Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7438
Gene name
LocationContig_935:790..2379
Strand+
Gene length (bp)1589
Transcript length (bp)1425
Coding sequence length (bp)1425
Protein length (aa) 475

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01070 FMN_dh FMN-dependent dehydrogenase 1.3E-107 115 460
PF00173 Cyt-b5 Cytochrome b5-like Heme/Steroid binding domain 1.5E-19 8 79
PF01645 Glu_synthase Conserved region in glutamate synthase 3.9E-06 382 421

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P09437|CYB2_WICAO Cytochrome b2, mitochondrial OS=Wickerhamomyces anomalus GN=CYB2 PE=1 SV=2 3 464 3.0E-100
sp|P00175|CYB2_YEAST Cytochrome b2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CYB2 PE=1 SV=1 6 460 2.0E-96
sp|P32953|CYBL_RHOGR (S)-mandelate dehydrogenase, mitochondrial OS=Rhodotorula graminis PE=1 SV=2 6 470 8.0E-92
sp|Q9NYQ2|HAOX2_MOUSE Hydroxyacid oxidase 2 OS=Mus musculus GN=Hao2 PE=1 SV=1 104 464 1.0E-73
sp|O49506|GLO5_ARATH Peroxisomal (S)-2-hydroxy-acid oxidase GLO5 OS=Arabidopsis thaliana GN=GLO5 PE=1 SV=1 105 462 1.0E-68
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P09437|CYB2_WICAO Cytochrome b2, mitochondrial OS=Wickerhamomyces anomalus GN=CYB2 PE=1 SV=2 3 464 3.0E-100
sp|P00175|CYB2_YEAST Cytochrome b2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CYB2 PE=1 SV=1 6 460 2.0E-96
sp|P32953|CYBL_RHOGR (S)-mandelate dehydrogenase, mitochondrial OS=Rhodotorula graminis PE=1 SV=2 6 470 8.0E-92
sp|Q9NYQ2|HAOX2_MOUSE Hydroxyacid oxidase 2 OS=Mus musculus GN=Hao2 PE=1 SV=1 104 464 1.0E-73
sp|O49506|GLO5_ARATH Peroxisomal (S)-2-hydroxy-acid oxidase GLO5 OS=Arabidopsis thaliana GN=GLO5 PE=1 SV=1 105 462 1.0E-68
sp|Q07523|HAOX2_RAT Hydroxyacid oxidase 2 OS=Rattus norvegicus GN=Hao2 PE=1 SV=2 105 464 3.0E-66
sp|P05414|GOX_SPIOL Peroxisomal (S)-2-hydroxy-acid oxidase OS=Spinacia oleracea PE=1 SV=1 105 455 1.0E-64
sp|Q9LRR9|GLO1_ARATH Peroxisomal (S)-2-hydroxy-acid oxidase GLO1 OS=Arabidopsis thaliana GN=GLO1 PE=1 SV=1 105 461 2.0E-64
sp|Q9NYQ3|HAOX2_HUMAN Hydroxyacid oxidase 2 OS=Homo sapiens GN=HAO2 PE=1 SV=1 104 464 4.0E-64
sp|Q8H3I4|GLO4_ORYSJ Peroxisomal (S)-2-hydroxy-acid oxidase GLO4 OS=Oryza sativa subsp. japonica GN=GLO4 PE=2 SV=2 106 454 4.0E-64
sp|Q3ZBW2|HAOX2_BOVIN Hydroxyacid oxidase 2 OS=Bos taurus GN=HAO2 PE=2 SV=1 100 464 2.0E-63
sp|Q9LRS0|GLO2_ARATH Peroxisomal (S)-2-hydroxy-acid oxidase GLO2 OS=Arabidopsis thaliana GN=GLO2 PE=1 SV=1 105 454 7.0E-63
sp|Q7FAS1|GLO3_ORYSJ Peroxisomal (S)-2-hydroxy-acid oxidase GLO3 OS=Oryza sativa subsp. japonica GN=GLO3 PE=2 SV=1 105 466 1.0E-62
sp|B8AUI3|GLO3_ORYSI Peroxisomal (S)-2-hydroxy-acid oxidase GLO3 OS=Oryza sativa subsp. indica GN=GLO3 PE=3 SV=1 105 466 1.0E-62
sp|Q9LJH5|GLO4_ARATH Peroxisomal (S)-2-hydroxy-acid oxidase GLO4 OS=Arabidopsis thaliana GN=GLO4 PE=2 SV=1 102 454 1.0E-62
sp|Q24JJ8|GLO3_ARATH Peroxisomal (S)-2-hydroxy-acid oxidase GLO3 OS=Arabidopsis thaliana GN=GLO3 PE=2 SV=1 102 454 1.0E-61
sp|B8B8K5|GLO4_ORYSI Peroxisomal (S)-2-hydroxy-acid oxidase GLO4 OS=Oryza sativa subsp. indica GN=GLO4 PE=3 SV=2 106 454 2.0E-61
sp|Q54E41|HAOX_DICDI Hydroxyacid oxidase OS=Dictyostelium discoideum GN=haox PE=3 SV=1 102 459 5.0E-60
sp|Q6YT73|GLO5_ORYSJ Peroxisomal (S)-2-hydroxy-acid oxidase GLO5 OS=Oryza sativa subsp. japonica GN=GLO5 PE=2 SV=1 105 454 9.0E-60
sp|B8B7C5|GLO5_ORYSI Peroxisomal (S)-2-hydroxy-acid oxidase GLO5 OS=Oryza sativa subsp. indica GN=GLO5 PE=3 SV=1 105 454 9.0E-60
sp|Q10CE4|GLO1_ORYSJ Peroxisomal (S)-2-hydroxy-acid oxidase GLO1 OS=Oryza sativa subsp. japonica GN=GLO1 PE=1 SV=1 105 454 2.0E-59
sp|B8AKX6|GLO1_ORYSI Peroxisomal (S)-2-hydroxy-acid oxidase GLO1 OS=Oryza sativa subsp. indica GN=GLO1 PE=3 SV=1 105 454 2.0E-59
sp|Q9UJM8|HAOX1_HUMAN Hydroxyacid oxidase 1 OS=Homo sapiens GN=HAO1 PE=1 SV=1 102 459 8.0E-56
sp|Q7XPR4|GLO2_ORYSJ Peroxisomal (S)-2-hydroxy-acid oxidase GLO2 OS=Oryza sativa subsp. japonica GN=GLO2 PE=3 SV=3 107 466 1.0E-55
sp|Q01KC2|GLO2_ORYSI Peroxisomal (S)-2-hydroxy-acid oxidase GLO2 OS=Oryza sativa subsp. indica GN=GLO2 PE=3 SV=2 107 466 1.0E-55
sp|Q9WU19|HAOX1_MOUSE Hydroxyacid oxidase 1 OS=Mus musculus GN=Hao1 PE=1 SV=1 102 459 8.0E-55
sp|P9WND5|LLDD_MYCTU Putative L-lactate dehydrogenase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=lldD PE=1 SV=1 102 464 6.0E-42
sp|P9WND4|LLDD_MYCTO Putative L-lactate dehydrogenase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=lldD PE=3 SV=1 102 464 6.0E-42
sp|O52792|HMO_AMYOR 4-hydroxymandelate oxidase OS=Amycolatopsis orientalis GN=hmo PE=1 SV=1 104 451 6.0E-38
sp|Q1R0J2|LLDD_CHRSD L-lactate dehydrogenase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=lldD PE=3 SV=1 114 455 4.0E-35
sp|Q6DAY3|LLDD_PECAS L-lactate dehydrogenase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=lldD PE=3 SV=1 110 454 1.0E-34
sp|O33655|LA2M_STRIN Lactate 2-monooxygenase OS=Streptococcus iniae GN=lctO PE=3 SV=1 105 454 3.0E-34
sp|P21795|LA2M_MYCSM Lactate 2-monooxygenase OS=Mycobacterium smegmatis PE=1 SV=3 106 454 4.0E-34
sp|Q87G18|LLDD_VIBPA L-lactate dehydrogenase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=lldD PE=3 SV=1 110 454 3.0E-33
sp|B4SMK1|LLDD_STRM5 L-lactate dehydrogenase OS=Stenotrophomonas maltophilia (strain R551-3) GN=lldD PE=3 SV=1 110 455 1.0E-32
sp|B2FIJ0|LLDD_STRMK L-lactate dehydrogenase OS=Stenotrophomonas maltophilia (strain K279a) GN=lldD PE=3 SV=1 110 455 3.0E-32
sp|P20932|MDLB_PSEPU (S)-mandelate dehydrogenase OS=Pseudomonas putida GN=mdlB PE=1 SV=1 104 464 2.0E-31
sp|B0BTC7|LLDD_ACTPJ L-lactate dehydrogenase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=lldD PE=3 SV=1 109 454 3.0E-31
sp|B3GZA5|LLDD_ACTP7 L-lactate dehydrogenase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=lldD PE=3 SV=1 109 454 3.0E-31
sp|A3N3E5|LLDD_ACTP2 L-lactate dehydrogenase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=lldD PE=3 SV=1 109 454 3.0E-31
sp|Q6WB83|LLDD_ALCFA L-lactate dehydrogenase OS=Alcaligenes faecalis GN=lldD PE=3 SV=1 114 459 5.0E-31
sp|B0RLM2|LLDD_XANCB L-lactate dehydrogenase OS=Xanthomonas campestris pv. campestris (strain B100) GN=lldD PE=3 SV=1 110 454 9.0E-31
sp|A5UFG9|LLDD_HAEIG L-lactate dehydrogenase OS=Haemophilus influenzae (strain PittGG) GN=lldD PE=3 SV=1 114 457 1.0E-30
sp|A5UBE3|LLDD_HAEIE L-lactate dehydrogenase OS=Haemophilus influenzae (strain PittEE) GN=lldD PE=3 SV=1 114 457 1.0E-30
sp|B9K115|LLDD_AGRVS L-lactate dehydrogenase OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=lldD PE=3 SV=1 114 456 1.0E-30
sp|Q31V17|LLDD_SHIBS L-lactate dehydrogenase OS=Shigella boydii serotype 4 (strain Sb227) GN=lldD PE=3 SV=1 110 454 2.0E-30
sp|Q3YVX0|LLDD_SHISS L-lactate dehydrogenase OS=Shigella sonnei (strain Ss046) GN=lldD PE=3 SV=1 110 454 2.0E-30
sp|Q83PP7|LLDD_SHIFL L-lactate dehydrogenase OS=Shigella flexneri GN=lldD PE=3 SV=1 110 454 2.0E-30
sp|Q0SYD1|LLDD_SHIF8 L-lactate dehydrogenase OS=Shigella flexneri serotype 5b (strain 8401) GN=lldD PE=3 SV=1 110 454 2.0E-30
sp|B6I3I4|LLDD_ECOSE L-lactate dehydrogenase OS=Escherichia coli (strain SE11) GN=lldD PE=3 SV=1 110 454 2.0E-30
sp|B7M492|LLDD_ECO8A L-lactate dehydrogenase OS=Escherichia coli O8 (strain IAI1) GN=lldD PE=3 SV=1 110 454 2.0E-30
sp|B5YWA7|LLDD_ECO5E L-lactate dehydrogenase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=lldD PE=3 SV=1 110 454 2.0E-30
sp|Q8XDF7|LLDD_ECO57 L-lactate dehydrogenase OS=Escherichia coli O157:H7 GN=lldD PE=3 SV=1 110 454 2.0E-30
sp|B7L725|LLDD_ECO55 L-lactate dehydrogenase OS=Escherichia coli (strain 55989 / EAEC) GN=lldD PE=3 SV=1 110 454 2.0E-30
sp|A7ZTF9|LLDD_ECO24 L-lactate dehydrogenase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=lldD PE=3 SV=1 110 454 2.0E-30
sp|B1LK44|LLDD_ECOSM L-lactate dehydrogenase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=lldD PE=3 SV=1 110 454 2.0E-30
sp|P46454|LLDD_HAEIN L-lactate dehydrogenase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=lldD PE=3 SV=1 114 457 2.0E-30
sp|B1JPU0|LLDD_YERPY L-lactate dehydrogenase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=lldD PE=3 SV=1 110 454 2.0E-30
sp|Q66C32|LLDD_YERPS L-lactate dehydrogenase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=lldD PE=3 SV=1 110 454 2.0E-30
sp|A4TKI4|LLDD_YERPP L-lactate dehydrogenase OS=Yersinia pestis (strain Pestoides F) GN=lldD PE=3 SV=1 110 454 2.0E-30
sp|Q1CGZ1|LLDD_YERPN L-lactate dehydrogenase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=lldD PE=3 SV=1 110 454 2.0E-30
sp|A9R623|LLDD_YERPG L-lactate dehydrogenase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=lldD PE=3 SV=1 110 454 2.0E-30
sp|Q8ZFV8|LLDD_YERPE L-lactate dehydrogenase OS=Yersinia pestis GN=lldD PE=3 SV=1 110 454 2.0E-30
sp|B2JZQ1|LLDD_YERPB L-lactate dehydrogenase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=lldD PE=3 SV=1 110 454 2.0E-30
sp|Q1C9P0|LLDD_YERPA L-lactate dehydrogenase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=lldD PE=3 SV=1 110 454 2.0E-30
sp|A7FJF0|LLDD_YERP3 L-lactate dehydrogenase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=lldD PE=3 SV=1 110 454 2.0E-30
sp|B2U5C2|LLDD_SHIB3 L-lactate dehydrogenase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=lldD PE=3 SV=1 110 454 3.0E-30
sp|B7NER0|LLDD_ECOLU L-lactate dehydrogenase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=lldD PE=3 SV=1 110 454 3.0E-30
sp|P33232|LLDD_ECOLI L-lactate dehydrogenase OS=Escherichia coli (strain K12) GN=lldD PE=1 SV=1 110 454 3.0E-30
sp|B1IZI5|LLDD_ECOLC L-lactate dehydrogenase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=lldD PE=3 SV=1 110 454 3.0E-30
sp|A8A670|LLDD_ECOHS L-lactate dehydrogenase OS=Escherichia coli O9:H4 (strain HS) GN=lldD PE=3 SV=1 110 454 3.0E-30
sp|B1X8M0|LLDD_ECODH L-lactate dehydrogenase OS=Escherichia coli (strain K12 / DH10B) GN=lldD PE=3 SV=1 110 454 3.0E-30
sp|C4ZXJ7|LLDD_ECOBW L-lactate dehydrogenase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=lldD PE=3 SV=1 110 454 3.0E-30
sp|Q4QJK8|LLDD_HAEI8 L-lactate dehydrogenase OS=Haemophilus influenzae (strain 86-028NP) GN=lldD PE=3 SV=1 114 457 3.0E-30
sp|Q3BZH2|LLDD_XANC5 L-lactate dehydrogenase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=lldD PE=3 SV=1 110 470 3.0E-30
sp|Q8PE75|LLDD_XANCP L-lactate dehydrogenase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=lldD PE=3 SV=1 110 454 3.0E-30
sp|Q4V0H2|LLDD_XANC8 L-lactate dehydrogenase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=lldD PE=3 SV=1 110 454 3.0E-30
sp|C3LWP7|LLDD_VIBCM L-lactate dehydrogenase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=lldD PE=3 SV=1 110 454 3.0E-30
sp|Q9KKW6|LLDD_VIBCH L-lactate dehydrogenase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=lldD PE=3 SV=1 110 454 3.0E-30
sp|Q1R4Z0|LLDD_ECOUT L-lactate dehydrogenase OS=Escherichia coli (strain UTI89 / UPEC) GN=lldD PE=3 SV=1 110 454 6.0E-30
sp|B7MFG9|LLDD_ECO45 L-lactate dehydrogenase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=lldD PE=3 SV=1 110 454 6.0E-30
sp|Q329P9|LLDD_SHIDS L-lactate dehydrogenase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=lldD PE=3 SV=1 110 454 7.0E-30
sp|Q8PR33|LLDD_XANAC L-lactate dehydrogenase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=lldD PE=3 SV=1 110 467 7.0E-30
sp|A4XYG7|LLDD_PSEMY L-lactate dehydrogenase OS=Pseudomonas mendocina (strain ymp) GN=lldD PE=3 SV=1 110 463 8.0E-30
sp|A7IMB0|LLDD_XANP2 L-lactate dehydrogenase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=lldD PE=3 SV=1 114 466 1.0E-29
sp|Q8FCB1|LLDD_ECOL6 L-lactate dehydrogenase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=lldD PE=3 SV=1 110 454 1.0E-29
sp|Q0TBK1|LLDD_ECOL5 L-lactate dehydrogenase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=lldD PE=3 SV=1 110 454 1.0E-29
sp|B7NPB4|LLDD_ECO7I L-lactate dehydrogenase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=lldD PE=3 SV=1 110 454 1.0E-29
sp|Q4ZY06|LLDD_PSEU2 L-lactate dehydrogenase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=lldD PE=3 SV=1 110 459 1.0E-29
sp|B7N251|LLDD_ECO81 L-lactate dehydrogenase OS=Escherichia coli O81 (strain ED1a) GN=lldD PE=3 SV=1 110 454 1.0E-29
sp|A1AHE2|LLDD_ECOK1 L-lactate dehydrogenase OS=Escherichia coli O1:K1 / APEC GN=lldD PE=3 SV=1 110 454 1.0E-29
sp|C3K053|LLDD_PSEFS L-lactate dehydrogenase OS=Pseudomonas fluorescens (strain SBW25) GN=lldD PE=3 SV=2 110 454 2.0E-29
sp|Q5H6Z4|LLDD_XANOR L-lactate dehydrogenase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=lldD PE=3 SV=1 110 467 3.0E-29
sp|B2SUY3|LLDD_XANOP L-lactate dehydrogenase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=lldD PE=3 SV=1 110 467 3.0E-29
sp|Q2P9K0|LLDD_XANOM L-lactate dehydrogenase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=lldD PE=3 SV=1 110 467 3.0E-29
sp|C0Q1T7|LLDD_SALPC L-lactate dehydrogenase OS=Salmonella paratyphi C (strain RKS4594) GN=lldD PE=3 SV=1 110 454 4.0E-29
sp|B7LTL2|LLDD_ESCF3 L-lactate dehydrogenase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=lldD PE=3 SV=1 135 454 4.0E-29
sp|Q6G4R2|LLDD_BARHE L-lactate dehydrogenase OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=lldD PE=3 SV=1 114 471 5.0E-29
sp|A8ARJ1|LLDD_CITK8 L-lactate dehydrogenase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=lldD PE=3 SV=1 135 454 5.0E-29
sp|B0KIT4|LLDD_PSEPG L-lactate dehydrogenase OS=Pseudomonas putida (strain GB-1) GN=lldD PE=3 SV=1 110 454 5.0E-29
sp|B7ULG1|LLDD_ECO27 L-lactate dehydrogenase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=lldD PE=3 SV=1 110 454 7.0E-29
sp|B4T986|LLDD_SALHS L-lactate dehydrogenase OS=Salmonella heidelberg (strain SL476) GN=lldD PE=3 SV=1 110 454 7.0E-29
sp|Q7VPI9|LLDD_HAEDU L-lactate dehydrogenase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=lldD PE=3 SV=1 109 455 7.0E-29
sp|B5BHX7|LLDD_SALPK L-lactate dehydrogenase OS=Salmonella paratyphi A (strain AKU_12601) GN=lldD PE=3 SV=1 110 454 1.0E-28
sp|Q5PLQ7|LLDD_SALPA L-lactate dehydrogenase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=lldD PE=3 SV=1 110 454 1.0E-28
sp|B0VND0|LLDD_ACIBS L-lactate dehydrogenase OS=Acinetobacter baumannii (strain SDF) GN=lldD PE=3 SV=1 109 454 1.0E-28
sp|Q57ID8|LLDD_SALCH L-lactate dehydrogenase OS=Salmonella choleraesuis (strain SC-B67) GN=lldD PE=3 SV=1 110 454 2.0E-28
sp|B0V6L1|LLDD_ACIBY L-lactate dehydrogenase OS=Acinetobacter baumannii (strain AYE) GN=lldD PE=3 SV=1 109 454 2.0E-28
sp|A3M0X0|LLDD_ACIBT L-lactate dehydrogenase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=lldD PE=3 SV=2 109 454 2.0E-28
sp|B2I061|LLDD_ACIBC L-lactate dehydrogenase OS=Acinetobacter baumannii (strain ACICU) GN=lldD PE=3 SV=1 109 454 2.0E-28
sp|B7IBS4|LLDD_ACIB5 L-lactate dehydrogenase OS=Acinetobacter baumannii (strain AB0057) GN=lldD PE=3 SV=1 109 454 2.0E-28
sp|B7H2H0|LLDD_ACIB3 L-lactate dehydrogenase OS=Acinetobacter baumannii (strain AB307-0294) GN=lldD PE=3 SV=1 109 454 2.0E-28
sp|Q8ZL61|LLDD_SALTY L-lactate dehydrogenase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=lldD PE=3 SV=1 110 454 2.0E-28
sp|B5FLH2|LLDD_SALDC L-lactate dehydrogenase OS=Salmonella dublin (strain CT_02021853) GN=lldD PE=3 SV=1 110 454 2.0E-28
sp|B5EXA8|LLDD_SALA4 L-lactate dehydrogenase OS=Salmonella agona (strain SL483) GN=lldD PE=3 SV=1 110 454 2.0E-28
sp|B4TZU7|LLDD_SALSV L-lactate dehydrogenase OS=Salmonella schwarzengrund (strain CVM19633) GN=lldD PE=3 SV=1 110 454 2.0E-28
sp|A9MVJ5|LLDD_SALPB L-lactate dehydrogenase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=lldD PE=3 SV=1 110 454 3.0E-28
sp|A9MLC3|LLDD_SALAR L-lactate dehydrogenase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=lldD PE=3 SV=1 110 454 3.0E-28
sp|B5RGI4|LLDD_SALG2 L-lactate dehydrogenase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=lldD PE=3 SV=1 110 454 3.0E-28
sp|B5R5C7|LLDD_SALEP L-lactate dehydrogenase OS=Salmonella enteritidis PT4 (strain P125109) GN=lldD PE=3 SV=1 110 454 3.0E-28
sp|A4W540|LLDD_ENT38 L-lactate dehydrogenase OS=Enterobacter sp. (strain 638) GN=lldD PE=3 SV=1 110 454 4.0E-28
sp|B4SXA4|LLDD_SALNS L-lactate dehydrogenase OS=Salmonella newport (strain SL254) GN=lldD PE=3 SV=1 110 454 5.0E-28
sp|A7MNF6|LLDD_CROS8 L-lactate dehydrogenase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=lldD PE=3 SV=1 135 454 5.0E-28
sp|Q88DT3|LLDD_PSEPK L-lactate dehydrogenase OS=Pseudomonas putida (strain KT2440) GN=lldD PE=3 SV=1 110 454 6.0E-28
sp|A5W9B2|LLDD_PSEP1 L-lactate dehydrogenase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=lldD PE=3 SV=1 110 454 6.0E-28
sp|Q8Z2E5|LLDD_SALTI L-lactate dehydrogenase OS=Salmonella typhi GN=lldD PE=3 SV=1 110 454 1.0E-27
sp|Q9HDX2|YKN3_SCHPO Uncharacterized lactate 2-monooxygenase PB1A11.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB1A11.03 PE=3 SV=1 112 447 1.0E-27
sp|B1J244|LLDD_PSEPW L-lactate dehydrogenase OS=Pseudomonas putida (strain W619) GN=lldD PE=3 SV=1 110 454 1.0E-27
sp|B5XMV0|LLDD_KLEP3 L-lactate dehydrogenase OS=Klebsiella pneumoniae (strain 342) GN=lldD PE=3 SV=1 135 454 2.0E-27
sp|Q1IF69|LLDD_PSEE4 L-lactate dehydrogenase OS=Pseudomonas entomophila (strain L48) GN=lldD PE=3 SV=1 110 454 2.0E-27
sp|Q6FFS1|LLDD_ACIAD L-lactate dehydrogenase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=lldD PE=3 SV=1 109 455 4.0E-27
sp|A8HTC9|LLDD_AZOC5 L-lactate dehydrogenase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=lldD PE=3 SV=1 109 454 5.0E-27
sp|A6TFK0|LLDD_KLEP7 L-lactate dehydrogenase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=lldD PE=3 SV=1 135 454 5.0E-27
sp|Q9HV37|LLDD_PSEAE L-lactate dehydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=lldD PE=3 SV=1 110 454 9.0E-27
sp|B7V1I3|LLDD_PSEA8 L-lactate dehydrogenase OS=Pseudomonas aeruginosa (strain LESB58) GN=lldD PE=3 SV=1 110 454 9.0E-27
sp|Q02FQ1|LLDD_PSEAB L-lactate dehydrogenase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=lldD PE=3 SV=1 110 454 1.0E-26
sp|A6VCM8|LLDD_PSEA7 L-lactate dehydrogenase OS=Pseudomonas aeruginosa (strain PA7) GN=lldD PE=3 SV=1 110 454 3.0E-26
sp|P9WND7|MFTD_MYCTU Putative mycofactocin system heme/flavin oxidoreductase MftD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mftD PE=1 SV=1 115 456 8.0E-25
sp|P9WND6|MFTD_MYCTO Putative mycofactocin system heme/flavin oxidoreductase MftD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mftD PE=3 SV=1 115 456 8.0E-25
sp|A9IN89|LLDD_BART1 L-lactate dehydrogenase OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=lldD PE=3 SV=1 114 454 6.0E-24
sp|A8GIL1|LLDD_SERP5 L-lactate dehydrogenase OS=Serratia proteamaculans (strain 568) GN=lldD PE=3 SV=1 110 454 7.0E-24
sp|Q6G0J2|LLDD_BARQU L-lactate dehydrogenase OS=Bartonella quintana (strain Toulouse) GN=lldD PE=3 SV=1 114 454 2.0E-23
sp|Q9A943|LLDD_CAUCR L-lactate dehydrogenase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=lldD PE=3 SV=1 110 462 2.0E-23
sp|B8H3Q5|LLDD_CAUCN L-lactate dehydrogenase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=lldD PE=3 SV=1 110 462 2.0E-23
sp|B0T7X2|LLDD_CAUSK L-lactate dehydrogenase OS=Caulobacter sp. (strain K31) GN=lldD PE=3 SV=1 140 454 4.0E-20
sp|P49098|CYB5_TOBAC Cytochrome b5 OS=Nicotiana tabacum PE=2 SV=1 5 60 5.0E-13
sp|O04354|CYB5_BOROF Cytochrome b5 OS=Borago officinalis PE=2 SV=1 5 60 5.0E-13
sp|Q9V4N3|CYB5_DROME Cytochrome b5 OS=Drosophila melanogaster GN=Cyt-b5 PE=2 SV=1 9 60 2.0E-12
sp|P49100|CYB5_ORYSJ Cytochrome b5 OS=Oryza sativa subsp. japonica GN=Os05g0108800 PE=2 SV=2 10 60 3.0E-12
sp|Q9ZWT2|CYB5D_ARATH Cytochrome B5 isoform D OS=Arabidopsis thaliana GN=CYTB5-D PE=1 SV=1 5 60 3.0E-12
sp|P36841|NIA_VOLCA Nitrate reductase [NADH] OS=Volvox carteri GN=NITA PE=2 SV=1 10 101 3.0E-12
sp|P27783|NIA_BETPN Nitrate reductase [NAD(P)H] OS=Betula pendula GN=NIA1 PE=2 SV=1 5 139 4.0E-12
sp|P49099|CYB5S_TOBAC Cytochrome b5, seed isoform OS=Nicotiana tabacum PE=2 SV=1 5 60 4.0E-12
sp|P49096|CYB5_MUSDO Cytochrome b5 OS=Musca domestica GN=Cyt-b5 PE=1 SV=1 9 71 4.0E-12
sp|Q42342|CYB5E_ARATH Cytochrome b5 isoform E OS=Arabidopsis thaliana GN=CYTB5-E PE=1 SV=2 5 60 6.0E-12
sp|Q9FDW8|CYB5A_ARATH Cytochrome b5 isoform A OS=Arabidopsis thaliana GN=CB5-A PE=1 SV=1 10 58 9.0E-12
sp|O48845|CYB5B_ARATH Cytochrome b5 isoform B OS=Arabidopsis thaliana GN=CYTB5-B PE=1 SV=1 5 60 1.0E-11
sp|P49097|CYB5_CUSRE Cytochrome b5 OS=Cuscuta reflexa PE=2 SV=1 5 60 3.0E-11
sp|P40934|CYB5_BRAOB Cytochrome b5 OS=Brassica oleracea var. botrytis GN=CYB5 PE=1 SV=1 5 60 3.0E-11
sp|P04166|CYB5B_RAT Cytochrome b5 type B OS=Rattus norvegicus GN=Cyb5b PE=1 SV=2 10 67 3.0E-11
sp|P23312|NIA_SPIOL Nitrate reductase [NADH] OS=Spinacia oleracea GN=NIA PE=2 SV=1 9 61 4.0E-11
sp|P27969|NIA2_HORVU Nitrate reductase [NADH] (Fragment) OS=Hordeum vulgare PE=2 SV=1 3 61 4.0E-11
sp|Q28CZ9|NB5R4_XENTR Cytochrome b5 reductase 4 OS=Xenopus tropicalis GN=cyb5r4 PE=2 SV=1 10 78 5.0E-11
sp|P27967|NIA1_HORVU Nitrate reductase [NADH] OS=Hordeum vulgare PE=3 SV=1 3 61 5.0E-11
sp|P43101|NIA_CICIN Nitrate reductase [NADH] OS=Cichorium intybus GN=NIA PE=2 SV=1 4 61 7.0E-11
sp|P11035|NIA2_ARATH Nitrate reductase [NADH] 2 OS=Arabidopsis thaliana GN=NIA2 PE=1 SV=1 9 61 7.0E-11
sp|P39864|NIA_PHYIN Nitrate reductase [NADPH] OS=Phytophthora infestans GN=NIAA PE=3 SV=1 5 61 8.0E-11
sp|Q9CQX2|CYB5B_MOUSE Cytochrome b5 type B OS=Mus musculus GN=Cyb5b PE=1 SV=1 10 67 8.0E-11
sp|Q01170|NIA_CHLVU Nitrate reductase [NADH] (Fragment) OS=Chlorella vulgaris PE=2 SV=1 6 61 9.0E-11
sp|P17571|NIA1_MAIZE Nitrate reductase [NADH] (Fragment) OS=Zea mays PE=1 SV=2 6 61 1.0E-10
sp|P17569|NIA_CUCMA Nitrate reductase [NADH] OS=Cucurbita maxima PE=2 SV=1 9 61 2.0E-10
sp|Q9USM6|CYB52_SCHPO Probable cytochrome b5 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=oca8 PE=3 SV=1 1 60 2.0E-10
sp|P16081|NIA1_ORYSJ Nitrate reductase [NADH] 1 OS=Oryza sativa subsp. japonica GN=NIA1 PE=2 SV=3 6 61 2.0E-10
sp|Q9ZNV4|CYB5C_ARATH Cytochrome B5 isoform C OS=Arabidopsis thaliana GN=CYTB5-C PE=1 SV=1 10 71 2.0E-10
sp|P36859|NIA_PETHY Nitrate reductase [NADH] OS=Petunia hybrida GN=NIA PE=2 SV=1 2 61 3.0E-10
sp|P39869|NIA_LOTJA Nitrate reductase [NADH] OS=Lotus japonicus GN=NIA PE=3 SV=1 9 122 3.0E-10
sp|P11605|NIA1_TOBAC Nitrate reductase [NADH] 1 OS=Nicotiana tabacum GN=NIA1 PE=3 SV=1 2 95 3.0E-10
sp|P49102|NIA3_MAIZE Nitrate reductase [NADH] 3 OS=Zea mays PE=3 SV=1 6 61 4.0E-10
sp|P39867|NIA1_BRANA Nitrate reductase [NADH], clone PBNBR1405 OS=Brassica napus GN=NIA1 PE=2 SV=1 2 61 4.0E-10
sp|Q874I5|CYB5_CANTR Cytochrome b5 OS=Candida tropicalis GN=Cytb5 PE=3 SV=1 10 60 4.0E-10
sp|P39866|NIA2_PHAVU Nitrate reductase [NADH] 2 OS=Phaseolus vulgaris GN=NIA2 PE=3 SV=1 2 61 4.0E-10
sp|P27968|NIA7_HORVU Nitrate reductase [NAD(P)H] OS=Hordeum vulgare GN=NAR-7 PE=2 SV=1 2 61 5.0E-10
sp|P11832|NIA1_ARATH Nitrate reductase [NADH] 1 OS=Arabidopsis thaliana GN=NIA1 PE=1 SV=3 2 61 6.0E-10
sp|P39868|NIA2_BRANA Nitrate reductase [NADH], clone PBNBR1412 OS=Brassica napus GN=NIA2 PE=2 SV=1 9 61 6.0E-10
sp|Q9P5L0|CYB5_NEUCR Probable cytochrome b5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B23L21.190 PE=3 SV=2 10 72 6.0E-10
sp|Q9Y1W0|FAD5A_DICDI Delta(5) fatty acid desaturase A OS=Dictyostelium discoideum GN=fadA PE=1 SV=1 9 80 7.0E-10
sp|P17570|NIA_SOLLC Nitrate reductase [NADH] OS=Solanum lycopersicum GN=NIA PE=3 SV=1 2 61 7.0E-10
sp|P08509|NIA2_TOBAC Nitrate reductase [NADH] 2 OS=Nicotiana tabacum GN=NIA2 PE=2 SV=2 2 95 9.0E-10
sp|P39865|NIA1_PHAVU Nitrate reductase [NADH] 1 OS=Phaseolus vulgaris GN=NIA1 PE=3 SV=1 9 61 2.0E-09
sp|A9SIZ6|D5FAD_PHYPA Acyl-lipid (8-3)-desaturase OS=Physcomitrella patens subsp. patens GN=DES5 PE=1 SV=1 10 62 2.0E-09
sp|O43169|CYB5B_HUMAN Cytochrome b5 type B OS=Homo sapiens GN=CYB5B PE=1 SV=2 10 71 3.0E-09
sp|P00174|CYB5_CHICK Cytochrome b5 OS=Gallus gallus GN=CYB5A PE=1 SV=4 10 60 3.0E-09
sp|Q5RDJ5|CYB5B_PONAB Cytochrome b5 type B OS=Pongo abelii GN=CYB5B PE=2 SV=2 7 71 3.0E-09
sp|Q9FR82|SLD1_BOROF Delta(8)-fatty-acid desaturase OS=Borago officinalis GN=sld1 PE=1 SV=1 6 94 3.0E-09
sp|Q8X0J4|CYB5L_NEUCR Putative cytochrome b5 B11H24.095 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B11H24.095 PE=3 SV=1 9 68 3.0E-09
sp|P00172|CYB5_PIG Cytochrome b5 OS=Sus scrofa GN=CYB5A PE=1 SV=3 10 60 4.0E-09
sp|P39870|NIA2_SOYBN Inducible nitrate reductase [NADH] 2 OS=Glycine max GN=INR2 PE=2 SV=1 9 123 4.0E-09
sp|Q10352|YDAA_SCHPO Uncharacterized protein C1F12.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1F12.10c PE=3 SV=1 10 54 5.0E-09
sp|P00171|CYB5_BOVIN Cytochrome b5 OS=Bos taurus GN=CYB5A PE=1 SV=3 10 60 6.0E-09
sp|P00169|CYB5_RABIT Cytochrome b5 OS=Oryctolagus cuniculus GN=CYB5A PE=1 SV=4 10 60 8.0E-09
sp|P00168|CYB5_ALOSE Cytochrome b5 (Fragment) OS=Alouatta seniculus GN=CYB5A PE=1 SV=2 10 60 8.0E-09
sp|P54233|NIA1_SOYBN Inducible nitrate reductase [NADH] 1 OS=Glycine max GN=INR1 PE=2 SV=1 9 61 9.0E-09
sp|P49050|NIA_PICAN Nitrate reductase [NADPH] OS=Pichia angusta GN=YNR1 PE=1 SV=1 3 102 1.0E-08
sp|Q502I6|NB5R4_DANRE Cytochrome b5 reductase 4 OS=Danio rerio GN=cyb5r4 PE=2 SV=1 10 78 1.0E-08
sp|Q32LH7|NB5R4_BOVIN Cytochrome b5 reductase 4 OS=Bos taurus GN=CYB5R4 PE=2 SV=1 10 78 1.0E-08
sp|P00167|CYB5_HUMAN Cytochrome b5 OS=Homo sapiens GN=CYB5A PE=1 SV=2 10 60 1.0E-08
sp|Q3TDX8|NB5R4_MOUSE Cytochrome b5 reductase 4 OS=Mus musculus GN=Cyb5r4 PE=2 SV=3 10 85 1.0E-08
sp|Q1ZXQ5|FAD5C_DICDI Probable Delta(5) fatty acid desaturase C OS=Dictyostelium discoideum GN=DDB_G0294553 PE=3 SV=1 10 78 1.0E-08
sp|P00170|CYB5_HORSE Cytochrome b5 OS=Equus caballus GN=CYB5A PE=1 SV=3 10 60 1.0E-08
sp|Q9HFV1|CYB5_RHIST Cytochrome b5 OS=Rhizopus stolonifer PE=2 SV=1 1 60 1.0E-08
sp|O96099|FAD5B_DICDI Acyl-lipid (8-3)-desaturase B OS=Dictyostelium discoideum GN=fadB PE=1 SV=1 10 77 2.0E-08
sp|Q7L1T6|NB5R4_HUMAN Cytochrome b5 reductase 4 OS=Homo sapiens GN=CYB5R4 PE=1 SV=1 10 117 2.0E-08
sp|Q9Y706|CYB5_MORAP Cytochrome b5 OS=Mortierella alpina PE=1 SV=1 9 60 2.0E-08
sp|P40312|CYB5_YEAST Cytochrome b5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CYB5 PE=1 SV=2 10 108 2.0E-08
sp|P00173|CYB5_RAT Cytochrome b5 OS=Rattus norvegicus GN=Cyb5a PE=1 SV=2 10 60 2.0E-08
sp|Q3EBF7|SLD2_ARATH Delta(8)-fatty-acid desaturase 2 OS=Arabidopsis thaliana GN=SLD2 PE=1 SV=1 1 71 3.0E-08
sp|P56395|CYB5_MOUSE Cytochrome b5 OS=Mus musculus GN=Cyb5a PE=1 SV=2 10 60 3.0E-08
sp|Q68EJ0|NB5R4_RAT Cytochrome b5 reductase 4 OS=Rattus norvegicus GN=Cyb5r4 PE=1 SV=2 10 85 4.0E-08
sp|Q9ZRP7|SLD1_ARATH Delta(8)-fatty-acid desaturase 1 OS=Arabidopsis thaliana GN=SLD1 PE=1 SV=1 10 70 4.0E-08
sp|O22704|CYP5F_ARATH Cytochrome B5-like protein OS=Arabidopsis thaliana GN=CB5LP PE=2 SV=1 9 61 4.0E-08
sp|O94391|CYB51_SCHPO Probable cytochrome b5 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC29A10.16c PE=3 SV=1 10 60 1.0E-07
sp|O74875|YJ83_SCHPO Uncharacterized heme-binding protein C330.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC330.03c PE=1 SV=1 4 71 2.0E-07
sp|Q9LXD1|RLF_ARATH Cytochrome b5 domain-containing protein RLF OS=Arabidopsis thaliana GN=RLF PE=2 SV=1 10 61 3.0E-07
sp|P82291|CYB5_ECTSH Soluble cytochrome b558 OS=Ectothiorhodospira shaposhnikovii PE=1 SV=2 5 58 3.0E-07
sp|Q8S3C0|D4FAD_THRSP Acyl-lipid (7-3)-desaturase OS=Thraustochytrium sp. GN=Fad4 PE=1 SV=1 10 88 3.0E-07
sp|Q43469|SLD1_HELAN Delta(8)-fatty-acid desaturase OS=Helianthus annuus GN=sld1 PE=1 SV=1 6 70 4.0E-07
sp|Q6DDK2|FADS2_XENLA Fatty acid desaturase 2 OS=Xenopus laevis GN=fads2 PE=2 SV=1 10 93 4.0E-07
sp|P39863|NIA_FUSOX Nitrate reductase [NADPH] OS=Fusarium oxysporum GN=NIA PE=3 SV=1 10 86 7.0E-07
sp|P22945|NIA_EMENI Nitrate reductase [NADPH] OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=niaD PE=3 SV=1 5 80 1.0E-06
sp|Q05531|NIA_USTMA Nitrate reductase [NADPH] OS=Ustilago maydis (strain 521 / FGSC 9021) GN=NAR1 PE=2 SV=2 2 61 2.0E-06
sp|Q4R749|FADS2_MACFA Fatty acid desaturase 2 OS=Macaca fascicularis GN=FADS2 PE=2 SV=1 10 62 2.0E-06
sp|P08619|NIA_NEUCR Nitrate reductase [NADPH] OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nit-3 PE=1 SV=3 5 61 2.0E-06
sp|O74212|D5FAD_MORAP Acyl-lipid (8-3)-desaturase OS=Mortierella alpina GN=DES1 PE=1 SV=1 10 71 3.0E-06
sp|P36842|NIA_LEPMC Nitrate reductase [NADPH] OS=Leptosphaeria maculans GN=NIAD PE=3 SV=2 5 61 4.0E-06
sp|Q03529|SCS7_YEAST Ceramide very long chain fatty acid hydroxylase SCS7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCS7 PE=1 SV=1 5 55 6.0E-06
sp|Q5REA7|FADS2_PONAB Fatty acid desaturase 2 OS=Pongo abelii GN=FADS2 PE=2 SV=1 10 62 6.0E-06
sp|O95864|FADS2_HUMAN Fatty acid desaturase 2 OS=Homo sapiens GN=FADS2 PE=1 SV=1 10 62 6.0E-06
sp|P43100|NIA_BEABA Nitrate reductase [NADPH] OS=Beauveria bassiana GN=NIA PE=3 SV=1 5 101 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0015930 glutamate synthase activity Yes
GO:0016638 oxidoreductase activity, acting on the CH-NH2 group of donors Yes
GO:0016491 oxidoreductase activity Yes
GO:0006537 glutamate biosynthetic process Yes
GO:0009064 glutamine family amino acid metabolic process No
GO:0006082 organic acid metabolic process No
GO:0009084 glutamine family amino acid biosynthetic process No
GO:0006536 glutamate metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0044283 small molecule biosynthetic process No
GO:0043436 oxoacid metabolic process No
GO:0019752 carboxylic acid metabolic process No
GO:0008152 metabolic process No
GO:0009058 biosynthetic process No
GO:0009987 cellular process No
GO:0003824 catalytic activity No
GO:0043648 dicarboxylic acid metabolic process No
GO:0044238 primary metabolic process No
GO:0044237 cellular metabolic process No
GO:0046394 carboxylic acid biosynthetic process No
GO:0016053 organic acid biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0003674 molecular_function No
GO:0006520 cellular amino acid metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0008150 biological_process No
GO:0043650 dicarboxylic acid biosynthetic process No
GO:0044281 small molecule metabolic process No
GO:1901607 alpha-amino acid biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:1901605 alpha-amino acid metabolic process No
GO:0008652 cellular amino acid biosynthetic process No
GO:0006807 nitrogen compound metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2509
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3960
Ophiocordyceps australis map64 (Brazil) OphauB2|517
Ophiocordyceps camponoti-floridani Ophcf2|07261
Ophiocordyceps camponoti-rufipedis Ophun1|7438 (this protein)
Ophiocordyceps kimflemingae Ophio5|1886
Ophiocordyceps subramaniannii Hirsu2|3667

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7438
MADVVLKAAEVAKHNTRESCWVVLYGNVYDVTDFLSSHPGGASIILKLAGRDATDEYDPVHPPGTLEENLKPEAR
LGRYDGEGAVVDKVEQKDHGGGEEVPLTSLLNLDEIEAAATKRISKRAWAYYYSASDDMYSKRLNSTVYRDILLR
PRVLVDCTDCDMSTSVLGHGIGLPVFIAPAAMARLAHADGERGMARAAARFGAMQIISNNASMTPEQIVEGAPEG
QVFGWQLYVQNRREKSEAMLKRIEAMGSRFKFICLTLDAPVPGKREDDERCGLERGVGGGGGGGQPSEAKGGVGK
QLFHGTASDLTWATTLPWLARHTKLPIVLKGLQTHEDARLAAQHAPQVQAVILSNHGGRALDTAPPAVHTLLEIR
RYCPEVLGRIEVWVDGGIRRGTDVVKALCLGATAVGLGRGPLFGLGAGGQAGVERMFEILEAETATCMRLLGARK
ISELGPHLINSRRVERDVYERARL*
Coding >Ophun1|7438
ATGGCAGACGTCGTCTTGAAAGCGGCCGAAGTGGCCAAGCACAACACGCGCGAGAGCTGCTGGGTCGTGCTCTAC
GGAAATGTCTACGACGTGACCGACTTTCTGTCTTCGCATCCGGGCGGGGCCAGCATCATCCTGAAGCTTGCGGGG
CGAGACGCTACGGACGAGTATGACCCTGTTCATCCACCGGGGACGCTCGAGGAGAATCTCAAGCCTGAGGCGAGG
TTGGGGCGGTACGATGGAGAGGGTGCTGTGGTGGACAAGGTCGAGCAGAAGGATCATGGTGGTGGTGAGGAGGTG
CCTCTGACGTCGTTGCTCAACCTCGACGAGATTGAGGCGGCGGCTACCAAGCGCATCTCCAAGCGGGCGTGGGCC
TATTACTACTCTGCCAGCGACGACATGTACTCGAAGCGACTCAACAGCACCGTCTACCGCGACATCCTGCTGCGG
CCGCGCGTGCTGGTCGACTGTACCGACTGCGACATGTCGACGTCGGTGCTCGGGCACGGCATCGGACTGCCGGTG
TTTATTGCGCCGGCTGCCATGGCGAGGCTGGCGCATGCAGACGGGGAGAGGGGGATGGCCCGGGCGGCGGCCCGC
TTCGGCGCCATGCAGATCATCTCTAATAATGCTTCCATGACGCCGGAGCAGATCGTCGAGGGGGCGCCCGAGGGG
CAGGTCTTTGGTTGGCAGCTCTATGTGCAGAACAGACGGGAGAAGAGCGAGGCCATGTTGAAGCGCATCGAGGCC
ATGGGTTCGCGCTTCAAGTTCATCTGCCTGACGCTCGATGCGCCGGTTCCGGGCAAGAGGGAGGACGACGAGAGA
TGTGGGCTGGAACGGGGTGTTGGTGGTGGTGGTGGTGGTGGTCAGCCTTCTGAAGCGAAGGGCGGCGTCGGGAAG
CAGCTCTTTCACGGAACGGCATCGGATCTGACGTGGGCGACGACGCTGCCCTGGCTCGCGCGTCACACCAAGCTC
CCCATCGTGCTCAAGGGCCTTCAGACGCACGAAGATGCCCGGCTGGCGGCTCAGCACGCGCCCCAAGTGCAGGCC
GTCATCCTCTCCAACCACGGGGGCCGAGCGCTGGACACGGCGCCGCCGGCGGTGCACACGCTGCTGGAGATTCGG
CGGTACTGCCCCGAGGTTCTGGGCCGGATCGAGGTCTGGGTCGACGGCGGCATCAGGCGAGGCACCGACGTTGTT
AAGGCTTTGTGCCTCGGCGCCACGGCGGTCGGACTCGGAAGGGGGCCCCTTTTCGGGCTTGGGGCCGGGGGTCAG
GCCGGGGTAGAGCGCATGTTTGAGATCCTCGAGGCGGAGACGGCTACTTGCATGCGTCTACTTGGAGCCCGTAAG
ATTTCCGAACTGGGACCGCATCTGATAAACAGCCGGCGAGTGGAGAGGGACGTTTACGAGCGGGCGAGGCTGTGA
Transcript >Ophun1|7438
ATGGCAGACGTCGTCTTGAAAGCGGCCGAAGTGGCCAAGCACAACACGCGCGAGAGCTGCTGGGTCGTGCTCTAC
GGAAATGTCTACGACGTGACCGACTTTCTGTCTTCGCATCCGGGCGGGGCCAGCATCATCCTGAAGCTTGCGGGG
CGAGACGCTACGGACGAGTATGACCCTGTTCATCCACCGGGGACGCTCGAGGAGAATCTCAAGCCTGAGGCGAGG
TTGGGGCGGTACGATGGAGAGGGTGCTGTGGTGGACAAGGTCGAGCAGAAGGATCATGGTGGTGGTGAGGAGGTG
CCTCTGACGTCGTTGCTCAACCTCGACGAGATTGAGGCGGCGGCTACCAAGCGCATCTCCAAGCGGGCGTGGGCC
TATTACTACTCTGCCAGCGACGACATGTACTCGAAGCGACTCAACAGCACCGTCTACCGCGACATCCTGCTGCGG
CCGCGCGTGCTGGTCGACTGTACCGACTGCGACATGTCGACGTCGGTGCTCGGGCACGGCATCGGACTGCCGGTG
TTTATTGCGCCGGCTGCCATGGCGAGGCTGGCGCATGCAGACGGGGAGAGGGGGATGGCCCGGGCGGCGGCCCGC
TTCGGCGCCATGCAGATCATCTCTAATAATGCTTCCATGACGCCGGAGCAGATCGTCGAGGGGGCGCCCGAGGGG
CAGGTCTTTGGTTGGCAGCTCTATGTGCAGAACAGACGGGAGAAGAGCGAGGCCATGTTGAAGCGCATCGAGGCC
ATGGGTTCGCGCTTCAAGTTCATCTGCCTGACGCTCGATGCGCCGGTTCCGGGCAAGAGGGAGGACGACGAGAGA
TGTGGGCTGGAACGGGGTGTTGGTGGTGGTGGTGGTGGTGGTCAGCCTTCTGAAGCGAAGGGCGGCGTCGGGAAG
CAGCTCTTTCACGGAACGGCATCGGATCTGACGTGGGCGACGACGCTGCCCTGGCTCGCGCGTCACACCAAGCTC
CCCATCGTGCTCAAGGGCCTTCAGACGCACGAAGATGCCCGGCTGGCGGCTCAGCACGCGCCCCAAGTGCAGGCC
GTCATCCTCTCCAACCACGGGGGCCGAGCGCTGGACACGGCGCCGCCGGCGGTGCACACGCTGCTGGAGATTCGG
CGGTACTGCCCCGAGGTTCTGGGCCGGATCGAGGTCTGGGTCGACGGCGGCATCAGGCGAGGCACCGACGTTGTT
AAGGCTTTGTGCCTCGGCGCCACGGCGGTCGGACTCGGAAGGGGGCCCCTTTTCGGGCTTGGGGCCGGGGGTCAG
GCCGGGGTAGAGCGCATGTTTGAGATCCTCGAGGCGGAGACGGCTACTTGCATGCGTCTACTTGGAGCCCGTAAG
ATTTCCGAACTGGGACCGCATCTGATAAACAGCCGGCGAGTGGAGAGGGACGTTTACGAGCGGGCGAGGCTGTGA
Gene >Ophun1|7438
ATGGCAGACGTCGTCTTGAAAGCGGCCGAAGGTGAGCGTACTTCCCTCTCGGGTTATGTGAAGCAGCGGGCTGAG
ACGATGCAGTGGCCAAGCACAACACGCGCGAGAGCTGCTGGGTCGTGCTCTACGGAAATGTCTACGACGTGACCG
ACTTTCTGTCTTCGCATCCGGGCGGGGCCAGCATCATCCTGAAGCTTGCGGGGCGAGACGCTACGGACGAGTATG
ACCCTGTTCATCCACCGGGGACGCTCGAGGAGAATCTCAAGCCTGAGGCGAGGTTGGGGCGGTACGATGGAGAGG
GTGCTGTGGTGGACAAGGTCGAGCAGAAGGATCATGGTGGTGGTGAGGAGGTGCCTCTGACGTCGTTGCTCAACC
TCGACGAGATTGAGGCGGCGGCTACCAAGCGCATCTCCAAGCGGGCGTGGGCCTATTACTACTCTGCCAGCGACG
ACATGTACTCGAAGCGACTCAACAGCACCGTCTACCGCGACATCCTGCTGCGGCCGCGCGTGCTGGTCGACTGTA
CCGACTGCGACATGTCGACGTCGGTGCTCGGGCACGGCATCGGACTGCCGGTGTTTATTGCGCCGGCTGCCATGG
CGAGGCTGGCGCATGCAGACGGGGAGAGGGGGATGGCCCGGGCGGCGGCCCGCTTCGGCGCCATGCAGATCATCT
CTAATAATGCTTCCATGACGCCGGAGCAGATCGTCGAGGGGGCGCCCGAGGGGCAGGTCTTTGGTTGGCAGCTCT
ATGTGCAGAACAGACGGGAGAAGAGCGAGGCCATGTTGAAGCGCATCGAGGCCATGGGTTCGCGCTTCAAGTTCA
TCTGCCTGACGCTCGATGCGCCGGTTCCGGGCAAGAGGGAGGACGACGAGAGATGTGGGCTGGAACGGGGTGTTG
GTGGTGGTGGTGGTGGTGGTCAGCCTTCTGAAGCGAAGGGCGGCGTCGGGAAGCAGCTCTTTCACGGAACGGCAT
CGGATCTGACGTGGGCGACGACGCTGCCCTGGCTCGCGCGTCACACCAAGCTCCCCATCGTGCTCAAGGGCCTTC
AGACGCACGAAGATGCCCGGCTGGCGGCTCAGCACGCGCCCCAAGTGCAGGCCGTCATCCTCTCCAACCACGGGG
GCCGAGCGCTGGACACGGCGCCGCCGGCGGTGCACACGCTGCTGGAGATTCGGCGGTACTGCCCCGAGGTTCTGG
GCCGGATCGAGGTCTGGGTCGACGGCGGCATCAGGCGAGGCACCGACGTTGTTAAGGCTTTGTGCCTCGGCGCCA
CGGCGGTCGGACTCGGAAGGGGGCCCCTTTTCGGGCTTGGGGCCGGGGGTCAGGCCGGGGTAGAGCGCATGTTTG
AGAGTGAGTCGGTTGGAGGCAAAAGGAAGCAAGCAACTAACTAAACATTGATCAGTCCTCGAGGCGGAGACGGCT
ACTTGCATGCGTCTACTTGGAGCCCGTAAGATTTCCGAACTGGGACCGCATCTGGTACGTTTCTGGCCATTCACC
GACCAAGAATGATGACAACTGACGTTTCATTTCATCAGATAAACAGCCGGCGAGTGGAGAGGGACGTTTACGAGC
GGGCGAGGCTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail