAGGGCAACGGCTTCCTGCAGATTGTGCTGGACAAGCCATCGATCCGGGTGACGCAGCTGGAGGCT
GGCTCTGACGCCCCCACTGATATCCTCTCTCGGTTGCCGGAGTCGACGTTTGCAGACAATGAGCCGGAGCACGCC
TTTATCATCTGCCGATCGGACCAGACGGGCGAGGTTGCTTGTCGATTGGACATGAGCCACGCTCTGACGGACGCC
CATTCCGCTTCCCTGCTGCTCACCGAGCTCGGAACGGCATACAATGGCACCGGGGAGCTGGCAGTGGCACCGGCA
TTTGTCGAAATCATCCGCTACATCAACAGCACGCCTCGGTCGCAAATCGTCAGCACCTGGACGTCTCTGCTCGAC
AAGGTCAAGCCCTGCGAGTTCCCGCTTTCTCCTCTGGCCGTGGAAGGAGACGAGGAGAAGTTTACGGAGCTCTCT
TGCAACGCTGAGCTGCACATGAGCATCAACGAGTTCTGTAAGAGGACGGAGCTGATGCCGTCGGCTGTGATTCAG
GTGGCCTGGGGCATGACCATGTCGCACATGACGGGCATGAACGACGTTTGCTTCGGCTACCTCGTTTCCGGACGA
GACGCGCCGGTCAAGGGCGTCGAGAGCCTGGTCGGGCCCTTGGCTAACCTCCTCATCAGCAGGGTTGACTTGGGC
GCGTCGGCGAGGCAGGTTCTGGAAACGACGTCGGAGAGGTTGAAGCAGCACATGTCGATTCAGCACGTCTCGTTG
GCTGAGATTCAGCACCATCTCGGGCACTCTGGGAGGCGGCTGTTTAATACGTCGCTGGCGCTTCGTGCCAATGAG
AAGGAAAAGGTCGGAGTTGAGTCGGGCTTGTCGTTTGACATCCTGTCGGGTGGTGACTCTCACGAGTTTGACGTC
AAGTGCAACGCCTCCATTGGAGGAGCTGATATTGACATCTCTGTCGAGTTCCGGGAGCCGCATGTGAGCAGAAAA
GCAGCTCTGGAAGCACGGGATACCCTTGAGCGCGCCATCGGCTACATCCTCACCAACACGTACCCGAGCACTGAC
ATTCAGGATGACATTGACGTGGAGACGACCACCCTCTACGATGGCTTCTTCAAGCACATGACTGGTGTCGAGGAT
TCGGCAGCTCGGTCGTTCTGGACGGATCAGTTTGCCAGCACGCAGGGGATACACTTCCCTCTGCCCAAGCCGGGC
CTCAGCCACGCCGTGCTTGATGGCTCGGTTCAACTCGACATCGGGCAGCTGGATTGGCAGTCTGGGGACTTTGAC
GCTGAGACCTTGATCAGGAGTGCCTGGTCTGTGCTGGCTGCCCGCCTCATGTGCTCGGACGAGAGTCTGTTTGGA
GCGATGAGCAAGCATTCAGTCGAACCGATGCCGATCCGTGTCGTGGTTGACTGGGAGAAGAGCGTGGGCAGTCTC
CTGGAAGAGGTGCAGCGCCAGACAACAGCCATGAAGCCGTTTGGACGCATGAGCTTGGACCGGATTCGGCGTTTC
AACGAGGATGCCGCCTTGGCTTGTGGCTTCCAGACGTTGCTGACGGACGAGGAGACGAAGGAGGGACGCGTCTCA
CACTCGCTCGAGGTGATTGTCCGGGGCGAGGGCATCACCATCCGGTTCGACTCGAGGGTGATGGAAGAGGTGCGA
GTGTCGCGGCTTGTGCATCAGTTTGAACACGTGCTGGGTCAAATGCTTGACCCGGATATGCGGCAGAAGAAGCTC
AGACAAGTAACGGCAGCCAGCAAGCGGGACATCGATGACGTATGGAGGTGGAACGCCGAGGTGCCTCCCATGATC
TCGGGCTGTATCCATGACGACATTGTGGCCAACGTTGAGACGCGTCCTGATGCTTCGGCCATTGACGCCTGGGAT
GGCGGCATGACATACAAGCAGCTCGAGGAGGCATCGCGGAAGCTGGCTATCCGGCTCATGAAGAGCGGAGTCGGC
GTGGGCAGCATCGTTCCGCTATGCTTCGAGAAGTCGATGTGGATGCCGGTGGCGGCTCTGGCTGTTATGAGAGCC
GGAGGAGCGTCGGTTGCCGTTGATACGACGCAGCCCATGGAGCGGATAGGGACCATGACGTCGCAGGTGTTTGCT
GCGCTGCCGAGGCCCAAGGTGATTCTATCGTCGGTTGCCAACGAGGCCATGGTGGGCCAGTTGCAAGCTGACGAG
GTCATTGTCATCGGCCGTGACACTCTCGACTCTCTGGAAGAGGACGACAAGAGCTACGAGTTGCCTGCCGTCGCG
CCTACCGACGTGCTGTACGTCGTCTTCACCTCTGGGAGCACGGGGAAGCCCAAGGGCGTCGTCATCACGCATCAG
AACTTTTACACGGCCACTCACACTCAGCGGACGCTGCTGGGCATCAAGAGTGACTCCCGCGTCTTTGACTTTTCC
TCCTACGCCTTTGATGTTGCCTGGTTGAATTTGCTCAAGGCACTGACGGCTGGAGCTTGTCTGTGCATTCCCTCG
GCGGCTGAACGGGAGGATGATCTCGGCGGCTGTTTGACCAAGTACGGCATCACCGTCGTCGATCTGACGCCTGCT
GTTGCGCGCGTCATCGAGCCGCGAGGTGTCTTGTCGACGCTGGACACGCTGATTCTCGGTGGCGAGGCCGTCTCA
TCGAGCGATGCTGACTTGGTCGGGGACAAGACGCAGGTCATGGTGGCGTACGGACCGGCTGAGTGCACGCCGACG
TGCTCCATCATGAATCTCACGCAGACCAGGAGTCCGGGCATCGGGCACGGAGTCAGCATGTGTCTCTGGGTTGTT
GATCTCGAGAACGCCGACGAGTTGGCTCCGGTCGGTGCTACGGGCGAGCTCTGGCTTGAAGGCCCGCTCGTTGGA
CTCGGCTACCTCAACGAGCCGGAGAAGACGGCTGCCTCATTCTTCCAGGATCCGGCTTGGTTGACGAGGGGGTCA
GCGGACGGGAAGAGGCCCGGACGAAGAGGCCGTGTCTACCGGACTGGAGATTTGGTGCAGCAGCTGGAGGATGGA
TCGTTCCTGTTTGTCGGCCGCAAGGACACGCAGGTGAAGATCCGGGGGCAGCGTGTTGAGCTCGGTGATATTGAG
CATCATGTTCAACAGACGCTTGAGGAGGTTGGCACCCTGGCCAAGGTGAATGTCGCGGCGGAGACGATTCAGCCT
CGGGGCGTGGAGTCCAAGATGCTCGTGGCCTTTGTGGCGGCTGAGGGGACGACTTCTACAACGACGACGATCGAG
GAGGAGATCCAGCGGGCATCAGCCGCGGCCATGGAGAAGCTGGCCAAGGCTCTGCCCGTCTACATGGTCCCAACC
CTCTTCATCCCCATCCCCGCCCTCCCCATGTCCCCCACTGGCAAAATCGACCGCCGCCGCCTCAAAGAGCAGGGC
TCGCACCTGACAGCCAAGGAGGTAGCGACGCTCAGCCGCCGAGGCGACGGGCAGCGAAGGGCGCCGCAGACGGAA
TCGGAGCGGGTGCTGCGGTCGCTGTGGGCGGAGGTGCTGGGCGTCGAGGAGGAGAGCGGGGTTTGGGTTCTCGGT
TAG
Transcript >Ophun1|7451
ATGGGCTCGCCCGCAGAACGACTGGTCAACGGCCTATCCGACCTATCCATGCACGCCCTTGATGCCGTCCGGGCC
GAACCCATCGAGGCATGCGTCCACGGCCTCATCAAGCTTCACGCTGCCCAACGCCCCTCGGCCCCCGCCATCTGC
TCCAGGGACGGAGAGCTCAGCTATGCACAGCTCGACGTGCTCTCTAGCCGCCTGTCCCGTCAATGGGGCCTGCGT
CCGGCTACGCCCGCTGTCCTCTGCGTGGAAGGATCTCTGCTGGCACCCATCGCTGCCCTGGCCGTTATCAAGTCG
GGCGCCGTCGCCGTGGTCCTTGATCTCGAGCAGCCCCAGGACCGACTTAGGGCCATTATATCCCGCCTGACGGAC
CCCGTCGTCATCTCTTGCTCCAATAATGCCCCCATCGCCCGCAAGCTCGGTCCCGGGCCCGTCATAGTCATTGAC
GTCGATACGCTGTCGGCCCCGGCCCACGACCACTCAACCGCCAGCCTGCCGGTCGTCGTCAGTCCCTCCGATACC
CTCTGTTTGATTTTCCTGCCCGACGCCTCAGACAATCCCACGGGGGCCGCCATTTCCCACCGAGACATGAGCAGC
GCCATTGTCTACCAACAACGCAATCTCGGGTACGCTGTTGATTGTCGCACTCTCGACGTTGCTCCTAGGGGCTCT
TACTCCGCCTGGTGTAACCTGCTGCACACCTTGGCCAATGGCGGCTGTCTCTGTGTCCCGTCACACTGGGACCGC
CGAAAGGACGTCTGGAGTTCGGCTGCAACGCTGCGGGCAAACACGGCGCACGTGACGCCGGACCTGGCCCTGGAT
CTGCTCCACAAGTCCGGTCCGGCCGGCCGGATGCGCCTCACGCTGGTGGGTCAGCCGTCAGCCGCCCCCACCCAG
GGCCGGGACTCTTGTTCCGACGAGAAGCTAGCCAGCCTCGGCGATGGCGTCTGCGCTTTTCTCTCCGATCCGCAA
TCCTCACACCCCCTCGGCCGTATCGTGAGCCAGCTCCGGCCCGAGGGTCCCCTGTTCGGCCCCGAGCCGGCTTCT
CTTACCATCCTAACTCCGCCGTCGATCGCATCCTTCTGGTCAGGCTGTGACGGCTGGATCTCTTCCATCGGCGAT
GTCGTACGAGGCTCAGATGGCAAGTGTTTCGTCCGCGGCACGTCTACAAACTCGATCGACGGTGAGGCCAAGAGC
CAGAGCCGGCAGGACAGCGAGCCGTCCGAGGACAGCATCGACAACCTACAATTCTCATCCGAGAGCGAAGAGACG
CTCGACACTCCCGAGGCAGAGCAGGCTGACGCTTCGGAGACGGAGCAGCTTCTGTTGCCTGTCTGGGCCCAAGCC
CTTCACATCAGCTCGGAAAAGATCTCCGGCGATGACGACTTCTATGAGCTCGGTGGCGATGCTGCCAAGGGTCTG
CGTCTTCATGCCCTGGCCCGCGACCAGGGCCTTCACTTCTCGCTGCGTGACCTCTTCCGGGGCACCAGCCTTCGC
CACCTTGCAATGCGGACCAGTCAAGGTAGACCGAACTCGACCCCGGGCGTTCCCCCTTTCTCCCTACTGGCTTCC
ATCACCCACATGGAAGAATCACGCGCCCAAGTCGCTCAGCTCTGTCGCGCCCAGACCTCACAGGTCGTCGACATT
CTCCCCTGCTCGCCCCTTCAGGAGGGTCTGCTGGCACTCACCCAGAGACTCCCGGGCAGCTATGTAGCTCAGCAC
ATCTACGAGATCGACGAGGGTATCAGCCTTTCACGCCTGCGCCGTGCCTGGGACCAGGTCGTGGCCATGAACCCC
GTGCTGAGGACCCGCGTTGTCAGTCTTCCCGGTCAGGGACTCGTCCAGGTCGTGCTGGAGCAAGGAGCTTCGTGG
TCGTCGGCTACCGATCTCAACGACTATCAGCGCCAACACAGCGAAGCGGACCAACAGATGGGACTCGGCACCCCC
TTGTCGAGGTTTGCCATTCTCGATGCCGGCGCGGGCGCCCGTCCCTGTCTCCTGTGGGAGATCCACCATGCTTTG
TATGATGGATGGTCTCTGCCGCTGGTGATGGGCGAGGTTGAAAGCGCCTACTACGGTGAGGCCGGCCAGGACCTG
GAGCCCATGACGGGCTTCATCAAGTACATCCGAGACCGCGACGAGGTAGCGGCCAAGGAGTTCTGGCGAGGCCAG
TTTGCTGGAATTCAGGAGGCCCACTTCCCCCGGCCTCGACCGACAACGGCAGCTTCACCATCAGCAGCACAAATG
TCCCTGACGGTCCCGAATCTCGGCTGGGGCCGCAGCGACTTTACACCGGCTACCATGGCCCGCGCCGCTTGGGCC
GTCGTCACGGCACGCGGAGCCGGCTCTGATGAGGCTCTGTACGGCGTCACCGTGACGGGCCGTCAGGCGCCAGTC
GACGGCATCGAGCGCATGGCTGGTCCGGCTATCGCGACGGTGCCCATGAGGGTGCCTGTGGACTGGGAGGGTAGC
GTACAGCGGCTGCTTGAAGCGGTACAGCGACAATCGACGGACATGATTCCCTTTGAGCAGACCGGACTGCAGAAC
ATCCGCCGGATGGGCAGCGAGGCCGCCATGGCCTGTGGTTTCCGCTCGCTCATGGTGGTTCAGCCTGGGGCCAGC
GGCAGTGACGGTGATGGAGAATCCCGGCCTTTCTTGAGCAAGCCCAGCATCGGCGGCGAGGATGACGAACAGCAG
GAAAAGGAGCTCGCTCCTACGACATACCCCATCGAGGTGGAATGCCATCTGGGCGCCGACGAGGCCCGGTTGCGT
CTCGACTTCAACCCCGATGCCGTCGATCGTCGCGAGATGGAGGCCATTGCTGAGAGCTTCACGAACGTTCTCCGC
AAGTTGGCGGACCGGAGTTTGGCGCAGGAAAAGGTCGGATCCCTGGTCGCTACCCAACCAGACCGCGTCGAGAAA
GCTCTCTCGTGGAACGCCACCGTCCCCGAGCCCGTGGAGCAGTGCGTCCATCACATTATCGCTCGCCGCGTCCAC
GAGCGCCCTCTGGCCCCTGCCCTCCGCGCCTGGGACGGCGAGCTCACCTATCGGGATCTGGACGAGCGGTCGACG
GCCCTGGCGCTCCGGCTCGTGTCCCGGGGCGTTGGCGGGACTCTGGTTCCAGTGCTGTTTGAGAAGTCGGCCTGG
ATGCCCGTCGCCGTGTTGGCCGTGTTGAAGGCCGGTGGCGCCCTGGTCGCGTTGGAAACGAAGGATCCCGAGGAC
AGACTGCGGACTATTGCTTCTCAGGCCACGTCTCCCGTGTTCTTATCGTCAGTTCGCAACGCTGCTCTGGCTCGT
CGCCTGGCTGGAGAGGGCAAGATGGAGGTTGAAGTCGTTGGAGGCTCTCAGAACGAGCAGGCCGACGCTGAACCG
CAACACGCGCTCTCCCTTCTCCCGACCGTTGTTCCGTCCAGCCTGCTCTACGTCGTCTTTACCTCTGGCAGTACG
GGAACACCGAAGGGAGTCATGATCTCTCACAGGAGCTTCTGCAGTGCCATTGCCTACCAGCAGTCTTTTCTGGAC
TACAATCAAAATGCCCGCGTGCTGGACTTTGCCTCGTGTGCGTTCGACGTCTCCTGGTCCAACCTTTTCAATACC
CTTACCTCTGGAGCCTGCCTCTGCATCCCGTCGCCCGAAGAGCGGGAGAACGACTTGGCAGGGTGCCTTTCCAAG
TATGACATTACCTTTGCCGACTTGACGCCTTCGGTTGCTCGTGCTCTTGGCCCCGACGTGCTTTCAGGGTTGTCG
ACTATGATTCTGGGTGGTGAAGCTCCCCTGCCGAGTGACGCCTCGCTAGCTGGCGGCAAGACTCACATCATCAAC
GCCTATGGCCCGGCTGAATGCACACCTACTGCAACGCTTTCGACGCTCAACGCCACCGACGTCTGCATAGGCCGT
GGACTCGGAATCTGCACATGGATCGTCGACGTCGACGGTGCTGATTCGCTGACGCCGGTCGGGGACGTGGGCGAG
CTCTGGATCGAGGGCCCGCTCGTGGGCGACGGATACCTCAACGATGCTGAGCGGACGGCGACAGCCTTCATCCGA
GATCCAGCGTGGCTTCAGCGGGCTGTTGGCCGGCGAGGCGTCGTCTACCGTACCGGTGATCTCGTGCGGTATAGG
GATGACGGAACGCTCGTCTTCATCGGACGCAAAGACACACAAGTCAAGATCCGCGGTCAGCGCGTTGAATTGGCC
GAGGTCGAGAGCTGCGTTCGCCGGCTGATGGACAGTGACGATGTTCAGGTAGTGGCTGAGGCCATCCAGCCGCCT
GGAGCCAACAATCCCGTGCTCGTGGCCATGATTGCTCTTTCAGGGGCCGAGGCCATGGCTGACGACGAGCTCGAC
AAGGCCGTGAGGAAGGCCACCGAGGGACTCTCTGACCGGCTACGTCAGGCGGTCCCGTCATACATGGTTCCGGCT
GCCTACATCCCGGTGCGGGAGATGCCGGTGACGACGGCCGGGAAGACGGACCGGCGCCGGCTCCGGGCCATCGGC
GTCTCGCTGTGGGCTCAGCACCGGGCCGACAAGAAGACCGAGTCTACGCAACCGGCGACGGAGATGGAGAGCATC
CTGCAAAAGGTGTGGATGTCGGTGCTAAACTTGACTGCCGAGGAGGCGTCGGTCGAAGCCGGCTTTGCCAGTCTC
GGAGGCGATTCCATCTCGGCCATGCAGCTGGTGTCTCGCTGCCGGCTTCACAACGTCATGTTCACCGTCAGCGAC
ATCCTTCAGTCCAACACGATCCGCAAGCTCGCTTCTTTGTACAAGCCGGTGGCGTCGACGACTGGGAGCGAGCTT
CTCAAGGCCATCGAGCAGGATGAAGAGGACGATCCGACGGCCGAGTTTGACCTCTCGCCTATGCAGCATTCCTTC
TTCCGCGACTATCCTGATGGCCTCAACCACTTCAACCAATCCTTCCTCCTTGATCTTGGCCAAGACGTCACGACT
CGCGCGCTCAAGGACGCGCTCGTGGCTCTTGTCGACCGCCACGCCATGCTCCGCGCTCGTTTCCAGAAAGATAGC
AAGAGCGGTGTTTGGAAGCAGAGAATCGAGGAAGAGGGCCCTGACTCGTTTGCTTTCTCCGAGCACAAGGTGGCC
AACCGCGACGAAGTCGGCATCATCGGCCAGCGTCGCCAGAACAAGCTCGACATTTGCAAGGGGCCCGTCTTTGCT
TGCGATCTGTTCCGCCTGCCAGACGGCGGCCAGGTGGTTCTACTCTCGGCTCATCATCTGGTCATCGACCTGGTA
TCGTGGCGGATTCTCTGGAACGATGTCGAGGAGCACGTTCGCCTCGGAGAGCCCCTGACGCAGAAGACGCTCTCG
TTCCGATCCTGGTGCGCGGCACAGGCCAAGATTGGCAGCAGTCTCTCGCCCCTATCGGTGCTGCCCTACCCGATC
CCGGAGCCGGAGCTGGACTTTTGGGGTCTGGCTCCGGAGAAGAACACGTTTGGCGACTGTGATACGCTGGACGTG
AGTCTCTCGCGGGAAGTGAGCAAGCTTCTCTTTGGGAAATGCAACGACAGCCTCAAGACGGAAGCGCTCGACCTC
ATCCTCGGTGCTCTTTCGTTTTCCTTCGCCCAGACGTTCCCTGAGCGTTCGGTGCCCGCCATCTGGATCGAGGGC
CATGGCAGGGAGCAGCTAGAGGCTGATCTCCCGACTGACGTCTCGGGCACCATCGGCTGGTTCACCACCATGTAC
CCCCTGGCCGTGCCCATCACCCCTGGCCAGCCGGTGACGCACGCAGTCCGGCTCGTCAAGGATACCAGGAGGAGA
GTCCCGCGCATGGGCTTGCCCTTTTACGCGTGCCAGCACTACAGTGAGTCTGGACGACAGGCCTTCCAGGGTCAC
GACGTGTACGAGATTGTCTTCAACTTTACCGGCCGATTTCAGCAGCTGGAACGGGAGGAGGGTCTGTTCAAGTCG
TCGCAGGGATCTGACGAGAGCGACGTCAAGATTGTCGAGATTGCAAAGTCGGCTCGACGCTTCCTTATGCTCGAG
ATTGGCGCGGGTGTGGCAGATAACATGCTGTCTGTCACTTTCAACTACCACAAGAGCATGAAGCATCTCGACCGG
CTGCGGGAATGGTCGCACAATTTCGTCGATGTTCTTGAATCGGCTGTTACTGAGCTCGCTGCCAGTCCTGTCGGC
TTCACCCTGAGCGATCTGCCCCTGACGCAACTCTCTTACCGCGGTCTCGATTCGCTGTTGACGGAGCAGCTGCCG
CGGATGGGCATCGAGCCGCGCCAGATTCAGAACATCTACCCCTGCTCGCCTCTTCAGGAGGGCATGCTGTTGAGT
TCGGTCAAGGGGGCAGCGTCGTACATCACGTACACCATCTGGCGTTGCAACTCGACCGGTCCTGACGCTCAGCCC
GTATCGCCCTCGCGGCTAGAGGAGGCGTGGAAGAAGGTGGTCAGCCGTCATAGCATTCTCTCGACTGTCTTTGCC
CTGCATCCAGAGGGCAACGGCTTCCTGCAGATTGTGCTGGACAAGCCATCGATCCGGGTGACGCAGCTGGAGGCT
GGCTCTGACGCCCCCACTGATATCCTCTCTCGGTTGCCGGAGTCGACGTTTGCAGACAATGAGCCGGAGCACGCC
TTTATCATCTGCCGATCGGACCAGACGGGCGAGGTTGCTTGTCGATTGGACATGAGCCACGCTCTGACGGACGCC
CATTCCGCTTCCCTGCTGCTCACCGAGCTCGGAACGGCATACAATGGCACCGGGGAGCTGGCAGTGGCACCGGCA
TTTGTCGAAATCATCCGCTACATCAACAGCACGCCTCGGTCGCAAATCGTCAGCACCTGGACGTCTCTGCTCGAC
AAGGTCAAGCCCTGCGAGTTCCCGCTTTCTCCTCTGGCCGTGGAAGGAGACGAGGAGAAGTTTACGGAGCTCTCT
TGCAACGCTGAGCTGCACATGAGCATCAACGAGTTCTGTAAGAGGACGGAGCTGATGCCGTCGGCTGTGATTCAG
GTGGCCTGGGGCATGACCATGTCGCACATGACGGGCATGAACGACGTTTGCTTCGGCTACCTCGTTTCCGGACGA
GACGCGCCGGTCAAGGGCGTCGAGAGCCTGGTCGGGCCCTTGGCTAACCTCCTCATCAGCAGGGTTGACTTGGGC
GCGTCGGCGAGGCAGGTTCTGGAAACGACGTCGGAGAGGTTGAAGCAGCACATGTCGATTCAGCACGTCTCGTTG
GCTGAGATTCAGCACCATCTCGGGCACTCTGGGAGGCGGCTGTTTAATACGTCGCTGGCGCTTCGTGCCAATGAG
AAGGAAAAGGTCGGAGTTGAGTCGGGCTTGTCGTTTGACATCCTGTCGGGTGGTGACTCTCACGAGTTTGACGTC
AAGTGCAACGCCTCCATTGGAGGAGCTGATATTGACATCTCTGTCGAGTTCCGGGAGCCGCATGTGAGCAGAAAA
GCAGCTCTGGAAGCACGGGATACCCTTGAGCGCGCCATCGGCTACATCCTCACCAACACGTACCCGAGCACTGAC
ATTCAGGATGACATTGACGTGGAGACGACCACCCTCTACGATGGCTTCTTCAAGCACATGACTGGTGTCGAGGAT
TCGGCAGCTCGGTCGTTCTGGACGGATCAGTTTGCCAGCACGCAGGGGATACACTTCCCTCTGCCCAAGCCGGGC
CTCAGCCACGCCGTGCTTGATGGCTCGGTTCAACTCGACATCGGGCAGCTGGATTGGCAGTCTGGGGACTTTGAC
GCTGAGACCTTGATCAGGAGTGCCTGGTCTGTGCTGGCTGCCCGCCTCATGTGCTCGGACGAGAGTCTGTTTGGA
GCGATGAGCAAGCATTCAGTCGAACCGATGCCGATCCGTGTCGTGGTTGACTGGGAGAAGAGCGTGGGCAGTCTC
CTGGAAGAGGTGCAGCGCCAGACAACAGCCATGAAGCCGTTTGGACGCATGAGCTTGGACCGGATTCGGCGTTTC
AACGAGGATGCCGCCTTGGCTTGTGGCTTCCAGACGTTGCTGACGGACGAGGAGACGAAGGAGGGACGCGTCTCA
CACTCGCTCGAGGTGATTGTCCGGGGCGAGGGCATCACCATCCGGTTCGACTCGAGGGTGATGGAAGAGGTGCGA
GTGTCGCGGCTTGTGCATCAGTTTGAACACGTGCTGGGTCAAATGCTTGACCCGGATATGCGGCAGAAGAAGCTC
AGACAAGTAACGGCAGCCAGCAAGCGGGACATCGATGACGTATGGAGGTGGAACGCCGAGGTGCCTCCCATGATC
TCGGGCTGTATCCATGACGACATTGTGGCCAACGTTGAGACGCGTCCTGATGCTTCGGCCATTGACGCCTGGGAT
GGCGGCATGACATACAAGCAGCTCGAGGAGGCATCGCGGAAGCTGGCTATCCGGCTCATGAAGAGCGGAGTCGGC
GTGGGCAGCATCGTTCCGCTATGCTTCGAGAAGTCGATGTGGATGCCGGTGGCGGCTCTGGCTGTTATGAGAGCC
GGAGGAGCGTCGGTTGCCGTTGATACGACGCAGCCCATGGAGCGGATAGGGACCATGACGTCGCAGGTGTTTGCT
GCGCTGCCGAGGCCCAAGGTGATTCTATCGTCGGTTGCCAACGAGGCCATGGTGGGCCAGTTGCAAGCTGACGAG
GTCATTGTCATCGGCCGTGACACTCTCGACTCTCTGGAAGAGGACGACAAGAGCTACGAGTTGCCTGCCGTCGCG
CCTACCGACGTGCTGTACGTCGTCTTCACCTCTGGGAGCACGGGGAAGCCCAAGGGCGTCGTCATCACGCATCAG
AACTTTTACACGGCCACTCACACTCAGCGGACGCTGCTGGGCATCAAGAGTGACTCCCGCGTCTTTGACTTTTCC
TCCTACGCCTTTGATGTTGCCTGGTTGAATTTGCTCAAGGCACTGACGGCTGGAGCTTGTCTGTGCATTCCCTCG
GCGGCTGAACGGGAGGATGATCTCGGCGGCTGTTTGACCAAGTACGGCATCACCGTCGTCGATCTGACGCCTGCT
GTTGCGCGCGTCATCGAGCCGCGAGGTGTCTTGTCGACGCTGGACACGCTGATTCTCGGTGGCGAGGCCGTCTCA
TCGAGCGATGCTGACTTGGTCGGGGACAAGACGCAGGTCATGGTGGCGTACGGACCGGCTGAGTGCACGCCGACG
TGCTCCATCATGAATCTCACGCAGACCAGGAGTCCGGGCATCGGGCACGGAGTCAGCATGTGTCTCTGGGTTGTT
GATCTCGAGAACGCCGACGAGTTGGCTCCGGTCGGTGCTACGGGCGAGCTCTGGCTTGAAGGCCCGCTCGTTGGA
CTCGGCTACCTCAACGAGCCGGAGAAGACGGCTGCCTCATTCTTCCAGGATCCGGCTTGGTTGACGAGGGGGTCA
GCGGACGGGAAGAGGCCCGGACGAAGAGGCCGTGTCTACCGGACTGGAGATTTGGTGCAGCAGCTGGAGGATGGA
TCGTTCCTGTTTGTCGGCCGCAAGGACACGCAGGTGAAGATCCGGGGGCAGCGTGTTGAGCTCGGTGATATTGAG
CATCATGTTCAACAGACGCTTGAGGAGGTTGGCACCCTGGCCAAGGTGAATGTCGCGGCGGAGACGATTCAGCCT
CGGGGCGTGGAGTCCAAGATGCTCGTGGCCTTTGTGGCGGCTGAGGGGACGACTTCTACAACGACGACGATCGAG
GAGGAGATCCAGCGGGCATCAGCCGCGGCCATGGAGAAGCTGGCCAAGGCTCTGCCCGTCTACATGGTCCCAACC
CTCTTCATCCCCATCCCCGCCCTCCCCATGTCCCCCACTGGCAAAATCGACCGCCGCCGCCTCAAAGAGCAGGGC
TCGCACCTGACAGCCAAGGAGGTAGCGACGCTCAGCCGCCGAGGCGACGGGCAGCGAAGGGCGCCGCAGACGGAA
TCGGAGCGGGTGCTGCGGTCGCTGTGGGCGGAGGTGCTGGGCGTCGAGGAGGAGAGCGGGGTTTGGGTTCTCGGT
TAG
Gene >Ophun1|7451
ATGGGCTCGCCCGCAGAACGACTGGTCAACGGCCTATCCGACCTATCCATGCACGCCCTTGATGCCGTCCGGGCC
GAACCCATCGAGGCATGCGTCCACGGCCTCATCAAGCTTCACGCTGCCCAACGCCCCTCGGCCCCCGCCATCTGC
TCCAGGGACGGAGAGCTCAGCTATGCACAGCTCGACGTGCTCTCTAGCCGCCTGTCCCGTCAATGGGGCCTGCGT
CCGGCTACGCCCGCTGTCCTCTGCGTGGAAGGATCTCTGCTGGCACCCATCGCTGCCCTGGCCGTTATCAAGTCG
GGCGCCGTCGCCGTGGTCCTTGATCTCGAGCAGCCCCAGGACCGACTTAGGGCCATTATATCCCGCCTGACGGAC
CCCGTCGTCATCTCTTGCTCCAATAATGCCCCCATCGCCCGCAAGCTCGGTCCCGGGCCCGTCATAGTCATTGAC
GTCGATACGCTGTCGGCCCCGGCCCACGACCACTCAACCGCCAGCCTGCCGGTCGTCGTCAGTCCCTCCGATACC
CTCTGTTTGATTTTCCTGCCCGACGCCTCAGACAATCCCACGGGGGCCGCCATTTCCCACCGAGACATGAGCAGC
GCCATTGTCTACCAACAACGCAATCTCGGGTACGCTGTTGATTGTCGCACTCTCGACGTTGCTCCTAGGGGCTCT
TACTCCGCCTGGTGTAACCTGCTGCACACCTTGGCCAATGGCGGCTGTCTCTGTGTCCCGTCACACTGGGACCGC
CGAAAGGACGTCTGGAGTTCGGCTGCAACGCTGCGGGCAAACACGGCGCACGTGACGCCGGACCTGGCCCTGGAT
CTGCTCCACAAGTCCGGTCCGGCCGGCCGGATGCGCCTCACGCTGGTGGGTCAGCCGTCAGCCGCCCCCACCCAG
GGCCGGGACTCTTGTTCCGACGAGAAGCTAGCCAGCCTCGGCGATGGCGTCTGCGCTTTTCTCTCCGATCCGCAA
TCCTCACACCCCCTCGGCCGTATCGTGAGCCAGCTCCGGCCCGAGGGTCCCCTGTTCGGCCCCGAGCCGGCTTCT
CTTACCATCCTAACTCCGCCGTCGATCGCATCCTTCTGGTCAGGCTGTGACGGCTGGATCTCTTCCATCGGCGAT
GTCGTACGAGGCTCAGATGGCAAGTGTTTCGTCCGCGGCACGTCTACAAACTCGATCGACGGTGAGGCCAAGAGC
CAGAGCCGGCAGGACAGCGAGCCGTCCGAGGACAGCATCGACAACCTACAATTCTCATCCGAGAGCGAAGAGACG
CTCGACACTCCCGAGGCAGAGCAGGCTGACGCTTCGGAGACGGAGCAGCTTCTGTTGCCTGTCTGGGCCCAAGCC
CTTCACATCAGCTCGGAAAAGATCTCCGGCGATGACGACTTCTATGAGCTCGGTGGCGATGCTGCCAAGGGTCTG
CGTCTTCATGCCCTGGCCCGCGACCAGGGCCTTCACTTCTCGCTGCGTGACCTCTTCCGGGGCACCAGCCTTCGC
CACCTTGCAATGCGGACCAGTCAAGGTAGACCGAACTCGACCCCGGGCGTTCCCCCTTTCTCCCTACTGGCTTCC
ATCACCCACATGGAAGAATCACGCGCCCAAGTCGCTCAGCTCTGTCGCGCCCAGACCTCACAGGTCGTCGACATT
CTCCCCTGCTCGCCCCTTCAGGAGGGTCTGCTGGCACTCACCCAGAGACTCCCGGGCAGCTATGTAGCTCAGCAC
ATCTACGAGATCGACGAGGGTATCAGCCTTTCACGCCTGCGCCGTGCCTGGGACCAGGTCGTGGCCATGAACCCC
GTGCTGAGGACCCGCGTTGTCAGTCTTCCCGGTCAGGGACTCGTCCAGGTCGTGCTGGAGCAAGGAGCTTCGTGG
TCGTCGGCTACCGATCTCAACGACTATCAGCGCCAACACAGCGAAGCGGACCAACAGATGGGACTCGGCACCCCC
TTGTCGAGGTTTGCCATTCTCGATGCCGGCGCGGGCGCCCGTCCCTGTCTCCTGTGGGAGATCCACCATGCTTTG
TATGATGGATGGTCTCTGCCGCTGGTGATGGGCGAGGTTGAAAGCGCCTACTACGGTGAGGCCGGCCAGGACCTG
GAGCCCATGACGGGCTTCATCAAGTACATCCGAGACCGCGACGAGGTAGCGGCCAAGGAGTTCTGGCGAGGCCAG
TTTGCTGGAATTCAGGAGGCCCACTTCCCCCGGCCTCGACCGACAACGGCAGCTTCACCATCAGCAGCACAAATG
TCCCTGACGGTCCCGAATCTCGGCTGGGGCCGCAGCGACTTTACACCGGCTACCATGGCCCGCGCCGCTTGGGCC
GTCGTCACGGCACGCGGAGCCGGCTCTGATGAGGCTCTGTACGGCGTCACCGTGACGGGCCGTCAGGCGCCAGTC
GACGGCATCGAGCGCATGGCTGGTCCGGCTATCGCGACGGTGCCCATGAGGGTGCCTGTGGACTGGGAGGGTAGC
GTACAGCGGCTGCTTGAAGCGGTACAGCGACAATCGACGGACATGATTCCCTTTGAGCAGACCGGACTGCAGAAC
ATCCGCCGGATGGGCAGCGAGGCCGCCATGGCCTGTGGTTTCCGCTCGCTCATGGTGGTTCAGCCTGGGGCCAGC
GGCAGTGACGGTGATGGAGAATCCCGGCCTTTCTTGAGCAAGCCCAGCATCGGCGGCGAGGATGACGAACAGCAG
GAAAAGGAGCTCGCTCCTACGACATACCCCATCGAGGTGGAATGCCATCTGGGCGCCGACGAGGCCCGGTTGCGT
CTCGACTTCAACCCCGATGCCGTCGATCGTCGCGAGATGGAGGCCATTGCTGAGAGCTTCACGAACGTTCTCCGC
AAGTTGGCGGACCGGAGTTTGGCGCAGGAAAAGGTCGGATCCCTGGTCGCTACCCAACCAGACCGCGTCGAGAAA
GCTCTCTCGTGGAACGCCACCGTCCCCGAGCCCGTGGAGCAGTGCGTCCATCACATTATCGCTCGCCGCGTCCAC
GAGCGCCCTCTGGCCCCTGCCCTCCGCGCCTGGGACGGCGAGCTCACCTATCGGGATCTGGACGAGCGGTCGACG
GCCCTGGCGCTCCGGCTCGTGTCCCGGGGCGTTGGCGGGACTCTGGTTCCAGTGCTGTTTGAGAAGTCGGCCTGG
ATGCCCGTCGCCGTGTTGGCCGTGTTGAAGGCCGGTGGCGCCCTGGTCGCGTTGGAAACGAAGGATCCCGAGGAC
AGACTGCGGACTATTGCTTCTCAGGCCACGTCTCCCGTGTTCTTATCGTCAGTTCGCAACGCTGCTCTGGCTCGT
CGCCTGGCTGGAGAGGGCAAGATGGAGGTTGAAGTCGTTGGAGGCTCTCAGAACGAGCAGGCCGACGCTGAACCG
CAACACGCGCTCTCCCTTCTCCCGACCGTTGTTCCGTCCAGCCTGCTCTACGTCGTCTTTACCTCTGGCAGTACG
GGAACACCGAAGGGAGTCATGATCTCTCACAGGAGCTTCTGCAGTGCCATTGCCTACCAGCAGTCTTTTCTGGAC
TACAATCAAAATGCCCGCGTGCTGGACTTTGCCTCGTGTGCGTTCGACGTCTCCTGGTCCAACCTTTTCAATACC
CTTACCTCTGGAGCCTGCCTCTGCATCCCGTCGCCCGAAGAGCGGGAGAACGACTTGGCAGGGTGCCTTTCCAAG
TATGACATTACCTTTGCCGACTTGACGCCTTCGGTTGCTCGTGCTCTTGGCCCCGACGTGCTTTCAGGGTTGTCG
ACTATGATTCTGGGTGGTGAAGCTCCCCTGCCGAGTGACGCCTCGCTAGCTGGCGGCAAGACTCACATCATCAAC
GCCTATGGCCCGGCTGAATGCACACCTACTGCAACGCTTTCGACGCTCAACGCCACCGACGTCTGCATAGGCCGT
GGACTCGGAATCTGCACATGGATCGTCGACGTCGACGGTGCTGATTCGCTGACGCCGGTCGGGGACGTGGGCGAG
CTCTGGATCGAGGGCCCGCTCGTGGGCGACGGATACCTCAACGATGCTGAGCGGACGGCGACAGCCTTCATCCGA
GATCCAGCGTGGCTTCAGCGGGCTGTTGGCCGGCGAGGCGTCGTCTACCGTACCGGTGATCTCGTGCGGTATAGG
GATGACGGAACGCTCGTCTTCATCGGACGCAAAGACACACAAGTCAAGATCCGCGGTCAGCGCGTTGAATTGGCC
GAGGTCGAGAGCTGCGTTCGCCGGCTGATGGACAGTGACGATGTTCAGGTAGTGGCTGAGGCCATCCAGCCGCCT
GGAGCCAACAATCCCGTGCTCGTGGCCATGATTGCTCTTTCAGGGGCCGAGGCCATGGCTGACGACGAGCTCGAC
AAGGCCGTGAGGAAGGCCACCGAGGGACTCTCTGACCGGCTACGTCAGGCGGTCCCGTCATACATGGTTCCGGCT
GCCTACATCCCGGTGCGGGAGATGCCGGTGACGACGGCCGGGAAGACGGACCGGCGCCGGCTCCGGGCCATCGGC
GTCTCGCTGTGGGCTCAGCACCGGGCCGACAAGAAGACCGAGTCTACGCAACCGGCGACGGAGATGGAGAGCATC
CTGCAAAAGGTGTGGATGTCGGTGCTAAACTTGACTGCCGAGGAGGCGTCGGTCGAAGCCGGCTTTGCCAGTCTC
GGAGGCGATTCCATCTCGGCCATGCAGCTGGTGTCTCGCTGCCGGCTTCACAACGTCATGTTCACCGTCAGCGAC
ATCCTTCAGTCCAACACGATCCGCAAGCTCGCTTCTTTGTACAAGCCGGTGGCGTCGACGACTGGGAGCGAGCTT
CTCAAGGCCATCGAGCAGGATGAAGAGGACGATCCGACGGCCGAGTTTGACCTCTCGCCTATGCAGCATTCCTTC
TTCCGCGACTATCCTGATGGCCTCAACCACTTCAACCAATCCTTCCTCCTTGATCTTGGCCAAGACGTCACGACT
CGCGCGCTCAAGGACGCGCTCGTGGCTCTTGTCGACCGCCACGCCATGCTCCGCGCTCGTTTCCAGAAAGATAGC
AAGAGCGGTGTTTGGAAGCAGAGAATCGAGGAAGAGGGCCCTGACTCGTTTGCTTTCTCCGAGCACAAGGTGGCC
AACCGCGACGAAGTCGGCATCATCGGCCAGCGTCGCCAGAACAAGCTCGACATTTGCAAGGGGCCCGTCTTTGCT
TGCGATCTGTTCCGCCTGCCAGACGGCGGCCAGGTGGTTCTACTCTCGGCTCATCATCTGGTCATCGACCTGGTA
TCGTGGCGGATTCTCTGGAACGATGTCGAGGAGCACGTTCGCCTCGGAGAGCCCCTGACGCAGAAGACGCTCTCG
TTCCGATCCTGGTGCGCGGCACAGGCCAAGATTGGCAGCAGTCTCTCGCCCCTATCGGTGCTGCCCTACCCGATC
CCGGAGCCGGAGCTGGACTTTTGGGGTCTGGCTCCGGAGAAGAACACGTTTGGCGACTGTGATACGCTGGACGTG
AGTCTCTCGCGGGAAGTGAGCAAGCTTCTCTTTGGGAAATGCAACGACAGCCTCAAGACGGAAGCGCTCGACCTC
ATCCTCGGTGCTCTTTCGTTTTCCTTCGCCCAGACGTTCCCTGAGCGTTCGGTGCCCGCCATCTGGATCGAGGGC
CATGGCAGGGAGCAGCTAGAGGCTGATCTCCCGACTGACGTCTCGGGCACCATCGGCTGGTTCACCACCATGTAC
CCCCTGGCCGTGCCCATCACCCCTGGCCAGCCGGTGACGCACGCAGTCCGGCTCGTCAAGGATACCAGGAGGAGA
GTCCCGCGCATGGGCTTGCCCTTTTACGCGTGCCAGCACTACAGTGAGTCTGGACGACAGGCCTTCCAGGGTCAC
GACGTGTACGAGATTGTCTTCAACTTTACCGGCCGATTTCAGCAGCTGGAACGGGAGGAGGGTCTGTTCAAGTCG
TCGCAGGGATCTGACGAGAGCGACGTCAAGATTGTCGAGATTGCAAAGTCGGCTCGACGCTTCCTTATGCTCGAG
ATTGGCGCGGGTGTGGCAGATAACATGCTGTCTGTCACTTTCAACTACCACAAGAGCATGAAGCATCTCGACCGG
CTGCGGGAATGGTCGCACAATTTCGTCGATGTTCTTGAATCGGCTGTTACTGAGCTCGCTGCCAGTCCTGTCGGC
TTCACCCTGAGCGATCTGCCCCTGACGCAACTCTCTTACCGCGGTCTCGATTCGCTGTTGACGGAGCAGCTGCCG
CGGATGGGCATCGAGCCGCGCCAGATTCAGAACATCTACCCCTGCTCGCCTCTTCAGGAGGGCATGCTGTTGAGT
TCGGTCAAGGGGGCAGCGTCGTACATCACGTACACCATCTGGCGTTGCAACTCGACCGGTCCTGACGCTCAGCCC
GTATCGCCCTCGCGGCTAGAGGAGGCGTGGAAGAAGGTGGTCAGCCGTCATAGCATTCTCTCGACTGTCTTTGCC
CTGCATCCAGAGGGCAACGGCTTCCTGCAGATTGTGCTGGACAAGCCATCGATCCGGGTGACGCAGCTGGAGGCT
GGCTCTGACGCCCCCACTGATATCCTCTCTCGGTTGCCGGAGTCGACGTTTGCAGACAATGAGCCGGAGCACGCC
TTTATCATCTGCCGATCGGACCAGACGGGCGAGGTTGCTTGTCGATTGGACATGAGCCACGCTCTGACGGACGCC
CATTCCGCTTCCCTGCTGCTCACCGAGCTCGGAACGGCATACAATGGCACCGGGGAGCTGGCAGTGGCACCGGCA
TTTGTCGAAATCATCCGCTACATCAACAGCACGCCTCGGTCGCAAATCGTCAGCACCTGGACGTCTCTGCTCGAC
AAGGTCAAGCCCTGCGAGTTCCCGCTTTCTCCTCTGGCCGTGGAAGGAGACGAGGAGAAGTTTACGGAGCTCTCT
TGCAACGCTGAGCTGCACATGAGCATCAACGAGTTCTGTAAGAGGACGGAGCTGATGCCGTCGGCTGTGATTCAG
GTGGCCTGGGGCATGACCATGTCGCACATGACGGGCATGAACGACGTTTGCTTCGGCTACCTCGTTTCCGGACGA
GACGCGCCGGTCAAGGGCGTCGAGAGCCTGGTCGGGCCCTTGGCTAACCTCCTCATCAGCAGGGTTGACTTGGGC
GCGTCGGCGAGGCAGGTTCTGGAAACGACGTCGGAGAGGTTGAAGCAGCACATGTCGATTCAGCACGTCTCGTTG
GCTGAGATTCAGCACCATCTCGGGCACTCTGGGAGGCGGCTGTTTAATACGTCGCTGGCGCTTCGTGCCAATGAG
AAGGAAAAGGTCGGAGTTGAGTCGGGCTTGTCGTTTGACATCCTGTCGGGTGGTGACTCTCACGAGGTTGGTTCT
CTCCTGTCGACTTGAGTTGATATGAGCTGACAGGTTTGCAGTTTGACGTCAAGTGCAACGCCTCCATTGGAGGAG
CTGATATTGACATCTCTGTCGAGTTCCGGGAGCCGCATGTGAGCAGAAAAGCAGCTCTGGAAGCACGGGATACCC
TTGAGCGCGCCATCGGCTACATCCTCACCAACACGTACCCGAGCACTGACATTCAGGATGACATTGACGTGGAGA
CGACCACCCTCTACGATGGCTTCTTCAAGCACATGACTGGTGTCGAGGATTCGGCAGCTCGGTCGTTCTGGACGG
ATCAGTTTGCCAGCACGCAGGGGATACACTTCCCTCTGCCCAAGCCGGGCCTCAGCCACGCCGTGCTTGATGGCT
CGGTTCAACTCGACATCGGGCAGCTGGATTGGCAGTCTGGGGACTTTGACGCTGAGACCTTGATCAGGAGTGCCT
GGTCTGTGCTGGCTGCCCGCCTCATGTGCTCGGACGAGAGTCTGTTTGGAGCGATGAGCAAGCATTCAGTCGAAC
CGATGCCGATCCGTGTCGTGGTTGACTGGGAGAAGAGCGTGGGCAGTCTCCTGGAAGAGGTGCAGCGCCAGACAA
CAGCCATGAAGCCGTTTGGACGCATGAGCTTGGACCGGATTCGGCGTTTCAACGAGGATGCCGCCTTGGCTTGTG
GCTTCCAGACGTTGCTGACGGACGAGGAGACGAAGGAGGGACGCGTCTCACACTCGCTCGAGGTGATTGTCCGGG
GCGAGGGCATCACCATCCGGTTCGACTCGAGGGTGATGGAAGAGGTGCGAGTGTCGCGGCTTGTGCATCAGTTTG
AACACGTGCTGGGTCAAATGCTTGACCCGGATATGCGGCAGAAGAAGCTCAGACAAGTAACGGCAGCCAGCAAGC
GGGACATCGATGACGTATGGAGGTGGAACGCCGAGGTGCCTCCCATGATCTCGGGCTGTATCCATGACGACATTG
TGGCCAACGTTGAGACGCGTCCTGATGCTTCGGCCATTGACGCCTGGGATGGCGGCATGACATACAAGCAGCTCG
AGGAGGCATCGCGGAAGCTGGCTATCCGGCTCATGAAGAGCGGAGTCGGCGTGGGCAGCATCGTTCCGCTATGCT
TCGAGAAGTCGATGTGGATGCCGGTGGCGGCTCTGGCTGTTATGAGAGCCGGAGGAGCGTCGGTTGCCGTTGATA
CGACGCAGCCCATGGAGCGGATAGGGACCATGACGTCGCAGGTGTTTGCTGCGCTGCCGAGGCCCAAGGTGATTC
TATCGTCGGTTGCCAACGAGGCCATGGTGGGCCAGTTGCAAGCTGACGAGGTCATTGTCATCGGCCGTGACACTC
TCGACTCTCTGGAAGAGGACGACAAGAGCTACGAGTTGCCTGCCGTCGCGCCTACCGACGTGCTGTACGTCGTCT
TCACCTCTGGGAGCACGGGGAAGCCCAAGGGCGTCGTCATCACGCATCAGAACTTTTACACGGCCACTCACACTC
AGCGGACGCTGCTGGGCATCAAGAGTGACTCCCGCGTCTTTGACTTTTCCTCCTACGCCTTTGATGTTGCCTGGT
TGAATTTGCTCAAGGCACTGACGGCTGGAGCTTGTCTGTGCATTCCCTCGGCGGCTGAACGGGAGGATGATCTCG
GCGGCTGTTTGACCAAGTACGGCATCACCGTCGTCGATCTGACGCCTGCTGTTGCGCGCGTCATCGAGCCGCGAG
GTGTCTTGTCGACGCTGGACACGCTGATTCTCGGTGGCGAGGCCGTCTCATCGAGCGATGCTGACTTGGTCGGGG
ACAAGACGCAGGTCATGGTGGCGTACGGACCGGCTGAGTGCACGCCGACGTGCTCCATCATGAATCTCACGCAGA
CCAGGAGTCCGGGCATCGGGCACGGAGTCAGCATGTGTCTCTGGGTTGTTGATCTCGAGAACGCCGACGAGTTGG
CTCCGGTCGGTGCTACGGGCGAGCTCTGGCTTGAAGGCCCGCTCGTTGGACTCGGCTACCTCAACGAGCCGGAGA
AGACGGCTGCCTCATTCTTCCAGGATCCGGCTTGGTTGACGAGGGGGTCAGCGGACGGGAAGAGGCCCGGACGAA
GAGGCCGTGTCTACCGGACTGGAGATTTGGTGCAGCAGCTGGAGGATGGATCGTTCCTGTTTGTCGGCCGCAAGG
ACACGCAGGTGAAGATCCGGGGGCAGCGTGTTGAGCTCGGTGATATTGAGCATCATGTTCAACAGACGCTTGAGG
AGGTTGGCACCCTGGCCAAGGTGAATGTCGCGGCGGAGACGATTCAGCCTCGGGGCGTGGAGTCCAAGATGCTCG
TGGCCTTTGTGGCGGCTGAGGGGACGACTTCTACAACGACGACGATCGAGGAGGAGATCCAGCGGGCATCAGCCG
CGGCCATGGAGAAGCTGGCCAAGGCTCTGCCCGTCTACATGGTCCCAACCCTCTTCATCCCCATCCCCGCCCTCC
CCATGTCCCCCACTGGCAAAATCGACCGCCGCCGCCTCAAAGAGCAGGGCTCGCACCTGACAGCCAAGGAGGTAG
CGACGCTCAGCCGCCGAGGCGACGGGCAGCGAAGGGCGCCGCAGACGGAATCGGAGCGGGTGCTGCGGTCGCTGT
GGGCGGAGGTGCTGGGCGTCGAGGAGGAGAGCGTGGGAGCGGATGATAGTTTCTTTAGGATCGGGGGGGATTCGA
TTGGGGCCATGAGGTTGGTTGGGTTGGCGAGGTTTAGGGGGTTTGGGTTCTCGGTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail