Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7439
Gene name
LocationContig_935:3502..4649
Strand+
Gene length (bp)1147
Transcript length (bp)1029
Coding sequence length (bp)1029
Protein length (aa) 343

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12505 DUF3712 Protein of unknown function (DUF3712) 6.2E-13 121 241

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 60 0.5

Transmembrane Domains

Domain # Start End Length
1 31 53 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7439
MSYDSKNMVAQTENDAPVGKKRGCINHAKRFWWAYGLALCALVVLVVCLLIFVAVPNLAQKKMDAAILEIQGVAV
RDTRRDGYRMEINSTMETDGSMHADIDAFKADLALTDVEDGTNPVFASLSFKQTPVEKLIKVNISEDAIITNRAG
FTRFNTLMYQRESVHVIIRGETHIQPAGLNRKYSVKLFRNYVFTGLNRFKGATVDGLVDITAERGQPNFKGKAVI
PNRSIFTMEIGNATFTNFADGQNLGNMTINNLVLRPGDNEVDVEANLDQIKILRIMSKRPYCETGIVPFDVLGTR
VVNNGEELDYFAKALGSANQTINIDIGNILRKSLGDMPLTCA*
Coding >Ophun1|7439
ATGTCTTACGACTCCAAGAACATGGTCGCCCAGACGGAGAATGATGCTCCTGTCGGCAAGAAGCGTGGCTGTATC
AACCATGCCAAGCGATTCTGGTGGGCGTACGGCCTGGCTCTCTGTGCCTTGGTCGTTCTCGTCGTTTGTCTCCTC
ATCTTCGTCGCTGTCCCCAACCTCGCTCAGAAGAAGATGGACGCTGCTATCCTCGAGATCCAGGGCGTTGCCGTG
CGCGACACCAGGCGTGATGGCTATCGAATGGAAATCAACTCCACCATGGAAACGGACGGCTCTATGCACGCCGAC
ATTGACGCGTTCAAAGCAGACTTGGCCCTCACGGACGTTGAGGACGGTACTAACCCTGTCTTTGCCTCGCTCTCG
TTCAAGCAAACCCCCGTCGAGAAGCTCATCAAGGTCAACATCTCCGAGGACGCCATCATCACCAATCGCGCCGGC
TTTACCAGGTTCAATACGCTCATGTACCAGAGGGAGTCGGTCCATGTTATCATCAGGGGCGAGACTCACATCCAG
CCAGCGGGTCTGAATAGGAAGTACTCCGTGAAGCTGTTCAGGAATTACGTGTTCACCGGCTTGAACCGCTTCAAG
GGCGCGACGGTTGATGGCCTCGTCGACATCACGGCCGAAAGGGGGCAACCCAACTTCAAGGGCAAGGCCGTGATC
CCCAACCGGTCCATCTTTACCATGGAGATTGGAAACGCCACCTTTACCAACTTTGCCGATGGCCAGAATCTCGGG
AACATGACCATTAACAACCTGGTTCTCAGGCCGGGCGACAACGAGGTCGACGTCGAGGCTAATCTCGATCAGATC
AAGATCCTGAGAATCATGTCCAAGAGGCCCTATTGCGAGACGGGCATCGTGCCCTTTGACGTCCTGGGCACAAGG
GTTGTCAACAACGGCGAGGAACTCGACTACTTCGCAAAAGCCCTCGGCAGCGCCAACCAGACCATCAACATCGAC
ATTGGCAACATCCTCCGCAAGAGCTTGGGCGACATGCCGTTGACTTGCGCCTGA
Transcript >Ophun1|7439
ATGTCTTACGACTCCAAGAACATGGTCGCCCAGACGGAGAATGATGCTCCTGTCGGCAAGAAGCGTGGCTGTATC
AACCATGCCAAGCGATTCTGGTGGGCGTACGGCCTGGCTCTCTGTGCCTTGGTCGTTCTCGTCGTTTGTCTCCTC
ATCTTCGTCGCTGTCCCCAACCTCGCTCAGAAGAAGATGGACGCTGCTATCCTCGAGATCCAGGGCGTTGCCGTG
CGCGACACCAGGCGTGATGGCTATCGAATGGAAATCAACTCCACCATGGAAACGGACGGCTCTATGCACGCCGAC
ATTGACGCGTTCAAAGCAGACTTGGCCCTCACGGACGTTGAGGACGGTACTAACCCTGTCTTTGCCTCGCTCTCG
TTCAAGCAAACCCCCGTCGAGAAGCTCATCAAGGTCAACATCTCCGAGGACGCCATCATCACCAATCGCGCCGGC
TTTACCAGGTTCAATACGCTCATGTACCAGAGGGAGTCGGTCCATGTTATCATCAGGGGCGAGACTCACATCCAG
CCAGCGGGTCTGAATAGGAAGTACTCCGTGAAGCTGTTCAGGAATTACGTGTTCACCGGCTTGAACCGCTTCAAG
GGCGCGACGGTTGATGGCCTCGTCGACATCACGGCCGAAAGGGGGCAACCCAACTTCAAGGGCAAGGCCGTGATC
CCCAACCGGTCCATCTTTACCATGGAGATTGGAAACGCCACCTTTACCAACTTTGCCGATGGCCAGAATCTCGGG
AACATGACCATTAACAACCTGGTTCTCAGGCCGGGCGACAACGAGGTCGACGTCGAGGCTAATCTCGATCAGATC
AAGATCCTGAGAATCATGTCCAAGAGGCCCTATTGCGAGACGGGCATCGTGCCCTTTGACGTCCTGGGCACAAGG
GTTGTCAACAACGGCGAGGAACTCGACTACTTCGCAAAAGCCCTCGGCAGCGCCAACCAGACCATCAACATCGAC
ATTGGCAACATCCTCCGCAAGAGCTTGGGCGACATGCCGTTGACTTGCGCCTGA
Gene >Ophun1|7439
ATGTCTTACGACTCCAAGAACATGGTCGCCCAGACGGAGAATGATGCTCCTGTCGGCAAGAAGCGTGGCTGTATC
AACCATGCCAAGCGATTCTGGTGGGCGTACGGCCTGGCTCTCTGTGCCTTGGTCGTTCTCGTCGTTTGTCTCCTG
TGAGAGCATCTTGATCTCCCTGACGGGGGGAGAGAGATGGTTCTTGCTGACTGGTTGACGATAGCATCTTCGTCG
CTGTCCCCAACCTCGCTCAGAAGAAGATGGACGCTGCTATCCTCGAGATCCAGGGCGTTGCCGTGCGCGACACCA
GGCGTGATGGCTATCGAATGGAAATCAACTCCACCATGGAAACGGACGGCTCTATGCACGCCGACATTGACGCGT
TCAAAGCAGACTTGGCCCTCACGGACGTTGAGGACGGTACTAACCCTGTCTTTGCCTCGCTCTCGTTCAAGCAAA
CCCCCGTCGAGAAGCTCATCAAGGTCAACATCTCCGAGGACGCCATCATCACCAATCGCGCCGGCTTTACCAGGT
TCAATACGCTCATGTACCAGAGGGAGTCGGTCCATGTTATCATCAGGGGCGAGACTCACATCCAGCCAGCGGGTC
TGAATAGGAAGTACTCCGTGAAGCTGTTCAGGAATTACGTGTTCACCGGCTTGAACCGCTTCAAGGGCGCGACGG
TTGATGGCCTCGTCGACATCACGGCCGAAAGGGGGCAACCCAACTTCAAGGGCAAGGCCGTGATCCCCAACCGGT
CCATCTTTACCATGGAGATTGTGAGTTTGATGCTTTCTGCCGTGGTTTGACGTTGCTGACGACTTCTTGGTAGGG
AAACGCCACCTTTACCAACTTTGCCGATGGCCAGAATCTCGGGAACATGACCATTAACAACCTGGTTCTCAGGCC
GGGCGACAACGAGGTCGACGTCGAGGCTAATCTCGATCAGATCAAGATCCTGAGAATCATGTCCAAGAGGCCCTA
TTGCGAGACGGGCATCGTGCCCTTTGACGTCCTGGGCACAAGGGTTGTCAACAACGGCGAGGAACTCGACTACTT
CGCAAAAGCCCTCGGCAGCGCCAACCAGACCATCAACATCGACATTGGCAACATCCTCCGCAAGAGCTTGGGCGA
CATGCCGTTGACTTGCGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail