Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7439
Gene name
LocationContig_935:3502..4649
Strand+
Gene length (bp)1147
Transcript length (bp)1029
Coding sequence length (bp)1029
Protein length (aa) 343

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12505 DUF3712 Protein of unknown function (DUF3712) 6.2E-13 121 241

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 31 53 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1516
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3961
Ophiocordyceps australis map64 (Brazil) OphauB2|518
Ophiocordyceps camponoti-floridani Ophcf2|07260
Ophiocordyceps camponoti-rufipedis Ophun1|7439 (this protein)
Ophiocordyceps kimflemingae Ophio5|1885
Ophiocordyceps subramaniannii Hirsu2|11189

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7439
MSYDSKNMVAQTENDAPVGKKRGCINHAKRFWWAYGLALCALVVLVVCLLIFVAVPNLAQKKMDAAILEIQGVAV
RDTRRDGYRMEINSTMETDGSMHADIDAFKADLALTDVEDGTNPVFASLSFKQTPVEKLIKVNISEDAIITNRAG
FTRFNTLMYQRESVHVIIRGETHIQPAGLNRKYSVKLFRNYVFTGLNRFKGATVDGLVDITAERGQPNFKGKAVI
PNRSIFTMEIGNATFTNFADGQNLGNMTINNLVLRPGDNEVDVEANLDQIKILRIMSKRPYCETGIVPFDVLGTR
VVNNGEELDYFAKALGSANQTINIDIGNILRKSLGDMPLTCA*
Coding >Ophun1|7439
ATGTCTTACGACTCCAAGAACATGGTCGCCCAGACGGAGAATGATGCTCCTGTCGGCAAGAAGCGTGGCTGTATC
AACCATGCCAAGCGATTCTGGTGGGCGTACGGCCTGGCTCTCTGTGCCTTGGTCGTTCTCGTCGTTTGTCTCCTC
ATCTTCGTCGCTGTCCCCAACCTCGCTCAGAAGAAGATGGACGCTGCTATCCTCGAGATCCAGGGCGTTGCCGTG
CGCGACACCAGGCGTGATGGCTATCGAATGGAAATCAACTCCACCATGGAAACGGACGGCTCTATGCACGCCGAC
ATTGACGCGTTCAAAGCAGACTTGGCCCTCACGGACGTTGAGGACGGTACTAACCCTGTCTTTGCCTCGCTCTCG
TTCAAGCAAACCCCCGTCGAGAAGCTCATCAAGGTCAACATCTCCGAGGACGCCATCATCACCAATCGCGCCGGC
TTTACCAGGTTCAATACGCTCATGTACCAGAGGGAGTCGGTCCATGTTATCATCAGGGGCGAGACTCACATCCAG
CCAGCGGGTCTGAATAGGAAGTACTCCGTGAAGCTGTTCAGGAATTACGTGTTCACCGGCTTGAACCGCTTCAAG
GGCGCGACGGTTGATGGCCTCGTCGACATCACGGCCGAAAGGGGGCAACCCAACTTCAAGGGCAAGGCCGTGATC
CCCAACCGGTCCATCTTTACCATGGAGATTGGAAACGCCACCTTTACCAACTTTGCCGATGGCCAGAATCTCGGG
AACATGACCATTAACAACCTGGTTCTCAGGCCGGGCGACAACGAGGTCGACGTCGAGGCTAATCTCGATCAGATC
AAGATCCTGAGAATCATGTCCAAGAGGCCCTATTGCGAGACGGGCATCGTGCCCTTTGACGTCCTGGGCACAAGG
GTTGTCAACAACGGCGAGGAACTCGACTACTTCGCAAAAGCCCTCGGCAGCGCCAACCAGACCATCAACATCGAC
ATTGGCAACATCCTCCGCAAGAGCTTGGGCGACATGCCGTTGACTTGCGCCTGA
Transcript >Ophun1|7439
ATGTCTTACGACTCCAAGAACATGGTCGCCCAGACGGAGAATGATGCTCCTGTCGGCAAGAAGCGTGGCTGTATC
AACCATGCCAAGCGATTCTGGTGGGCGTACGGCCTGGCTCTCTGTGCCTTGGTCGTTCTCGTCGTTTGTCTCCTC
ATCTTCGTCGCTGTCCCCAACCTCGCTCAGAAGAAGATGGACGCTGCTATCCTCGAGATCCAGGGCGTTGCCGTG
CGCGACACCAGGCGTGATGGCTATCGAATGGAAATCAACTCCACCATGGAAACGGACGGCTCTATGCACGCCGAC
ATTGACGCGTTCAAAGCAGACTTGGCCCTCACGGACGTTGAGGACGGTACTAACCCTGTCTTTGCCTCGCTCTCG
TTCAAGCAAACCCCCGTCGAGAAGCTCATCAAGGTCAACATCTCCGAGGACGCCATCATCACCAATCGCGCCGGC
TTTACCAGGTTCAATACGCTCATGTACCAGAGGGAGTCGGTCCATGTTATCATCAGGGGCGAGACTCACATCCAG
CCAGCGGGTCTGAATAGGAAGTACTCCGTGAAGCTGTTCAGGAATTACGTGTTCACCGGCTTGAACCGCTTCAAG
GGCGCGACGGTTGATGGCCTCGTCGACATCACGGCCGAAAGGGGGCAACCCAACTTCAAGGGCAAGGCCGTGATC
CCCAACCGGTCCATCTTTACCATGGAGATTGGAAACGCCACCTTTACCAACTTTGCCGATGGCCAGAATCTCGGG
AACATGACCATTAACAACCTGGTTCTCAGGCCGGGCGACAACGAGGTCGACGTCGAGGCTAATCTCGATCAGATC
AAGATCCTGAGAATCATGTCCAAGAGGCCCTATTGCGAGACGGGCATCGTGCCCTTTGACGTCCTGGGCACAAGG
GTTGTCAACAACGGCGAGGAACTCGACTACTTCGCAAAAGCCCTCGGCAGCGCCAACCAGACCATCAACATCGAC
ATTGGCAACATCCTCCGCAAGAGCTTGGGCGACATGCCGTTGACTTGCGCCTGA
Gene >Ophun1|7439
ATGTCTTACGACTCCAAGAACATGGTCGCCCAGACGGAGAATGATGCTCCTGTCGGCAAGAAGCGTGGCTGTATC
AACCATGCCAAGCGATTCTGGTGGGCGTACGGCCTGGCTCTCTGTGCCTTGGTCGTTCTCGTCGTTTGTCTCCTG
TGAGAGCATCTTGATCTCCCTGACGGGGGGAGAGAGATGGTTCTTGCTGACTGGTTGACGATAGCATCTTCGTCG
CTGTCCCCAACCTCGCTCAGAAGAAGATGGACGCTGCTATCCTCGAGATCCAGGGCGTTGCCGTGCGCGACACCA
GGCGTGATGGCTATCGAATGGAAATCAACTCCACCATGGAAACGGACGGCTCTATGCACGCCGACATTGACGCGT
TCAAAGCAGACTTGGCCCTCACGGACGTTGAGGACGGTACTAACCCTGTCTTTGCCTCGCTCTCGTTCAAGCAAA
CCCCCGTCGAGAAGCTCATCAAGGTCAACATCTCCGAGGACGCCATCATCACCAATCGCGCCGGCTTTACCAGGT
TCAATACGCTCATGTACCAGAGGGAGTCGGTCCATGTTATCATCAGGGGCGAGACTCACATCCAGCCAGCGGGTC
TGAATAGGAAGTACTCCGTGAAGCTGTTCAGGAATTACGTGTTCACCGGCTTGAACCGCTTCAAGGGCGCGACGG
TTGATGGCCTCGTCGACATCACGGCCGAAAGGGGGCAACCCAACTTCAAGGGCAAGGCCGTGATCCCCAACCGGT
CCATCTTTACCATGGAGATTGTGAGTTTGATGCTTTCTGCCGTGGTTTGACGTTGCTGACGACTTCTTGGTAGGG
AAACGCCACCTTTACCAACTTTGCCGATGGCCAGAATCTCGGGAACATGACCATTAACAACCTGGTTCTCAGGCC
GGGCGACAACGAGGTCGACGTCGAGGCTAATCTCGATCAGATCAAGATCCTGAGAATCATGTCCAAGAGGCCCTA
TTGCGAGACGGGCATCGTGCCCTTTGACGTCCTGGGCACAAGGGTTGTCAACAACGGCGAGGAACTCGACTACTT
CGCAAAAGCCCTCGGCAGCGCCAACCAGACCATCAACATCGACATTGGCAACATCCTCCGCAAGAGCTTGGGCGA
CATGCCGTTGACTTGCGCCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail