Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7449
Gene name
LocationContig_94:2685..5731
Strand-
Gene length (bp)3046
Transcript length (bp)2808
Coding sequence length (bp)2808
Protein length (aa) 936

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01061 ABC2_membrane ABC-2 type transporter 1.2E-41 492 701
PF06422 PDR_CDR CDR ABC transporter 5.0E-26 713 798
PF00005 ABC_tran ABC transporter 3.6E-09 186 321
PF00005 ABC_tran ABC transporter 4.2E-08 860 926
PF14510 ABC_trans_N ABC-transporter N-terminal 9.4E-16 75 160

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P78595|CDR2_CANAL Multidrug resistance protein CDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR2 PE=3 SV=2 104 929 0.0E+00
sp|O74676|CDR4_CANAX ABC transporter CDR4 OS=Candida albicans GN=CDR4 PE=3 SV=1 105 929 0.0E+00
sp|Q5ANA3|CDR1_CANAL Pleiotropic ABC efflux transporter of multiple drugs CDR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR1 PE=1 SV=1 40 929 0.0E+00
sp|P43071|CDR1_CANAX Multidrug resistance protein CDR1 OS=Candida albicans GN=CDR1 PE=3 SV=1 40 928 0.0E+00
sp|O42690|CDR3_CANAX Opaque-specific ABC transporter CDR3 OS=Candida albicans GN=CDR3 PE=2 SV=1 80 929 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P78595|CDR2_CANAL Multidrug resistance protein CDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR2 PE=3 SV=2 104 929 0.0E+00
sp|O74676|CDR4_CANAX ABC transporter CDR4 OS=Candida albicans GN=CDR4 PE=3 SV=1 105 929 0.0E+00
sp|Q5ANA3|CDR1_CANAL Pleiotropic ABC efflux transporter of multiple drugs CDR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR1 PE=1 SV=1 40 929 0.0E+00
sp|P43071|CDR1_CANAX Multidrug resistance protein CDR1 OS=Candida albicans GN=CDR1 PE=3 SV=1 40 928 0.0E+00
sp|O42690|CDR3_CANAX Opaque-specific ABC transporter CDR3 OS=Candida albicans GN=CDR3 PE=2 SV=1 80 929 0.0E+00
sp|P33302|PDR5_YEAST Pleiotropic ABC efflux transporter of multiple drugs OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR5 PE=1 SV=1 13 928 0.0E+00
sp|O74208|PDH1_CANGA ATP-binding cassette transporter CGR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PDH1 PE=3 SV=3 52 928 0.0E+00
sp|Q04182|PDR15_YEAST ATP-dependent permease PDR15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR15 PE=1 SV=1 97 928 0.0E+00
sp|P32568|SNQ2_YEAST Protein SNQ2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNQ2 PE=1 SV=2 32 928 0.0E+00
sp|P51533|PDR10_YEAST ATP-dependent permease PDR10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR10 PE=3 SV=1 97 928 0.0E+00
sp|P41820|BFR1_SCHPO Brefeldin A resistance protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bfr1 PE=1 SV=1 8 928 0.0E+00
sp|P53756|PDR18_YEAST ABC transporter ATP-binding protein/permease PDR18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR18 PE=3 SV=1 156 928 0.0E+00
sp|Q02785|PDR12_YEAST ATP-dependent permease PDR12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR12 PE=1 SV=1 111 928 0.0E+00
sp|Q8T675|ABCGJ_DICDI ABC transporter G family member 19 OS=Dictyostelium discoideum GN=abcG19 PE=3 SV=1 97 927 2.0E-161
sp|Q55DQ2|ABCGB_DICDI ABC transporter G family member 11 OS=Dictyostelium discoideum GN=abcG11 PE=3 SV=1 108 927 9.0E-154
sp|Q8T673|ABCGL_DICDI ABC transporter G family member 21 OS=Dictyostelium discoideum GN=abcG21 PE=3 SV=1 108 927 1.0E-152
sp|Q55DR1|ABCGE_DICDI ABC transporter G family member 14 OS=Dictyostelium discoideum GN=abcG14 PE=3 SV=1 118 927 9.0E-152
sp|Q54CG0|ABCGA_DICDI ABC transporter G family member 10 OS=Dictyostelium discoideum GN=abcG10 PE=3 SV=1 39 927 3.0E-149
sp|Q8T683|ABCG9_DICDI ABC transporter G family member 9 OS=Dictyostelium discoideum GN=abcG9 PE=3 SV=1 108 927 2.0E-141
sp|Q556W2|ABCGH_DICDI ABC transporter G family member 17 OS=Dictyostelium discoideum GN=abcG17-1 PE=3 SV=1 118 927 2.0E-139
sp|Q55GB1|ABCGF_DICDI ABC transporter G family member 15 OS=Dictyostelium discoideum GN=abcG15 PE=3 SV=1 102 923 2.0E-135
sp|Q08409|AUS1_YEAST ATP-dependent permease AUS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AUS1 PE=3 SV=1 186 930 2.0E-112
sp|P40550|PDR11_YEAST ATP-dependent permease PDR11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR11 PE=1 SV=3 148 930 9.0E-107
sp|Q9C0Y5|PDR1_SCHPO ATP-binding cassette transporter pdr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pdr1 PE=3 SV=1 118 928 8.0E-102
sp|Q9NGP5|ABCG2_DICDI ABC transporter G family member 2 OS=Dictyostelium discoideum GN=abcG2 PE=1 SV=2 122 923 2.0E-75
sp|Q8ST66|ABCGI_DICDI ABC transporter G family member 18 OS=Dictyostelium discoideum GN=abcG18 PE=3 SV=1 224 926 1.0E-73
sp|Q54HM0|ABCGG_DICDI ABC transporter G family member 16 OS=Dictyostelium discoideum GN=abcG16 PE=3 SV=1 186 924 1.0E-70
sp|Q8GZ52|AB30G_ARATH ABC transporter G family member 30 OS=Arabidopsis thaliana GN=ABCG30 PE=2 SV=2 186 927 8.0E-69
sp|Q76CU2|PDR1_TOBAC Pleiotropic drug resistance protein 1 OS=Nicotiana tabacum GN=PDR1 PE=2 SV=1 186 927 7.0E-68
sp|Q8GU85|AB40G_ORYSJ ABC transporter G family member 40 OS=Oryza sativa subsp. japonica GN=ABCG40 PE=3 SV=2 186 927 8.0E-68
sp|Q9LFH0|AB37G_ARATH ABC transporter G family member 37 OS=Arabidopsis thaliana GN=ABCG37 PE=2 SV=1 186 927 1.0E-67
sp|B9GDE5|AB50G_ORYSJ ABC transporter G family member 50 OS=Oryza sativa subsp. japonica GN=ABCG50 PE=2 SV=2 159 927 5.0E-67
sp|Q0JLC5|AB36G_ORYSJ ABC transporter G family member 36 OS=Oryza sativa subsp. japonica GN=ABCG36 PE=2 SV=1 226 927 8.0E-67
sp|A2WSH0|AB36G_ORYSI ABC transporter G family member 36 OS=Oryza sativa subsp. indica GN=ABCG36 PE=2 SV=1 226 927 1.0E-66
sp|Q8GU84|AB48G_ORYSJ ABC transporter G family member 48 OS=Oryza sativa subsp. japonica GN=ABCG48 PE=3 SV=1 186 927 5.0E-66
sp|Q7PC80|AB34G_ORYSJ ABC transporter G family member 34 OS=Oryza sativa subsp. japonica GN=ABCG34 PE=3 SV=1 111 927 8.0E-66
sp|Q9M9E1|AB40G_ARATH ABC transporter G family member 40 OS=Arabidopsis thaliana GN=ABCG40 PE=1 SV=1 186 927 1.0E-65
sp|Q8GU92|AB35G_ORYSJ ABC transporter G family member 35 OS=Oryza sativa subsp. japonica GN=ABCG35 PE=3 SV=1 226 927 2.0E-65
sp|Q949G3|PDR1_NICPL Pleiotropic drug resistance protein 1 OS=Nicotiana plumbaginifolia GN=PDR1 PE=1 SV=1 186 927 8.0E-65
sp|Q7PC83|AB41G_ARATH ABC transporter G family member 41 OS=Arabidopsis thaliana GN=ABCG41 PE=2 SV=1 186 927 9.0E-65
sp|Q9ZUT8|AB33G_ARATH ABC transporter G family member 33 OS=Arabidopsis thaliana GN=ABCG33 PE=2 SV=1 186 927 1.0E-64
sp|Q2QV81|AB49G_ORYSJ ABC transporter G family member 49 OS=Oryza sativa subsp. japonica GN=ABCG49 PE=2 SV=3 186 927 2.0E-64
sp|Q7PC88|AB31G_ARATH ABC transporter G family member 31 OS=Arabidopsis thaliana GN=ABCG31 PE=1 SV=1 186 927 5.0E-64
sp|O24367|TUR2_SPIPO Pleiotropic drug resistance protein TUR2 OS=Spirodela polyrhiza GN=TUR2 PE=1 SV=1 186 927 1.0E-63
sp|Q8GU86|AB43G_ORYSJ ABC transporter G family member 43 OS=Oryza sativa subsp. japonica GN=ABCG43 PE=2 SV=2 186 927 6.0E-63
sp|Q8GU89|AB37G_ORYSJ ABC transporter G family member 37 OS=Oryza sativa subsp. japonica GN=ABCG37 PE=2 SV=1 111 927 8.0E-63
sp|Q8GU83|AB41G_ORYSJ ABC transporter G family member 41 OS=Oryza sativa subsp. japonica GN=ABCG41 PE=3 SV=1 186 927 2.0E-62
sp|Q8GU88|AB39G_ORYSJ ABC transporter G family member 39 OS=Oryza sativa subsp. japonica GN=ABCG39 PE=3 SV=1 186 927 1.0E-61
sp|Q7PC82|AB42G_ARATH ABC transporter G family member 42 OS=Arabidopsis thaliana GN=ABCG42 PE=2 SV=1 186 927 4.0E-61
sp|Q7PC85|AB38G_ARATH ABC transporter G family member 38 OS=Arabidopsis thaliana GN=ABCG38 PE=2 SV=1 186 927 2.0E-60
sp|Q54TV1|ABCG6_DICDI ABC transporter G family member 6 OS=Dictyostelium discoideum GN=abcG6 PE=3 SV=1 186 777 2.0E-60
sp|Q8S628|AB51G_ORYSJ ABC transporter G family member 51 OS=Oryza sativa subsp. japonica GN=ABCG51 PE=3 SV=1 199 927 4.0E-60
sp|Q7FMW4|AB38G_ORYSJ ABC transporter G family member 38 OS=Oryza sativa subsp. japonica GN=ABCG38 PE=3 SV=1 186 927 5.0E-60
sp|A3BXL8|AB53G_ORYSJ ABC transporter G family member 53 OS=Oryza sativa subsp. japonica GN=ABCG53 PE=2 SV=1 186 927 8.0E-60
sp|Q7PC81|AB43G_ARATH ABC transporter G family member 43 OS=Arabidopsis thaliana GN=ABCG43 PE=3 SV=1 186 927 3.0E-59
sp|Q7PC87|AB34G_ARATH ABC transporter G family member 34 OS=Arabidopsis thaliana GN=ABCG34 PE=2 SV=1 113 927 7.0E-59
sp|B9G300|AB52G_ORYSJ ABC transporter G family member 52 OS=Oryza sativa subsp. japonica GN=ABCG52 PE=2 SV=2 226 927 1.0E-58
sp|Q6EQ60|AB47G_ORYSJ ABC transporter G family member 47 OS=Oryza sativa subsp. japonica GN=ABCG47 PE=3 SV=2 113 927 2.0E-58
sp|Q8GU82|AB45G_ORYSJ ABC transporter G family member 45 OS=Oryza sativa subsp. japonica GN=ABCG45 PE=2 SV=2 186 927 2.0E-58
sp|Q6YW62|AB44G_ORYSJ ABC transporter G family member 44 OS=Oryza sativa subsp. japonica GN=ABCG44 PE=2 SV=2 226 927 4.0E-58
sp|Q9XIE2|AB36G_ARATH ABC transporter G family member 36 OS=Arabidopsis thaliana GN=ABCG36 PE=1 SV=1 186 927 1.0E-57
sp|Q94A18|AB29G_ARATH ABC transporter G family member 29 OS=Arabidopsis thaliana GN=ABCG29 PE=2 SV=2 186 927 5.0E-57
sp|Q80W57|ABCG2_RAT ATP-binding cassette sub-family G member 2 OS=Rattus norvegicus GN=Abcg2 PE=1 SV=1 219 771 6.0E-57
sp|Q54TV2|ABCG5_DICDI ABC transporter G family member 5 OS=Dictyostelium discoideum GN=abcG5 PE=3 SV=1 186 777 9.0E-57
sp|Q8LQX2|AB32G_ORYSJ ABC transporter G family member 32 OS=Oryza sativa subsp. japonica GN=ABCG32 PE=2 SV=1 111 927 1.0E-56
sp|Q7PC84|AB39G_ARATH ABC transporter G family member 39 OS=Arabidopsis thaliana GN=ABCG39 PE=3 SV=1 81 927 1.0E-56
sp|Q5W274|PDR3_TOBAC Pleiotropic drug resistance protein 3 OS=Nicotiana tabacum GN=PDR3 PE=2 SV=1 186 927 3.0E-56
sp|Q8MIB3|ABCG2_PIG ATP-binding cassette sub-family G member 2 OS=Sus scrofa GN=ABCG2 PE=2 SV=1 219 771 4.0E-56
sp|Q5Z9S8|AB42G_ORYSJ ABC transporter G family member 42 OS=Oryza sativa subsp. japonica GN=ABCG42 PE=2 SV=1 186 927 7.0E-56
sp|Q7PC86|AB35G_ARATH ABC transporter G family member 35 OS=Arabidopsis thaliana GN=ABCG35 PE=2 SV=1 186 927 3.0E-55
sp|Q4GZT4|ABCG2_BOVIN ATP-binding cassette sub-family G member 2 OS=Bos taurus GN=ABCG2 PE=3 SV=2 219 771 6.0E-55
sp|Q7TMS5|ABCG2_MOUSE ATP-binding cassette sub-family G member 2 OS=Mus musculus GN=Abcg2 PE=1 SV=1 201 771 4.0E-54
sp|Q5MB13|ABCG2_MACMU ATP-binding cassette sub-family G member 2 OS=Macaca mulatta GN=ABCG2 PE=2 SV=1 219 771 5.0E-54
sp|Q8GU87|AB31G_ORYSJ ABC transporter G family member 31 OS=Oryza sativa subsp. japonica GN=ABCG31 PE=2 SV=3 226 927 8.0E-54
sp|Q2PCF1|PDR2_NICPL Pleiotropic drug resistance protein 2 OS=Nicotiana plumbaginifolia GN=PDR2 PE=2 SV=1 226 927 1.0E-52
sp|O81016|AB32G_ARATH ABC transporter G family member 32 OS=Arabidopsis thaliana GN=ABCG32 PE=1 SV=1 226 927 3.0E-52
sp|Q9UNQ0|ABCG2_HUMAN ATP-binding cassette sub-family G member 2 OS=Homo sapiens GN=ABCG2 PE=1 SV=3 128 771 3.0E-52
sp|C7J6G6|AB46G_ORYSJ ABC transporter G family member 46 OS=Oryza sativa subsp. japonica GN=ABCG46 PE=3 SV=2 186 927 4.0E-47
sp|Q93YS4|AB22G_ARATH ABC transporter G family member 22 OS=Arabidopsis thaliana GN=ABCG22 PE=1 SV=1 186 702 8.0E-41
sp|Q9FT51|AB27G_ARATH ABC transporter G family member 27 OS=Arabidopsis thaliana GN=ABCG27 PE=2 SV=1 186 702 2.0E-39
sp|Q8T690|ABCG3_DICDI ABC transporter G family member 3 OS=Dictyostelium discoideum GN=abcG3 PE=3 SV=1 189 711 3.0E-38
sp|Q9C6W5|AB14G_ARATH ABC transporter G family member 14 OS=Arabidopsis thaliana GN=ABCG14 PE=2 SV=1 176 709 2.0E-37
sp|Q7XA72|AB21G_ARATH ABC transporter G family member 21 OS=Arabidopsis thaliana GN=ABCG21 PE=2 SV=2 186 710 8.0E-36
sp|Q9SZR9|AB9G_ARATH ABC transporter G family member 9 OS=Arabidopsis thaliana GN=ABCG9 PE=3 SV=2 186 708 2.0E-35
sp|P58428|ABCG8_RAT ATP-binding cassette sub-family G member 8 OS=Rattus norvegicus GN=Abcg8 PE=2 SV=2 185 727 2.0E-35
sp|Q9DBM0|ABCG8_MOUSE ATP-binding cassette sub-family G member 8 OS=Mus musculus GN=Abcg8 PE=2 SV=1 185 706 3.0E-34
sp|Q9H221|ABCG8_HUMAN ATP-binding cassette sub-family G member 8 OS=Homo sapiens GN=ABCG8 PE=1 SV=1 185 738 4.0E-34
sp|Q8T685|ABCGC_DICDI ABC transporter G family member 12 OS=Dictyostelium discoideum GN=abcG12 PE=3 SV=1 238 724 4.0E-34
sp|Q9ZU35|AB7G_ARATH ABC transporter G family member 7 OS=Arabidopsis thaliana GN=ABCG7 PE=2 SV=1 186 706 1.0E-33
sp|Q08234|YO075_YEAST Uncharacterized ABC transporter ATP-binding protein/permease YOL075C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL075C PE=1 SV=3 237 928 8.0E-32
sp|Q8T690|ABCG3_DICDI ABC transporter G family member 3 OS=Dictyostelium discoideum GN=abcG3 PE=3 SV=1 226 771 1.0E-31
sp|Q55DA0|ABCGM_DICDI ABC transporter G family member 22 OS=Dictyostelium discoideum GN=abcG22 PE=2 SV=1 176 711 1.0E-31
sp|Q84TH5|AB25G_ARATH ABC transporter G family member 25 OS=Arabidopsis thaliana GN=ABCG25 PE=2 SV=1 186 701 6.0E-30
sp|Q17320|WHITE_CERCA Protein white OS=Ceratitis capitata GN=W PE=2 SV=1 196 701 9.0E-30
sp|P10090|WHITE_DROME Protein white OS=Drosophila melanogaster GN=w PE=2 SV=2 186 701 2.0E-29
sp|Q86HQ2|ABCG8_DICDI ABC transporter G family member 8 OS=Dictyostelium discoideum GN=abcG8 PE=3 SV=1 226 709 2.0E-29
sp|Q8RWI9|AB15G_ARATH ABC transporter G family member 15 OS=Arabidopsis thaliana GN=ABCG15 PE=2 SV=2 222 805 2.0E-29
sp|Q9NGP5|ABCG2_DICDI ABC transporter G family member 2 OS=Dictyostelium discoideum GN=abcG2 PE=1 SV=2 221 730 1.0E-28
sp|Q8T686|ABCG7_DICDI ABC transporter G family member 7 OS=Dictyostelium discoideum GN=abcG7 PE=3 SV=1 238 721 3.0E-28
sp|Q05360|WHITE_LUCCU Protein white OS=Lucilia cuprina GN=W PE=2 SV=2 186 747 4.0E-28
sp|Q8T689|ABCG4_DICDI ABC transporter G family member 4 OS=Dictyostelium discoideum GN=abcG4 PE=3 SV=1 238 708 7.0E-28
sp|Q99PE8|ABCG5_MOUSE ATP-binding cassette sub-family G member 5 OS=Mus musculus GN=Abcg5 PE=1 SV=1 186 778 2.0E-27
sp|P41820|BFR1_SCHPO Brefeldin A resistance protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bfr1 PE=1 SV=1 226 776 5.0E-27
sp|Q54TV1|ABCG6_DICDI ABC transporter G family member 6 OS=Dictyostelium discoideum GN=abcG6 PE=3 SV=1 219 710 5.0E-27
sp|Q54TV2|ABCG5_DICDI ABC transporter G family member 5 OS=Dictyostelium discoideum GN=abcG5 PE=3 SV=1 219 710 6.0E-27
sp|Q9ZUT0|AB2G_ARATH ABC transporter G family member 2 OS=Arabidopsis thaliana GN=ABCG2 PE=2 SV=1 180 782 6.0E-27
sp|Q55GB1|ABCGF_DICDI ABC transporter G family member 15 OS=Dictyostelium discoideum GN=abcG15 PE=3 SV=1 189 774 1.0E-26
sp|Q9C8K2|AB12G_ARATH ABC transporter G family member 12 OS=Arabidopsis thaliana GN=ABCG12 PE=1 SV=1 222 806 2.0E-26
sp|P45844|ABCG1_HUMAN ATP-binding cassette sub-family G member 1 OS=Homo sapiens GN=ABCG1 PE=1 SV=3 201 694 2.0E-26
sp|Q9C8J8|AB13G_ARATH ABC transporter G family member 13 OS=Arabidopsis thaliana GN=ABCG13 PE=2 SV=1 178 706 3.0E-26
sp|Q8RXN0|AB11G_ARATH ABC transporter G family member 11 OS=Arabidopsis thaliana GN=ABCG11 PE=1 SV=1 222 703 4.0E-26
sp|Q11180|WHT1_CAEEL ABC transporter ATP-binding protein/permease wht-1 OS=Caenorhabditis elegans GN=wht-1 PE=2 SV=2 226 701 6.0E-26
sp|Q99PE7|ABCG5_RAT ATP-binding cassette sub-family G member 5 OS=Rattus norvegicus GN=Abcg5 PE=2 SV=3 186 778 7.0E-26
sp|Q64343|ABCG1_MOUSE ATP-binding cassette sub-family G member 1 OS=Mus musculus GN=Abcg1 PE=1 SV=1 201 694 9.0E-26
sp|Q27256|WHITE_ANOGA Protein white OS=Anopheles gambiae GN=w PE=2 SV=1 186 701 1.0E-25
sp|Q99P81|ABCG3_MOUSE ATP-binding cassette sub-family G member 3 OS=Mus musculus GN=Abcg3 PE=1 SV=2 226 771 2.0E-25
sp|P25371|ADP1_YEAST Probable ATP-dependent permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADP1 PE=1 SV=2 204 700 2.0E-25
sp|Q9LK50|AB26G_ARATH ABC transporter G family member 26 OS=Arabidopsis thaliana GN=ABCG26 PE=3 SV=2 180 710 8.0E-25
sp|Q04182|PDR15_YEAST ATP-dependent permease PDR15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR15 PE=1 SV=1 215 768 2.0E-24
sp|Q9M2V6|AB17G_ARATH ABC transporter G family member 17 OS=Arabidopsis thaliana GN=ABCG17 PE=2 SV=1 186 701 2.0E-24
sp|Q94A18|AB29G_ARATH ABC transporter G family member 29 OS=Arabidopsis thaliana GN=ABCG29 PE=2 SV=2 186 701 3.0E-24
sp|Q08234|YO075_YEAST Uncharacterized ABC transporter ATP-binding protein/permease YOL075C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL075C PE=1 SV=3 186 704 5.0E-24
sp|B8ALI0|AB5G_ORYSI ABC transporter G family member 5 OS=Oryza sativa subsp. indica GN=OsI_11044 PE=3 SV=1 226 701 5.0E-24
sp|Q8H8V7|AB5G_ORYSJ ABC transporter G family member 5 OS=Oryza sativa subsp. japonica GN=RCN1 PE=1 SV=1 226 701 5.0E-24
sp|Q556W2|ABCGH_DICDI ABC transporter G family member 17 OS=Dictyostelium discoideum GN=abcG17-1 PE=3 SV=1 226 776 1.0E-23
sp|Q9H222|ABCG5_HUMAN ATP-binding cassette sub-family G member 5 OS=Homo sapiens GN=ABCG5 PE=1 SV=1 186 778 1.0E-23
sp|Q9FLX5|AB8G_ARATH ABC transporter G family member 8 OS=Arabidopsis thaliana GN=ABCG8 PE=2 SV=1 204 771 2.0E-23
sp|Q9H172|ABCG4_HUMAN ATP-binding cassette sub-family G member 4 OS=Homo sapiens GN=ABCG4 PE=1 SV=2 201 694 3.0E-23
sp|Q16928|WHITE_ANOAL Protein white OS=Anopheles albimanus GN=W PE=3 SV=1 197 782 4.0E-23
sp|Q9M3D6|AB19G_ARATH ABC transporter G family member 19 OS=Arabidopsis thaliana GN=ABCG19 PE=1 SV=1 186 701 5.0E-23
sp|Q02785|PDR12_YEAST ATP-dependent permease PDR12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR12 PE=1 SV=1 226 772 1.0E-22
sp|Q76CU2|PDR1_TOBAC Pleiotropic drug resistance protein 1 OS=Nicotiana tabacum GN=PDR1 PE=2 SV=1 186 701 1.0E-22
sp|Q0JLC5|AB36G_ORYSJ ABC transporter G family member 36 OS=Oryza sativa subsp. japonica GN=ABCG36 PE=2 SV=1 186 713 1.0E-22
sp|A2WSH0|AB36G_ORYSI ABC transporter G family member 36 OS=Oryza sativa subsp. indica GN=ABCG36 PE=2 SV=1 186 713 1.0E-22
sp|Q08409|AUS1_YEAST ATP-dependent permease AUS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AUS1 PE=3 SV=1 186 765 2.0E-22
sp|Q8LQX2|AB32G_ORYSJ ABC transporter G family member 32 OS=Oryza sativa subsp. japonica GN=ABCG32 PE=2 SV=1 186 701 3.0E-22
sp|P32568|SNQ2_YEAST Protein SNQ2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNQ2 PE=1 SV=2 186 780 1.0E-21
sp|Q9SIT6|AB5G_ARATH ABC transporter G family member 5 OS=Arabidopsis thaliana GN=ABCG5 PE=2 SV=1 202 768 1.0E-21
sp|O80946|AB1G_ARATH ABC transporter G family member 1 OS=Arabidopsis thaliana GN=ABCG1 PE=2 SV=1 226 701 2.0E-21
sp|P53756|PDR18_YEAST ABC transporter ATP-binding protein/permease PDR18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR18 PE=3 SV=1 210 761 3.0E-21
sp|Q55DR1|ABCGE_DICDI ABC transporter G family member 14 OS=Dictyostelium discoideum GN=abcG14 PE=3 SV=1 203 773 3.0E-21
sp|Q55DW4|ABCG1_DICDI ABC transporter G family member 1 OS=Dictyostelium discoideum GN=abcG1 PE=3 SV=1 186 408 3.0E-21
sp|P45843|SCRT_DROME Protein scarlet OS=Drosophila melanogaster GN=st PE=1 SV=3 226 703 3.0E-21
sp|Q8GU89|AB37G_ORYSJ ABC transporter G family member 37 OS=Oryza sativa subsp. japonica GN=ABCG37 PE=2 SV=1 186 701 4.0E-21
sp|Q8T683|ABCG9_DICDI ABC transporter G family member 9 OS=Dictyostelium discoideum GN=abcG9 PE=3 SV=1 226 776 1.0E-20
sp|Q6YW62|AB44G_ORYSJ ABC transporter G family member 44 OS=Oryza sativa subsp. japonica GN=ABCG44 PE=2 SV=2 186 707 1.0E-20
sp|Q3E9B8|AB23G_ARATH ABC transporter G family member 23 OS=Arabidopsis thaliana GN=ABCG23 PE=2 SV=1 186 785 1.0E-20
sp|Q9M2V5|AB18G_ARATH ABC transporter G family member 18 OS=Arabidopsis thaliana GN=ABCG18 PE=2 SV=1 186 701 1.0E-20
sp|Q8T675|ABCGJ_DICDI ABC transporter G family member 19 OS=Dictyostelium discoideum GN=abcG19 PE=3 SV=1 189 774 2.0E-20
sp|Q9M9E1|AB40G_ARATH ABC transporter G family member 40 OS=Arabidopsis thaliana GN=ABCG40 PE=1 SV=1 186 701 3.0E-20
sp|Q9SW08|AB4G_ARATH ABC transporter G family member 4 OS=Arabidopsis thaliana GN=ABCG4 PE=3 SV=1 226 730 3.0E-20
sp|Q9LFG8|AB20G_ARATH ABC transporter G family member 20 OS=Arabidopsis thaliana GN=ABCG20 PE=2 SV=1 182 782 4.0E-20
sp|O74208|PDH1_CANGA ATP-binding cassette transporter CGR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PDH1 PE=3 SV=3 204 766 7.0E-20
sp|Q7PC80|AB34G_ORYSJ ABC transporter G family member 34 OS=Oryza sativa subsp. japonica GN=ABCG34 PE=3 SV=1 186 773 1.0E-19
sp|Q9M2V7|AB16G_ARATH ABC transporter G family member 16 OS=Arabidopsis thaliana GN=ABCG16 PE=2 SV=2 226 701 1.0E-19
sp|Q6EQ60|AB47G_ORYSJ ABC transporter G family member 47 OS=Oryza sativa subsp. japonica GN=ABCG47 PE=3 SV=2 203 701 2.0E-19
sp|Q8GU87|AB31G_ORYSJ ABC transporter G family member 31 OS=Oryza sativa subsp. japonica GN=ABCG31 PE=2 SV=3 186 701 2.0E-19
sp|Q8T673|ABCGL_DICDI ABC transporter G family member 21 OS=Dictyostelium discoideum GN=abcG21 PE=3 SV=1 189 766 3.0E-19
sp|Q8GU82|AB45G_ORYSJ ABC transporter G family member 45 OS=Oryza sativa subsp. japonica GN=ABCG45 PE=2 SV=2 186 688 3.0E-19
sp|Q9XIE2|AB36G_ARATH ABC transporter G family member 36 OS=Arabidopsis thaliana GN=ABCG36 PE=1 SV=1 43 701 5.0E-19
sp|Q9FNB5|AB6G_ARATH ABC transporter G family member 6 OS=Arabidopsis thaliana GN=ABCG6 PE=2 SV=1 226 701 6.0E-19
sp|A3BXL8|AB53G_ORYSJ ABC transporter G family member 53 OS=Oryza sativa subsp. japonica GN=ABCG53 PE=2 SV=1 167 701 8.0E-19
sp|O74676|CDR4_CANAX ABC transporter CDR4 OS=Candida albicans GN=CDR4 PE=3 SV=1 186 720 1.0E-18
sp|Q9LFH0|AB37G_ARATH ABC transporter G family member 37 OS=Arabidopsis thaliana GN=ABCG37 PE=2 SV=1 203 701 1.0E-18
sp|B9GDE5|AB50G_ORYSJ ABC transporter G family member 50 OS=Oryza sativa subsp. japonica GN=ABCG50 PE=2 SV=2 186 701 1.0E-18
sp|Q8GZ52|AB30G_ARATH ABC transporter G family member 30 OS=Arabidopsis thaliana GN=ABCG30 PE=2 SV=2 186 701 2.0E-18
sp|Q8GU92|AB35G_ORYSJ ABC transporter G family member 35 OS=Oryza sativa subsp. japonica GN=ABCG35 PE=3 SV=1 186 773 2.0E-18
sp|Q9ZUT8|AB33G_ARATH ABC transporter G family member 33 OS=Arabidopsis thaliana GN=ABCG33 PE=2 SV=1 226 701 2.0E-18
sp|Q7PC85|AB38G_ARATH ABC transporter G family member 38 OS=Arabidopsis thaliana GN=ABCG38 PE=2 SV=1 186 778 2.0E-18
sp|P33302|PDR5_YEAST Pleiotropic ABC efflux transporter of multiple drugs OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR5 PE=1 SV=1 209 768 3.0E-18
sp|Q54CG0|ABCGA_DICDI ABC transporter G family member 10 OS=Dictyostelium discoideum GN=abcG10 PE=3 SV=1 226 771 4.0E-18
sp|Q7FMW4|AB38G_ORYSJ ABC transporter G family member 38 OS=Oryza sativa subsp. japonica GN=ABCG38 PE=3 SV=1 186 701 4.0E-18
sp|D4AYW0|ABCG1_ARTBC ABC transporter G family member ARB_01379 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01379 PE=1 SV=1 219 407 4.0E-18
sp|Q55DQ2|ABCGB_DICDI ABC transporter G family member 11 OS=Dictyostelium discoideum GN=abcG11 PE=3 SV=1 203 773 2.0E-17
sp|Q8GU83|AB41G_ORYSJ ABC transporter G family member 41 OS=Oryza sativa subsp. japonica GN=ABCG41 PE=3 SV=1 186 701 3.0E-17
sp|Q9MAH4|AB10G_ARATH ABC transporter G family member 10 OS=Arabidopsis thaliana GN=ABCG10 PE=3 SV=1 186 703 3.0E-17
sp|P78595|CDR2_CANAL Multidrug resistance protein CDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR2 PE=3 SV=2 216 774 5.0E-17
sp|B9G300|AB52G_ORYSJ ABC transporter G family member 52 OS=Oryza sativa subsp. japonica GN=ABCG52 PE=2 SV=2 203 701 5.0E-17
sp|Q9ZUU9|AB3G_ARATH ABC transporter G family member 3 OS=Arabidopsis thaliana GN=ABCG3 PE=1 SV=2 237 730 6.0E-17
sp|Q7PC81|AB43G_ARATH ABC transporter G family member 43 OS=Arabidopsis thaliana GN=ABCG43 PE=3 SV=1 226 701 7.0E-17
sp|Q7PC88|AB31G_ARATH ABC transporter G family member 31 OS=Arabidopsis thaliana GN=ABCG31 PE=1 SV=1 191 701 8.0E-17
sp|O81016|AB32G_ARATH ABC transporter G family member 32 OS=Arabidopsis thaliana GN=ABCG32 PE=1 SV=1 186 701 8.0E-17
sp|Q7PC84|AB39G_ARATH ABC transporter G family member 39 OS=Arabidopsis thaliana GN=ABCG39 PE=3 SV=1 186 700 1.0E-16
sp|P40550|PDR11_YEAST ATP-dependent permease PDR11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR11 PE=1 SV=3 186 765 2.0E-16
sp|Q8GU86|AB43G_ORYSJ ABC transporter G family member 43 OS=Oryza sativa subsp. japonica GN=ABCG43 PE=2 SV=2 203 701 2.0E-16
sp|Q949G3|PDR1_NICPL Pleiotropic drug resistance protein 1 OS=Nicotiana plumbaginifolia GN=PDR1 PE=1 SV=1 186 709 3.0E-16
sp|Q5Z9S8|AB42G_ORYSJ ABC transporter G family member 42 OS=Oryza sativa subsp. japonica GN=ABCG42 PE=2 SV=1 186 701 3.0E-16
sp|Q7PC83|AB41G_ARATH ABC transporter G family member 41 OS=Arabidopsis thaliana GN=ABCG41 PE=2 SV=1 186 701 6.0E-16
sp|Q8S628|AB51G_ORYSJ ABC transporter G family member 51 OS=Oryza sativa subsp. japonica GN=ABCG51 PE=3 SV=1 226 701 8.0E-16
sp|P51533|PDR10_YEAST ATP-dependent permease PDR10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR10 PE=3 SV=1 197 766 2.0E-15
sp|Q8GU88|AB39G_ORYSJ ABC transporter G family member 39 OS=Oryza sativa subsp. japonica GN=ABCG39 PE=3 SV=1 186 701 2.0E-15
sp|O24367|TUR2_SPIPO Pleiotropic drug resistance protein TUR2 OS=Spirodela polyrhiza GN=TUR2 PE=1 SV=1 186 701 3.0E-15
sp|Q09466|WHT3_CAEEL ABC transporter ATP-binding protein/permease wht-3 OS=Caenorhabditis elegans GN=wht-3 PE=3 SV=1 256 701 4.0E-15
sp|Q54T02|ABCGO_DICDI ABC transporter G family member 24 OS=Dictyostelium discoideum GN=abcG24 PE=3 SV=1 855 928 4.0E-15
sp|Q7PC82|AB42G_ARATH ABC transporter G family member 42 OS=Arabidopsis thaliana GN=ABCG42 PE=2 SV=1 226 701 6.0E-15
sp|Q7PC87|AB34G_ARATH ABC transporter G family member 34 OS=Arabidopsis thaliana GN=ABCG34 PE=2 SV=1 186 689 8.0E-15
sp|Q8GU85|AB40G_ORYSJ ABC transporter G family member 40 OS=Oryza sativa subsp. japonica GN=ABCG40 PE=3 SV=2 226 704 2.0E-14
sp|Q54TV1|ABCG6_DICDI ABC transporter G family member 6 OS=Dictyostelium discoideum GN=abcG6 PE=3 SV=1 853 923 2.0E-14
sp|Q54TV2|ABCG5_DICDI ABC transporter G family member 5 OS=Dictyostelium discoideum GN=abcG5 PE=3 SV=1 853 923 2.0E-14
sp|Q5W274|PDR3_TOBAC Pleiotropic drug resistance protein 3 OS=Nicotiana tabacum GN=PDR3 PE=2 SV=1 203 701 2.0E-14
sp|Q7PC86|AB35G_ARATH ABC transporter G family member 35 OS=Arabidopsis thaliana GN=ABCG35 PE=2 SV=1 186 711 4.0E-14
sp|Q8GU84|AB48G_ORYSJ ABC transporter G family member 48 OS=Oryza sativa subsp. japonica GN=ABCG48 PE=3 SV=1 203 724 9.0E-14
sp|Q55DA0|ABCGM_DICDI ABC transporter G family member 22 OS=Dictyostelium discoideum GN=abcG22 PE=2 SV=1 842 928 3.0E-13
sp|O42690|CDR3_CANAX Opaque-specific ABC transporter CDR3 OS=Candida albicans GN=CDR3 PE=2 SV=1 216 618 4.0E-13
sp|Q54T02|ABCGO_DICDI ABC transporter G family member 24 OS=Dictyostelium discoideum GN=abcG24 PE=3 SV=1 203 389 1.0E-12
sp|P45843|SCRT_DROME Protein scarlet OS=Drosophila melanogaster GN=st PE=1 SV=3 808 928 3.0E-12
sp|Q9SJK6|WBC30_ARATH Putative white-brown complex homolog protein 30 OS=Arabidopsis thaliana GN=WBC30 PE=1 SV=3 235 401 3.0E-12
sp|Q8T685|ABCGC_DICDI ABC transporter G family member 12 OS=Dictyostelium discoideum GN=abcG12 PE=3 SV=1 855 929 4.0E-12
sp|Q9MAG3|AB24G_ARATH ABC transporter G family member 24 OS=Arabidopsis thaliana GN=ABCG24 PE=2 SV=2 186 406 7.0E-12
sp|Q8T690|ABCG3_DICDI ABC transporter G family member 3 OS=Dictyostelium discoideum GN=abcG3 PE=3 SV=1 858 926 9.0E-12
sp|Q86HQ2|ABCG8_DICDI ABC transporter G family member 8 OS=Dictyostelium discoideum GN=abcG8 PE=3 SV=1 859 929 1.0E-11
sp|D4AYW0|ABCG1_ARTBC ABC transporter G family member ARB_01379 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01379 PE=1 SV=1 855 928 1.0E-11
sp|Q8T689|ABCG4_DICDI ABC transporter G family member 4 OS=Dictyostelium discoideum GN=abcG4 PE=3 SV=1 828 929 2.0E-11
sp|Q8ST66|ABCGI_DICDI ABC transporter G family member 18 OS=Dictyostelium discoideum GN=abcG18 PE=3 SV=1 521 728 3.0E-11
sp|C7J6G6|AB46G_ORYSJ ABC transporter G family member 46 OS=Oryza sativa subsp. japonica GN=ABCG46 PE=3 SV=2 189 701 3.0E-11
sp|P43071|CDR1_CANAX Multidrug resistance protein CDR1 OS=Candida albicans GN=CDR1 PE=3 SV=1 220 759 5.0E-11
sp|Q54HM0|ABCGG_DICDI ABC transporter G family member 16 OS=Dictyostelium discoideum GN=abcG16 PE=3 SV=1 512 736 5.0E-11
sp|Q5ANA3|CDR1_CANAL Pleiotropic ABC efflux transporter of multiple drugs CDR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR1 PE=1 SV=1 220 759 1.0E-10
sp|Q80W57|ABCG2_RAT ATP-binding cassette sub-family G member 2 OS=Rattus norvegicus GN=Abcg2 PE=1 SV=1 837 923 1.0E-10
sp|Q7TMS5|ABCG2_MOUSE ATP-binding cassette sub-family G member 2 OS=Mus musculus GN=Abcg2 PE=1 SV=1 826 923 1.0E-10
sp|P25371|ADP1_YEAST Probable ATP-dependent permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADP1 PE=1 SV=2 824 928 2.0E-10
sp|Q9UNQ0|ABCG2_HUMAN ATP-binding cassette sub-family G member 2 OS=Homo sapiens GN=ABCG2 PE=1 SV=3 840 923 2.0E-09
sp|Q54T02|ABCGO_DICDI ABC transporter G family member 24 OS=Dictyostelium discoideum GN=abcG24 PE=3 SV=1 519 719 2.0E-09
sp|Q2QV81|AB49G_ORYSJ ABC transporter G family member 49 OS=Oryza sativa subsp. japonica GN=ABCG49 PE=2 SV=3 186 381 3.0E-09
sp|Q55DW4|ABCG1_DICDI ABC transporter G family member 1 OS=Dictyostelium discoideum GN=abcG1 PE=3 SV=1 456 787 3.0E-09
sp|Q8ST66|ABCGI_DICDI ABC transporter G family member 18 OS=Dictyostelium discoideum GN=abcG18 PE=3 SV=1 221 407 4.0E-09
sp|Q8MIB3|ABCG2_PIG ATP-binding cassette sub-family G member 2 OS=Sus scrofa GN=ABCG2 PE=2 SV=1 857 923 4.0E-09
sp|Q2PCF1|PDR2_NICPL Pleiotropic drug resistance protein 2 OS=Nicotiana plumbaginifolia GN=PDR2 PE=2 SV=1 186 378 6.0E-09
sp|Q4GZT4|ABCG2_BOVIN ATP-binding cassette sub-family G member 2 OS=Bos taurus GN=ABCG2 PE=3 SV=2 857 923 8.0E-09
sp|Q8SQU5|YBD4_ENCCU ABC transporter-like protein ECU11_1340 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU11_1340 PE=1 SV=1 214 415 9.0E-09
sp|Q7XA72|AB21G_ARATH ABC transporter G family member 21 OS=Arabidopsis thaliana GN=ABCG21 PE=2 SV=2 857 930 1.0E-08
sp|P10090|WHITE_DROME Protein white OS=Drosophila melanogaster GN=w PE=2 SV=2 857 928 1.0E-08
sp|Q8T686|ABCG7_DICDI ABC transporter G family member 7 OS=Dictyostelium discoideum GN=abcG7 PE=3 SV=1 859 929 1.0E-08
sp|D4AYW0|ABCG1_ARTBC ABC transporter G family member ARB_01379 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01379 PE=1 SV=1 487 745 1.0E-08
sp|Q9FF46|AB28G_ARATH ABC transporter G family member 28 OS=Arabidopsis thaliana GN=ABCG28 PE=3 SV=1 137 410 1.0E-08
sp|Q09466|WHT3_CAEEL ABC transporter ATP-binding protein/permease wht-3 OS=Caenorhabditis elegans GN=wht-3 PE=3 SV=1 842 928 2.0E-08
sp|Q5MB13|ABCG2_MACMU ATP-binding cassette sub-family G member 2 OS=Macaca mulatta GN=ABCG2 PE=2 SV=1 840 923 3.0E-08
sp|Q54HM0|ABCGG_DICDI ABC transporter G family member 16 OS=Dictyostelium discoideum GN=abcG16 PE=3 SV=1 218 460 4.0E-08
sp|Q93YS4|AB22G_ARATH ABC transporter G family member 22 OS=Arabidopsis thaliana GN=ABCG22 PE=1 SV=1 806 923 5.0E-08
sp|Q9C8K2|AB12G_ARATH ABC transporter G family member 12 OS=Arabidopsis thaliana GN=ABCG12 PE=1 SV=1 854 908 5.0E-08
sp|Q8RWI9|AB15G_ARATH ABC transporter G family member 15 OS=Arabidopsis thaliana GN=ABCG15 PE=2 SV=2 854 928 6.0E-08
sp|Q9C6W5|AB14G_ARATH ABC transporter G family member 14 OS=Arabidopsis thaliana GN=ABCG14 PE=2 SV=1 843 930 7.0E-08
sp|Q9ZU35|AB7G_ARATH ABC transporter G family member 7 OS=Arabidopsis thaliana GN=ABCG7 PE=2 SV=1 817 926 9.0E-08
sp|Q9SZR9|AB9G_ARATH ABC transporter G family member 9 OS=Arabidopsis thaliana GN=ABCG9 PE=3 SV=2 814 923 1.0E-07
sp|Q9FF46|AB28G_ARATH ABC transporter G family member 28 OS=Arabidopsis thaliana GN=ABCG28 PE=3 SV=1 850 926 1.0E-07
sp|Q9MAH4|AB10G_ARATH ABC transporter G family member 10 OS=Arabidopsis thaliana GN=ABCG10 PE=3 SV=1 859 924 2.0E-07
sp|Q9SJK6|WBC30_ARATH Putative white-brown complex homolog protein 30 OS=Arabidopsis thaliana GN=WBC30 PE=1 SV=3 850 923 2.0E-07
sp|Q9MAG3|AB24G_ARATH ABC transporter G family member 24 OS=Arabidopsis thaliana GN=ABCG24 PE=2 SV=2 850 923 2.0E-07
sp|Q9FT51|AB27G_ARATH ABC transporter G family member 27 OS=Arabidopsis thaliana GN=ABCG27 PE=2 SV=1 818 923 3.0E-07
sp|Q05360|WHITE_LUCCU Protein white OS=Lucilia cuprina GN=W PE=2 SV=2 857 928 3.0E-07
sp|Q55DW4|ABCG1_DICDI ABC transporter G family member 1 OS=Dictyostelium discoideum GN=abcG1 PE=3 SV=1 858 923 3.0E-07
sp|Q99P81|ABCG3_MOUSE ATP-binding cassette sub-family G member 3 OS=Mus musculus GN=Abcg3 PE=1 SV=2 860 928 4.0E-07
sp|Q9M2V7|AB16G_ARATH ABC transporter G family member 16 OS=Arabidopsis thaliana GN=ABCG16 PE=2 SV=2 839 926 6.0E-07
sp|Q9FNB5|AB6G_ARATH ABC transporter G family member 6 OS=Arabidopsis thaliana GN=ABCG6 PE=2 SV=1 841 926 7.0E-07
sp|Q8RXN0|AB11G_ARATH ABC transporter G family member 11 OS=Arabidopsis thaliana GN=ABCG11 PE=1 SV=1 841 923 8.0E-07
sp|Q9C8J8|AB13G_ARATH ABC transporter G family member 13 OS=Arabidopsis thaliana GN=ABCG13 PE=2 SV=1 853 928 1.0E-06
sp|Q8ST66|ABCGI_DICDI ABC transporter G family member 18 OS=Dictyostelium discoideum GN=abcG18 PE=3 SV=1 836 928 2.0E-06
sp|Q17320|WHITE_CERCA Protein white OS=Ceratitis capitata GN=W PE=2 SV=1 842 928 3.0E-06
sp|B8ALI0|AB5G_ORYSI ABC transporter G family member 5 OS=Oryza sativa subsp. indica GN=OsI_11044 PE=3 SV=1 857 926 4.0E-06
sp|Q8H8V7|AB5G_ORYSJ ABC transporter G family member 5 OS=Oryza sativa subsp. japonica GN=RCN1 PE=1 SV=1 857 926 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0005524 ATP binding Yes
GO:0042626 ATPase-coupled transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0016021 integral component of membrane Yes
GO:0140657 ATP-dependent activity No
GO:0032555 purine ribonucleotide binding No
GO:0051179 localization No
GO:0030554 adenyl nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0051234 establishment of localization No
GO:0009987 cellular process No
GO:0097367 carbohydrate derivative binding No
GO:0006810 transport No
GO:0036094 small molecule binding No
GO:0032553 ribonucleotide binding No
GO:0031224 intrinsic component of membrane No
GO:0017076 purine nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0022804 active transmembrane transporter activity No
GO:0043167 ion binding No
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:1901265 nucleoside phosphate binding No
GO:0043168 anion binding No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0000166 nucleotide binding No
GO:0005215 transporter activity No
GO:0015399 primary active transmembrane transporter activity No
GO:0022857 transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 55 0.45

Transmembrane Domains

Domain # Start End Length
1 508 530 22
2 537 559 22
3 586 608 22
4 621 643 22
5 648 670 22
6 754 776 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7449
MAEKTKDETQTTTNEAKDVTQATATETQDETTSPTHLENDQTPQPERSSSCSSNSSHRSSPSHIDASQRSELVRL
ATAFTQTGHASGAQVQSCSLLDPIDYSPELDPSHTDFDVSAWLRRFIEQLQQQGITYRRTGVAFRHLDVYGSGAA
LQLQSTVGSVLLTPLRLPELIRARRKKEPRHILHGTLLRALTGELHGLKLGEEASVHFTGIPLDRMRKEFRGEIV
YNQEVDKHFAHLTVGQTLEFAAAARTPSSRIQGMSRRKLSEHVARVVMTVFGLSHTYNTKVGSDFVRGVSGGERK
RVSIAEMVVAGSPLAAWDNSTRGLDSATAFKFVQSLRMTCDLASQTNLVAIYQASQAIYDLFDKATVLYQGRQIY
FGPASQARRFFEDQGWHCPPRQTTGDFLTAVTNPSERRARPGMEDRVPRTPAEFETYWRESPDYQALKEDLDEYE
ERTLGGENVRETMAEFRQQTEAFRAPHRLRPRSPYTIGVGLQLTLNMRRAYQRIRGDMSAKVAQICSDIFMALII
GSLFYNTPNATVGFYSKGAVLFMAVLMNALTAISEISGLYEQRPVVEKQRSYAFYHPATEALAGVVADIPIRFVT
SACFNLIVYFLSNLWRSAGQFFLYYMVVFMTIFVMSAVFRTLAAATKTISQAMAFAGIMVLALVMYTGFAIRVPQ
MHPWLSWIRWINPIFYAFEILVANEFHGHRYPCSSLIPNYSPPEGNSFICAITGAVAGETTVSGDSFIMADYRYS
WSHVWRNYGILWAFLIAFLVLYLFTIEINSSSTSTAEALVFPRSHVPPHLKPDYKESSSEKGPALDGEAIIAERS
TNDDQVNALPPQTDLFTWRHVIYDIEIKGKGRRLLDHVDGWVKPGTLTALMGVSGAGKTTLLDVLAQRTTMGVIT
GDMLVNGKPLDASFQRKTGYVQQQGLHLHLQGGIS*
Coding >Ophun1|7449
ATGGCGGAAAAGACAAAAGACGAGACGCAAACAACCACCAACGAAGCCAAAGACGTAACCCAAGCCACAGCCACA
GAAACACAAGACGAAACCACATCACCAACGCATCTCGAAAACGATCAAACCCCCCAGCCTGAACGCTCCTCCAGC
TGCTCCTCCAATTCCTCCCACCGCAGCTCCCCCTCCCACATAGACGCCTCCCAACGCTCCGAACTGGTCCGCCTA
GCCACAGCCTTCACGCAAACCGGCCACGCATCCGGAGCCCAAGTCCAAAGCTGCTCACTCCTCGATCCCATAGAC
TACTCGCCCGAGCTCGACCCCTCGCACACCGACTTCGACGTCTCAGCCTGGCTGCGTCGCTTCATAGAGCAGCTC
CAGCAGCAAGGCATCACCTACCGTCGAACAGGCGTTGCCTTCCGCCACCTCGATGTCTACGGCTCAGGCGCAGCG
CTCCAGCTTCAGTCGACGGTTGGGTCTGTGCTTCTGACGCCGCTGCGGCTGCCGGAGCTGATTCGGGCGAGGCGC
AAAAAGGAGCCGAGGCATATTCTTCATGGTACTCTGTTGAGGGCGCTGACGGGGGAGTTGCACGGGTTGAAGCTT
GGAGAGGAGGCGAGCGTGCATTTTACCGGGATTCCTCTCGATAGAATGAGGAAAGAGTTTCGTGGAGAAATCGTC
TACAACCAAGAGGTAGACAAGCACTTCGCCCACCTCACCGTCGGCCAAACCCTCGAATTCGCAGCCGCGGCACGC
ACGCCGTCGAGTCGGATACAGGGCATGTCGCGGCGGAAGCTGAGCGAGCACGTCGCCCGTGTCGTCATGACCGTC
TTTGGCCTCAGCCATACCTACAACACAAAGGTTGGGAGCGACTTTGTGCGTGGGGTTTCGGGGGGGGAGAGGAAG
AGGGTGAGTATTGCTGAGATGGTTGTTGCGGGCTCGCCGTTGGCGGCGTGGGATAACAGCACCCGCGGCCTTGAC
TCAGCAACCGCCTTCAAATTCGTCCAATCCCTTCGAATGACCTGCGACCTTGCCTCGCAAACAAACCTGGTAGCC
ATCTACCAAGCCAGCCAAGCAATCTACGACCTCTTCGACAAAGCAACCGTCCTCTACCAAGGCCGCCAGATCTAC
TTCGGACCCGCCAGCCAAGCCCGCCGCTTCTTCGAAGACCAAGGCTGGCATTGCCCTCCCCGTCAAACCACCGGC
GACTTCCTCACCGCCGTCACCAACCCTTCCGAGCGGAGGGCTCGTCCCGGCATGGAGGATAGGGTTCCGCGGACG
CCGGCCGAGTTTGAGACCTACTGGCGGGAATCTCCAGACTATCAGGCTCTCAAGGAGGATCTGGATGAGTATGAG
GAGAGGACGCTCGGTGGTGAGAACGTCAGAGAGACAATGGCCGAGTTCCGGCAGCAGACGGAGGCCTTCCGGGCT
CCGCACCGGCTCCGGCCCCGCTCGCCGTACACCATCGGCGTCGGCCTCCAACTAACACTCAACATGCGGCGCGCC
TACCAGCGGATCCGAGGCGACATGTCCGCCAAAGTAGCCCAGATCTGCTCCGACATCTTCATGGCCCTCATCATC
GGCTCTCTCTTCTACAACACGCCCAACGCCACCGTCGGCTTCTACTCCAAAGGCGCCGTGCTCTTCATGGCGGTG
CTGATGAATGCGCTGACGGCCATCTCGGAGATTAGCGGGCTGTATGAGCAGAGGCCTGTTGTTGAGAAGCAGAGG
TCGTACGCGTTCTATCATCCTGCTACCGAGGCGTTGGCGGGTGTCGTTGCGGATATACCGATCCGGTTTGTTACC
TCTGCTTGCTTTAACCTGATTGTTTACTTCTTGTCGAATCTGTGGCGGTCGGCTGGTCAGTTCTTTTTATACTAC
ATGGTTGTCTTTATGACCATCTTTGTCATGAGCGCCGTCTTCCGCACTCTGGCTGCGGCGACAAAGACCATTTCC
CAGGCCATGGCATTTGCGGGAATCATGGTTCTCGCGCTGGTCATGTACACGGGCTTCGCGATTCGAGTACCGCAG
ATGCATCCCTGGCTCTCCTGGATAAGATGGATCAACCCCATCTTCTACGCCTTCGAGATCCTCGTCGCAAACGAA
TTCCACGGCCATCGCTACCCCTGCTCCAGCCTGATCCCCAACTACTCTCCTCCTGAGGGGAACTCGTTCATCTGT
GCCATCACAGGTGCTGTGGCGGGCGAGACGACCGTCAGTGGCGATAGCTTCATCATGGCAGACTACCGCTACTCG
TGGAGCCACGTATGGCGCAACTACGGCATCCTCTGGGCCTTTCTCATTGCGTTTCTCGTGCTGTATCTCTTTACT
ATTGAGATTAACTCGTCCAGCACCAGCACAGCAGAAGCCCTCGTCTTCCCTCGCAGCCATGTACCGCCTCACCTG
AAACCAGACTACAAAGAGAGCAGTTCGGAAAAGGGGCCTGCGTTAGACGGCGAAGCCATCATCGCCGAACGAAGC
ACCAACGACGACCAAGTCAACGCCCTTCCACCGCAGACGGATCTCTTTACATGGCGACACGTCATCTACGACATC
GAAATCAAGGGCAAGGGCCGCCGTCTGCTGGATCACGTCGACGGCTGGGTGAAACCAGGGACGCTGACAGCTCTC
ATGGGCGTTTCCGGCGCGGGAAAGACGACGTTGCTTGATGTTCTCGCCCAGAGAACTACCATGGGCGTCATCACA
GGGGATATGCTCGTCAACGGAAAGCCACTAGACGCCAGTTTCCAGCGTAAGACGGGCTACGTGCAGCAACAAGGT
CTTCATCTCCATCTCCAAGGCGGGATAAGTTGA
Transcript >Ophun1|7449
ATGGCGGAAAAGACAAAAGACGAGACGCAAACAACCACCAACGAAGCCAAAGACGTAACCCAAGCCACAGCCACA
GAAACACAAGACGAAACCACATCACCAACGCATCTCGAAAACGATCAAACCCCCCAGCCTGAACGCTCCTCCAGC
TGCTCCTCCAATTCCTCCCACCGCAGCTCCCCCTCCCACATAGACGCCTCCCAACGCTCCGAACTGGTCCGCCTA
GCCACAGCCTTCACGCAAACCGGCCACGCATCCGGAGCCCAAGTCCAAAGCTGCTCACTCCTCGATCCCATAGAC
TACTCGCCCGAGCTCGACCCCTCGCACACCGACTTCGACGTCTCAGCCTGGCTGCGTCGCTTCATAGAGCAGCTC
CAGCAGCAAGGCATCACCTACCGTCGAACAGGCGTTGCCTTCCGCCACCTCGATGTCTACGGCTCAGGCGCAGCG
CTCCAGCTTCAGTCGACGGTTGGGTCTGTGCTTCTGACGCCGCTGCGGCTGCCGGAGCTGATTCGGGCGAGGCGC
AAAAAGGAGCCGAGGCATATTCTTCATGGTACTCTGTTGAGGGCGCTGACGGGGGAGTTGCACGGGTTGAAGCTT
GGAGAGGAGGCGAGCGTGCATTTTACCGGGATTCCTCTCGATAGAATGAGGAAAGAGTTTCGTGGAGAAATCGTC
TACAACCAAGAGGTAGACAAGCACTTCGCCCACCTCACCGTCGGCCAAACCCTCGAATTCGCAGCCGCGGCACGC
ACGCCGTCGAGTCGGATACAGGGCATGTCGCGGCGGAAGCTGAGCGAGCACGTCGCCCGTGTCGTCATGACCGTC
TTTGGCCTCAGCCATACCTACAACACAAAGGTTGGGAGCGACTTTGTGCGTGGGGTTTCGGGGGGGGAGAGGAAG
AGGGTGAGTATTGCTGAGATGGTTGTTGCGGGCTCGCCGTTGGCGGCGTGGGATAACAGCACCCGCGGCCTTGAC
TCAGCAACCGCCTTCAAATTCGTCCAATCCCTTCGAATGACCTGCGACCTTGCCTCGCAAACAAACCTGGTAGCC
ATCTACCAAGCCAGCCAAGCAATCTACGACCTCTTCGACAAAGCAACCGTCCTCTACCAAGGCCGCCAGATCTAC
TTCGGACCCGCCAGCCAAGCCCGCCGCTTCTTCGAAGACCAAGGCTGGCATTGCCCTCCCCGTCAAACCACCGGC
GACTTCCTCACCGCCGTCACCAACCCTTCCGAGCGGAGGGCTCGTCCCGGCATGGAGGATAGGGTTCCGCGGACG
CCGGCCGAGTTTGAGACCTACTGGCGGGAATCTCCAGACTATCAGGCTCTCAAGGAGGATCTGGATGAGTATGAG
GAGAGGACGCTCGGTGGTGAGAACGTCAGAGAGACAATGGCCGAGTTCCGGCAGCAGACGGAGGCCTTCCGGGCT
CCGCACCGGCTCCGGCCCCGCTCGCCGTACACCATCGGCGTCGGCCTCCAACTAACACTCAACATGCGGCGCGCC
TACCAGCGGATCCGAGGCGACATGTCCGCCAAAGTAGCCCAGATCTGCTCCGACATCTTCATGGCCCTCATCATC
GGCTCTCTCTTCTACAACACGCCCAACGCCACCGTCGGCTTCTACTCCAAAGGCGCCGTGCTCTTCATGGCGGTG
CTGATGAATGCGCTGACGGCCATCTCGGAGATTAGCGGGCTGTATGAGCAGAGGCCTGTTGTTGAGAAGCAGAGG
TCGTACGCGTTCTATCATCCTGCTACCGAGGCGTTGGCGGGTGTCGTTGCGGATATACCGATCCGGTTTGTTACC
TCTGCTTGCTTTAACCTGATTGTTTACTTCTTGTCGAATCTGTGGCGGTCGGCTGGTCAGTTCTTTTTATACTAC
ATGGTTGTCTTTATGACCATCTTTGTCATGAGCGCCGTCTTCCGCACTCTGGCTGCGGCGACAAAGACCATTTCC
CAGGCCATGGCATTTGCGGGAATCATGGTTCTCGCGCTGGTCATGTACACGGGCTTCGCGATTCGAGTACCGCAG
ATGCATCCCTGGCTCTCCTGGATAAGATGGATCAACCCCATCTTCTACGCCTTCGAGATCCTCGTCGCAAACGAA
TTCCACGGCCATCGCTACCCCTGCTCCAGCCTGATCCCCAACTACTCTCCTCCTGAGGGGAACTCGTTCATCTGT
GCCATCACAGGTGCTGTGGCGGGCGAGACGACCGTCAGTGGCGATAGCTTCATCATGGCAGACTACCGCTACTCG
TGGAGCCACGTATGGCGCAACTACGGCATCCTCTGGGCCTTTCTCATTGCGTTTCTCGTGCTGTATCTCTTTACT
ATTGAGATTAACTCGTCCAGCACCAGCACAGCAGAAGCCCTCGTCTTCCCTCGCAGCCATGTACCGCCTCACCTG
AAACCAGACTACAAAGAGAGCAGTTCGGAAAAGGGGCCTGCGTTAGACGGCGAAGCCATCATCGCCGAACGAAGC
ACCAACGACGACCAAGTCAACGCCCTTCCACCGCAGACGGATCTCTTTACATGGCGACACGTCATCTACGACATC
GAAATCAAGGGCAAGGGCCGCCGTCTGCTGGATCACGTCGACGGCTGGGTGAAACCAGGGACGCTGACAGCTCTC
ATGGGCGTTTCCGGCGCGGGAAAGACGACGTTGCTTGATGTTCTCGCCCAGAGAACTACCATGGGCGTCATCACA
GGGGATATGCTCGTCAACGGAAAGCCACTAGACGCCAGTTTCCAGCGTAAGACGGGCTACGTGCAGCAACAAGGT
CTTCATCTCCATCTCCAAGGCGGGATAAGTTGA
Gene >Ophun1|7449
ATGGCGGAAAAGACAAAAGACGAGACGCAAACAACCACCAACGAAGCCAAAGACGTAACCCAAGCCACAGCCACA
GAAACACAAGACGAAACCACATCACCAACGCATCTCGAAAACGATCAAACCCCCCAGCCTGAACGCTCCTCCAGC
TGCTCCTCCAATTCCTCCCACCGCAGCTCCCCCTCCCACATAGACGCCTCCCAACGCTCCGAACTGGTCCGCCTA
GCCACAGCCTTCACGCAAACCGGCCACGCATCCGGAGCCCAAGTCCAAAGCTGCTCACTCCTCGATCCCATAGAC
TACTCGCCCGAGCTCGACCCCTCGCACACCGACTTCGACGTCTCAGCCTGGCTGCGTCGCTTCATAGAGCAGCTC
CAGCAGCAAGGCATCACCTACCGTCGAACAGGCGTTGCCTTCCGCCACCTCGATGTCTACGGCTCAGGCGCAGCG
CTCCAGCTTCAGTCGACGGTTGGGTCTGTGCTTCTGACGCCGCTGCGGCTGCCGGAGCTGATTCGGGCGAGGCGC
AAAAAGGAGCCGAGGCATATTCTTCATGGGTTTGATGGCTTGGTTCGGAGTGGGGAGTTGCTTATCGTGTTGGGG
AGGCCGGGGTCTGGGTGCAGTACTCTGTTGAGGGCGCTGACGGGGGAGTTGCACGGGTTGAAGCTTGGAGAGGAG
GCGAGCGTGCATTTTACCGGGATTCCTCTCGATAGAATGAGGAAAGAGTTTCGTGGAGAAATCGTCTACAACCAA
GAGGTCAGCCCCTGTCCACCTATACCAACCTCACGAGAAGTAAGACCGTACTGACGATTCGCAGGTAGACAAGCA
CTTCGCCCACCTCACCGTCGGCCAAACCCTCGAATTCGCAGCCGCGGCACGCACGCCGTCGAGTCGGATACAGGG
CATGTCGCGGCGGAAGCTGAGCGAGCACGTCGCCCGTGTCGTCATGACCGTCTTTGGCCTCAGCCATACCTACAA
CACAAAGGTTGGGAGCGACTTTGTGCGTGGGGTTTCGGGGGGGGAGAGGAAGAGGGTGAGTATTGCTGAGATGGT
TGTTGCGGGCTCGCCGTTGGCGGCGTGGGATAACAGGTGAGTCTTTAAGATCTTCAACTCTATATACATCAGAAC
TAACAGGAGGAAGCACCCGCGGCCTTGACTCAGCAACCGCCTTCAAATTCGTCCAATCCCTTCGAATGACCTGCG
ACCTTGCCTCGCAAACAAACCTGGTAGCCATCTACCAAGCCAGCCAAGCAATCTACGACCTCTTCGACAAAGCAA
CCGTCCTCTACCAAGGCCGCCAGATCTACTTCGGACCCGCCAGCCAAGCCCGCCGCTTCTTCGAAGACCAAGGCT
GGCATTGCCCTCCCCGTCAAACCACCGGCGACTTCCTCACCGCCGTCACCAACCCTTCCGAGCGGAGGGCTCGTC
CCGGCATGGAGGATAGGGTTCCGCGGACGCCGGCCGAGTTTGAGACCTACTGGCGGGAATCTCCAGACTATCAGG
CTCTCAAGGAGGATCTGGATGAGTATGAGGAGAGGACGCTCGGTGGTGAGAACGTCAGAGAGACAATGGCCGAGT
TCCGGCAGCAGACGGAGGCCTTCCGGGCTCCGCACCGGCTCCGGCCCCGCTCGCCGTACACCATCGGCGTCGGCC
TCCAACTAACACTCAACATGCGGCGCGCCTACCAGCGGATCCGAGGCGACATGTCCGCCAAAGTAGCCCAGATCT
GCTCCGACATCTTCATGGCCCTCATCATCGGCTCTCTCTTCTACAACACGCCCAACGCCACCGTCGGCTTCTACT
CCAAAGGCGCCGTGCTCTTCATGGCGGTGCTGATGAATGCGCTGACGGCCATCTCGGAGATTAGCGGGCTGTATG
AGCAGAGGCCTGTTGTTGAGAAGCAGAGGTCGTACGCGTTCTATCATCCTGCTACCGAGGCGTTGGCGGGTGTCG
TTGCGGATATACCGATCCGGTTTGTTACCTCTGCTTGCTTTAACCTGATTGTTTACTTCTTGTCGAATCTGTGGC
GGTCGGCTGGTCAGTTCTTTTTATACTACATGGTTGTCTTTATGACCATCTTTGTCATGAGCGCCGTCTTCCGCA
CTCTGGCTGCGGCGACAAAGACCATTTCCCAGGCCATGGCATTTGCGGGAATCATGGTTCTCGCGCTGGTCATGT
ACACGGGCTTCGCGATTCGAGTACCGCAGATGCATCCCTGGTGAGTCTCTACTGATACGGTTGTGATGATGCATA
CATGTGATATACTGACGGCTGCAGGCTCTCCTGGATAAGATGGATCAACCCCATCTTCTACGCCTTCGAGATCCT
CGTCGCAAACGAATTCCACGGCCATCGCTACCCCTGCTCCAGCCTGATCCCCAACTACTCTCCTCCTGAGGGGAA
CTCGTTCATCTGTGCCATCACAGGTGCTGTGGCGGGCGAGACGACCGTCAGTGGCGATAGCTTCATCATGGCAGA
CTACCGCTACTCGTGGAGCCACGTATGGCGCAACTACGGCATCCTCTGGGCCTTTCTCATTGCGTTTCTCGTGCT
GTATCTCTTTACTATTGAGATTAACTCGTCCAGCACCAGCACAGCAGAAGCCCTCGTCTTCCCTCGCAGCCATGT
ACCGCCTCACCTGAAACCAGACTACAAAGAGAGCAGTTCGGAAAAGGGGCCTGCGTTAGACGGCGAAGCCATCAT
CGCCGAACGAAGCACCAACGACGACCAAGTCAACGCCCTTCCACCGCAGACGGATCTCTTTACATGGCGACACGT
CATCTACGACATCGAAATCAAGGGCAAGGGCCGCCGTCTGCTGGATCACGTCGACGGCTGGGTGAAACCAGGGAC
GCTGACAGCTCTCATGGGCGTTTCCGGCGCGGGAAAGACGACGTTGCTTGATGTTCTCGCCCAGAGAACTACCAT
GGGCGTCATCACAGGGGATATGCTCGTCAACGGAAAGCCACTAGACGCCAGTTTCCAGCGTAAGACGGGCTACGT
GCAGCAACAAGGTCTTCATCTCCATCTCCAAGGCGGGATAAGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail