Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7447
Gene name
LocationContig_939:2699..4024
Strand-
Gene length (bp)1325
Transcript length (bp)1113
Coding sequence length (bp)1113
Protein length (aa) 371

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09783 Vac_ImportDeg Vacuolar import and degradation protein 8.2E-68 188 358

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9CPY6|GID4_MOUSE Glucose-induced degradation protein 4 homolog OS=Mus musculus GN=Gid4 PE=1 SV=1 182 370 7.0E-54
sp|Q8IVV7|GID4_HUMAN Glucose-induced degradation protein 4 homolog OS=Homo sapiens GN=GID4 PE=2 SV=1 182 359 2.0E-52
sp|P38263|GID4_YEAST Vacuolar import and degradation protein 24 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VID24 PE=1 SV=1 186 355 1.0E-28
sp|Q10079|YANE_SCHPO Uncharacterized protein C3H1.14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H1.14 PE=4 SV=2 187 370 2.0E-28
sp|P53242|YG29_YEAST Uncharacterized protein YGR066C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YGR066C PE=4 SV=1 188 355 1.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9CPY6|GID4_MOUSE Glucose-induced degradation protein 4 homolog OS=Mus musculus GN=Gid4 PE=1 SV=1 182 370 7.0E-54
sp|Q8IVV7|GID4_HUMAN Glucose-induced degradation protein 4 homolog OS=Homo sapiens GN=GID4 PE=2 SV=1 182 359 2.0E-52
sp|P38263|GID4_YEAST Vacuolar import and degradation protein 24 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VID24 PE=1 SV=1 186 355 1.0E-28
sp|Q10079|YANE_SCHPO Uncharacterized protein C3H1.14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H1.14 PE=4 SV=2 187 370 2.0E-28
sp|P53242|YG29_YEAST Uncharacterized protein YGR066C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YGR066C PE=4 SV=1 188 355 1.0E-19
sp|Q9UT04|YLWD_SCHPO Uncharacterized protein P8A3.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAP8A3.13c PE=4 SV=1 177 346 8.0E-13
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4403
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6504
Ophiocordyceps australis map64 (Brazil) OphauB2|8073
Ophiocordyceps camponoti-floridani Ophcf2|04739
Ophiocordyceps camponoti-rufipedis Ophun1|7447 (this protein)
Ophiocordyceps kimflemingae Ophio5|6178
Ophiocordyceps subramaniannii Hirsu2|9115

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7447
MPTPSSNQPPNPSSPIPFPFPTCPDDVQHTPRLPPRQADPVASTQPHGIEDQSETLLDGSSPPAFESQPSQPGEP
EHLSLNRLSSTETSSRTATVTPDTHFTDTPATSPAPNGPDSDVAKGREAGPDGLVNYASSAAPRRCPGRASLVRD
MESQDSSLLDGWDDLLHPTPMGMDFSSKRTIPVSPSSYLRPGSRFHGTQQSERQVYDVQVEVKYVDMRESFLCGY
LRIQGLTEDHPTLTTYFEGEIIGSKYGFITDHEDWGASLKTDMNHWGKFNAFRPFQKLVRKGTCMIGDIAQRDNI
FMRWKEHFLVPDHRVRTITGASFEGFYYICFNQLKGDVSGIYFHSKSEKFQQLELKHVPNRGCFSATEFR*
Coding >Ophun1|7447
ATGCCGACCCCGTCATCCAATCAGCCGCCTAATCCATCCTCACCCATCCCGTTTCCCTTTCCGACCTGCCCTGAC
GACGTGCAACATACGCCACGCCTGCCTCCTCGTCAGGCCGACCCGGTCGCGTCGACGCAACCTCATGGAATAGAG
GACCAGTCCGAAACGCTGCTGGATGGCTCGTCGCCGCCGGCCTTTGAATCTCAACCCTCTCAGCCAGGTGAACCT
GAACACCTCTCCCTGAACCGTCTGTCGTCCACCGAGACGTCCTCTAGAACCGCGACAGTGACGCCCGATACCCAT
TTTACTGACACACCAGCCACTTCTCCGGCGCCAAACGGGCCGGACAGCGATGTGGCTAAAGGCCGCGAGGCTGGC
CCAGACGGTCTCGTCAATTACGCCTCTTCGGCCGCGCCACGACGCTGCCCCGGCAGGGCGTCGCTCGTTCGAGAC
ATGGAATCCCAAGACTCGTCTCTCCTCGATGGGTGGGATGACTTACTACACCCCACCCCAATGGGCATGGACTTT
TCTAGCAAGCGGACCATCCCCGTGTCACCCTCGTCGTATTTGCGCCCTGGCAGCAGATTTCACGGAACTCAGCAG
TCAGAGCGCCAGGTGTATGATGTTCAGGTAGAAGTCAAGTATGTCGACATGCGCGAGTCGTTTCTCTGTGGCTAC
CTGCGAATACAAGGCCTTACTGAGGACCACCCAACCCTTACGACCTATTTTGAAGGTGAAATTATTGGATCCAAA
TACGGCTTCATCACCGATCATGAGGACTGGGGAGCGAGTCTGAAAACGGACATGAATCATTGGGGGAAATTCAAC
GCCTTCCGGCCCTTTCAGAAGCTCGTTCGTAAGGGAACCTGCATGATAGGCGACATTGCCCAAAGGGACAACATC
TTTATGCGATGGAAGGAACACTTCCTCGTACCCGATCATCGTGTGCGAACCATTACGGGAGCCAGTTTTGAGGGC
TTCTACTATATCTGCTTCAACCAACTCAAGGGCGATGTCAGCGGGATATATTTTCATTCTAAAAGCGAAAAGTTC
CAGCAGCTCGAGTTGAAGCACGTACCAAATCGTGGCTGTTTCAGTGCTACCGAGTTCCGATAA
Transcript >Ophun1|7447
ATGCCGACCCCGTCATCCAATCAGCCGCCTAATCCATCCTCACCCATCCCGTTTCCCTTTCCGACCTGCCCTGAC
GACGTGCAACATACGCCACGCCTGCCTCCTCGTCAGGCCGACCCGGTCGCGTCGACGCAACCTCATGGAATAGAG
GACCAGTCCGAAACGCTGCTGGATGGCTCGTCGCCGCCGGCCTTTGAATCTCAACCCTCTCAGCCAGGTGAACCT
GAACACCTCTCCCTGAACCGTCTGTCGTCCACCGAGACGTCCTCTAGAACCGCGACAGTGACGCCCGATACCCAT
TTTACTGACACACCAGCCACTTCTCCGGCGCCAAACGGGCCGGACAGCGATGTGGCTAAAGGCCGCGAGGCTGGC
CCAGACGGTCTCGTCAATTACGCCTCTTCGGCCGCGCCACGACGCTGCCCCGGCAGGGCGTCGCTCGTTCGAGAC
ATGGAATCCCAAGACTCGTCTCTCCTCGATGGGTGGGATGACTTACTACACCCCACCCCAATGGGCATGGACTTT
TCTAGCAAGCGGACCATCCCCGTGTCACCCTCGTCGTATTTGCGCCCTGGCAGCAGATTTCACGGAACTCAGCAG
TCAGAGCGCCAGGTGTATGATGTTCAGGTAGAAGTCAAGTATGTCGACATGCGCGAGTCGTTTCTCTGTGGCTAC
CTGCGAATACAAGGCCTTACTGAGGACCACCCAACCCTTACGACCTATTTTGAAGGTGAAATTATTGGATCCAAA
TACGGCTTCATCACCGATCATGAGGACTGGGGAGCGAGTCTGAAAACGGACATGAATCATTGGGGGAAATTCAAC
GCCTTCCGGCCCTTTCAGAAGCTCGTTCGTAAGGGAACCTGCATGATAGGCGACATTGCCCAAAGGGACAACATC
TTTATGCGATGGAAGGAACACTTCCTCGTACCCGATCATCGTGTGCGAACCATTACGGGAGCCAGTTTTGAGGGC
TTCTACTATATCTGCTTCAACCAACTCAAGGGCGATGTCAGCGGGATATATTTTCATTCTAAAAGCGAAAAGTTC
CAGCAGCTCGAGTTGAAGCACGTACCAAATCGTGGCTGTTTCAGTGCTACCGAGTTCCGATAA
Gene >Ophun1|7447
ATGCCGACCCCGTCATCCAATCAGCCGCCTAATCCATCCTCACCCATCCCGTTTCCCTTTCCGACCTGCCCTGAC
GACGTGCAACATACGCCACGCCTGCCTCCTCGTCAGGCCGACCCGGTCGCGTCGACGCAACCTCATGGAATAGAG
GACCAGTCCGAAACGCTGCTGGATGGCTCGTCGCCGCCGGCCTTTGAATCTCAACCCTCTCAGCCAGGTGAACCT
GAACACCTCTCCCTGAACCGTCTGTCGTCCACCGAGACGTCCTCTAGAACCGCGACAGTGACGCCCGATACCCAT
TTTACTGACACACCAGCCACTTCTCCGGCGCCAAACGGGCCGGACAGCGATGTGGCTAAAGGCCGCGAGGCTGGC
CCAGACGGTCTCGTCAATTACGCCTCTTCGGCCGCGCCACGACGCTGCCCCGGCAGGGCGTCGCTCGTTCGAGAC
ATGGAATCCCAAGACTCGTCTCTCCTCGATGGGTGGGATGACTTACTACACCCCACCCCAATGGGCATGGACTTT
TCTAGCAAGCGGGTATAGCCGTGCACCCCTTACGGAGCGCTGTCGCGAACGGAGCTCACAAGTCCCTAGACCATC
CCCGTGTCACCCTCGTCGTATTTGCGCCCTGGCAGCAGATTTCACGGAACTCAGCAGTCAGAGCGCCAGGTGTAT
GATGTTCAGGTAGAAGTCAAGTATGTCGACATGCGCGAGTCGTTTCTCTGTGGCTACCTGCGAATACAAGGTTAG
CAAAGCTCGTCACCCATGTTTAATCCTCGGCGCCCCTTATTTTGGCATGCCTTGACGCATGTGGCACGGCTGACG
TGCCTGCTCCTATTTCGCAGGCCTTACTGAGGACCACCCAACCCTTACGACCTATTTTGAAGGTGAAATTATTGG
ATCCAAATACGGCTTCATCACCGATCATGAGGACTGGGGAGCGAGTCTGAAAACGGACATGAATCATTGGGGGAA
ATTCAACGCCTTCCGGCCCTTTCAGAAGCTCGTTCGTAAGGGAACCTGCATGATAGGCGACATTGCCCAAAGGGA
CAACATCTTTATGCGATGGAAGGAACACTTCCTCGTACCCGATCATCGTGTGCGAACCATTACGGGAGCCAGTTT
TGAGGGCTTCTACTATATCTGCTTCAACCAACTCAAGGGCGATGTCAGCGGGATATATTTTCATTCTAAAAGCGA
AAAGTGAGGGCCTTTCGCGTCTGTGGTTTGCTGGCTCAATTCTGACTTCGTATTCTAGGTTCCAGCAGCTCGAGT
TGAAGCACGTACCAAATCGTGGCTGTTTCAGTGCTACCGAGTTCCGATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail