Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7437
Gene name
LocationContig_934:1268..3819
Strand-
Gene length (bp)2551
Transcript length (bp)2493
Coding sequence length (bp)2493
Protein length (aa) 831

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00069 Pkinase Protein kinase domain 1.6E-09 288 421
PF07714 PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase 9.7E-08 304 473

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9CAD5|YODA_ARATH Mitogen-activated protein kinase kinase kinase YODA OS=Arabidopsis thaliana GN=YDA PE=1 SV=1 297 515 7.0E-09
sp|Q61846|MELK_MOUSE Maternal embryonic leucine zipper kinase OS=Mus musculus GN=Melk PE=1 SV=2 317 515 3.0E-08
sp|Q9SIT1|TMK3_ARATH Receptor-like kinase TMK3 OS=Arabidopsis thaliana GN=TMK3 PE=2 SV=1 249 474 4.0E-08
sp|Q91821|MELK_XENLA Maternal embryonic leucine zipper kinase OS=Xenopus laevis GN=melk PE=1 SV=2 317 516 1.0E-07
sp|Q14680|MELK_HUMAN Maternal embryonic leucine zipper kinase OS=Homo sapiens GN=MELK PE=1 SV=3 317 515 2.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9CAD5|YODA_ARATH Mitogen-activated protein kinase kinase kinase YODA OS=Arabidopsis thaliana GN=YDA PE=1 SV=1 297 515 7.0E-09
sp|Q61846|MELK_MOUSE Maternal embryonic leucine zipper kinase OS=Mus musculus GN=Melk PE=1 SV=2 317 515 3.0E-08
sp|Q9SIT1|TMK3_ARATH Receptor-like kinase TMK3 OS=Arabidopsis thaliana GN=TMK3 PE=2 SV=1 249 474 4.0E-08
sp|Q91821|MELK_XENLA Maternal embryonic leucine zipper kinase OS=Xenopus laevis GN=melk PE=1 SV=2 317 516 1.0E-07
sp|Q14680|MELK_HUMAN Maternal embryonic leucine zipper kinase OS=Homo sapiens GN=MELK PE=1 SV=3 317 515 2.0E-07
sp|Q28GW8|MELK_XENTR Maternal embryonic leucine zipper kinase OS=Xenopus tropicalis GN=melk PE=2 SV=1 317 515 2.0E-07
sp|F1QGZ6|MELK_DANRE Maternal embryonic leucine zipper kinase OS=Danio rerio GN=melk PE=2 SV=1 294 515 4.0E-07
sp|Q41328|PTI1_SOLLC Pto-interacting protein 1 OS=Solanum lycopersicum GN=PTI1 PE=1 SV=2 301 466 4.0E-07
sp|O49339|PTI12_ARATH PTI1-like tyrosine-protein kinase 2 OS=Arabidopsis thaliana GN=PTI12 PE=1 SV=1 270 466 6.0E-07
sp|Q23356|MIG15_CAEEL Serine/threonine-protein kinase mig-15 OS=Caenorhabditis elegans GN=mig-15 PE=2 SV=3 288 473 9.0E-07
sp|Q8H1G6|PTI11_ARATH PTI1-like tyrosine-protein kinase 1 OS=Arabidopsis thaliana GN=PTI11 PE=1 SV=1 256 466 9.0E-07
sp|C0LGL4|Y2289_ARATH Probable LRR receptor-like serine/threonine-protein kinase At2g28960 OS=Arabidopsis thaliana GN=At2g28960 PE=2 SV=1 288 463 2.0E-06
sp|P43298|TMK1_ARATH Receptor protein kinase TMK1 OS=Arabidopsis thaliana GN=TMK1 PE=1 SV=1 248 474 4.0E-06
sp|Q0VBZ0|CSK_BOVIN Tyrosine-protein kinase CSK OS=Bos taurus GN=CSK PE=2 SV=1 297 464 6.0E-06
sp|P41239|CSK_CHICK Tyrosine-protein kinase CSK OS=Gallus gallus GN=CSK PE=2 SV=1 297 464 8.0E-06
sp|P32577|CSK_RAT Tyrosine-protein kinase CSK OS=Rattus norvegicus GN=Csk PE=1 SV=1 297 464 9.0E-06
sp|P41241|CSK_MOUSE Tyrosine-protein kinase CSK OS=Mus musculus GN=Csk PE=1 SV=2 297 464 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004672 protein kinase activity Yes
GO:0006468 protein phosphorylation Yes
GO:0008152 metabolic process No
GO:0019538 protein metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0043170 macromolecule metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0032559 adenyl ribonucleotide binding No
GO:0016740 transferase activity No
GO:0016301 kinase activity No
GO:0006796 phosphate-containing compound metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0009987 cellular process No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:1901363 heterocyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:0044237 cellular metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0000166 nucleotide binding No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0006793 phosphorus metabolic process No
GO:0016310 phosphorylation No
GO:0036211 protein modification process No
GO:0043167 ion binding No
GO:0043412 macromolecule modification No
GO:0017076 purine nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7437
MTDETDHVKPALWRRILGKPGVTPLPPPVLSVPALSTPALSTPATSTPALSPPALSPPPNAESKLPARKVVTGLP
RAQTFKRQQSEQRVHLSPITTSLDERRAASADRRDDAASLSALSLGYDLDDNREDGLATDAQSVTTSQHDAMIND
ELESTWILNLSMHFRDRSRREKFFVTYREKANVWRRVTISLDYRLATPNSLEDDLVNTQYQREKSAKIYEAIRES
LLDIKFYDTVTNLKLETTNGRLHVHVVEDGNEIINYPLVKQVRHLSCKRVRERDITFDSHMSGFVYKVRVDGEML
IKKEIPSQDTVDEFLYEVNALSSLRFSRHIVTFYGVVVDDTEQRVKGLLISYASRGALIDIIYDHGKAGGGGRRL
PWSSKEKWARQMVQGLADIHESGFVQGDFTLSNIVIDDADDAKIIDINRRGCPLGWEPPEATALLELGHRISMYI
GVKSDLYQLGMVLWGLAMDEDEPEALGRPLLFDGGADEVPDWYRHMTEICLDADPRMRLQASTLLQFFPKHYEAI
SVDDGTSLSAYLVDGFQADGRPLMRSWPCSGRTYVDTPYDVSFPTRGRSPPSLLPSDLDLRETSRDALSKTSWLA
NRTVRPSYTDIDDAMSEAASLRHDETLRHEETPTPTACRHGHEAAAAKHDDDDGGFRAERASVTETNTADETAPD
VSRAGGSQADGDTADVVRSAIFRETRAGSDDGAEMKGGPDPEPKQEGTATTTMDGPRPSCHQQESDDAEEPEYVA
AQQMASGLHDWTTTTTTSLPLSLTGVGAAHIDIDEERMREKSILDDDDDDDVDDDFGALMRPATVPVLMTMTVTD
RSGRS*
Coding >Ophun1|7437
ATGACGGACGAGACGGATCATGTGAAGCCGGCTCTCTGGCGTCGCATCTTGGGCAAGCCCGGTGTCACGCCGCTT
CCGCCTCCGGTTCTTTCCGTTCCGGCTCTCTCCACTCCGGCCCTCTCCACTCCGGCCACCTCCACTCCGGCCCTC
TCCCCTCCGGCCCTCTCCCCTCCTCCAAACGCAGAGTCCAAGCTCCCGGCTAGAAAAGTGGTCACCGGCCTGCCC
CGGGCCCAGACGTTCAAGAGGCAGCAGTCGGAGCAGCGCGTCCATCTATCGCCCATCACCACCTCTCTCGATGAA
CGGAGAGCAGCCTCTGCCGATAGACGCGACGATGCAGCAAGTCTATCCGCCCTTTCTCTCGGCTACGACCTCGAC
GACAACAGGGAAGATGGCCTCGCCACAGACGCCCAGTCCGTCACAACATCCCAGCACGACGCCATGATCAACGAC
GAGCTCGAGTCGACGTGGATCCTCAACCTCAGCATGCACTTCCGCGACCGATCCAGAAGGGAAAAGTTCTTCGTC
ACCTATCGAGAAAAGGCAAACGTCTGGCGTCGCGTCACCATCTCTCTCGATTATCGGCTCGCTACGCCCAACTCG
TTGGAGGATGACCTCGTCAACACGCAGTACCAGCGCGAGAAGAGCGCAAAGATTTACGAGGCTATTCGCGAGAGC
CTCCTCGATATCAAGTTTTACGATACCGTCACTAACCTCAAGCTCGAAACTACCAACGGTCGTCTTCACGTGCAT
GTTGTCGAGGATGGCAATGAAATCATCAACTATCCCCTCGTGAAACAGGTTCGACACTTGAGCTGCAAGCGAGTT
CGCGAGCGGGACATTACCTTTGACTCTCACATGTCGGGCTTCGTCTACAAGGTGCGCGTCGACGGCGAGATGCTC
ATCAAGAAGGAGATTCCCAGCCAAGACACCGTCGACGAGTTTCTGTACGAGGTCAACGCCCTCAGCAGCCTGCGC
TTCTCCCGCCACATCGTCACCTTTTACGGCGTCGTCGTCGATGACACGGAGCAGCGCGTCAAGGGCCTGCTGATA
AGCTACGCTTCGCGAGGCGCCCTCATCGACATCATCTACGATCACGGCAAGGCTGGCGGCGGTGGTAGAAGATTG
CCGTGGTCCAGCAAGGAGAAGTGGGCGCGGCAGATGGTTCAGGGTCTGGCCGATATACACGAGTCGGGATTCGTT
CAGGGAGACTTTACCCTGTCCAACATTGTCATCGACGACGCAGACGACGCCAAGATCATCGACATCAACAGGAGG
GGATGTCCTCTCGGATGGGAGCCCCCCGAGGCGACGGCGCTGCTGGAGCTGGGTCACCGGATATCCATGTACATA
GGCGTCAAGTCGGACCTCTACCAGCTGGGAATGGTTCTCTGGGGCCTGGCCATGGACGAGGATGAGCCCGAGGCG
CTCGGCCGGCCTCTACTGTTCGATGGCGGCGCAGACGAGGTGCCCGACTGGTACCGACACATGACGGAGATTTGC
CTCGACGCCGATCCCAGGATGCGCTTACAGGCGTCGACGCTGCTGCAGTTCTTCCCCAAGCACTACGAGGCCATC
TCGGTCGACGACGGCACCTCGCTGAGCGCCTATCTCGTCGACGGCTTCCAGGCCGATGGCCGGCCACTGATGCGG
TCGTGGCCCTGTTCGGGAAGAACGTACGTCGACACGCCCTACGACGTCTCCTTTCCGACGCGAGGCCGATCGCCG
CCGAGTCTGCTGCCGAGTGACCTCGACCTGCGCGAGACGTCACGAGACGCGCTGAGCAAGACGTCGTGGCTCGCC
AACCGGACGGTGAGGCCTTCGTACACGGACATTGACGACGCCATGTCGGAAGCCGCTTCGCTGCGGCACGACGAG
ACGCTCAGGCATGAAGAGACGCCGACGCCGACGGCCTGCAGGCACGGTCACGAGGCAGCGGCTGCCAAGCACGAC
GACGACGATGGCGGCTTCAGGGCAGAGCGGGCGTCTGTTACGGAGACGAATACAGCTGACGAGACGGCACCCGAC
GTGTCACGGGCCGGGGGTTCGCAGGCGGATGGTGACACGGCAGACGTCGTACGCAGTGCCATCTTCCGAGAGACG
AGGGCGGGCTCCGATGACGGGGCTGAGATGAAGGGGGGTCCGGATCCGGAGCCGAAGCAGGAGGGCACTGCTACC
ACGACGATGGACGGGCCACGTCCATCTTGTCACCAGCAGGAAAGCGACGACGCAGAGGAGCCCGAGTACGTGGCG
GCGCAGCAGATGGCCAGCGGGTTGCACGACTGGACGACGACGACGACGACGTCACTGCCCTTGTCGCTGACGGGG
GTGGGAGCTGCGCACATAGACATTGACGAGGAGAGGATGCGAGAGAAGAGTATTCTGGATGACGATGATGATGAT
GATGTTGATGATGACTTTGGCGCCCTGATGCGGCCGGCGACGGTCCCGGTGTTGATGACGATGACGGTGACGGAC
AGAAGCGGGCGGTCATGA
Transcript >Ophun1|7437
ATGACGGACGAGACGGATCATGTGAAGCCGGCTCTCTGGCGTCGCATCTTGGGCAAGCCCGGTGTCACGCCGCTT
CCGCCTCCGGTTCTTTCCGTTCCGGCTCTCTCCACTCCGGCCCTCTCCACTCCGGCCACCTCCACTCCGGCCCTC
TCCCCTCCGGCCCTCTCCCCTCCTCCAAACGCAGAGTCCAAGCTCCCGGCTAGAAAAGTGGTCACCGGCCTGCCC
CGGGCCCAGACGTTCAAGAGGCAGCAGTCGGAGCAGCGCGTCCATCTATCGCCCATCACCACCTCTCTCGATGAA
CGGAGAGCAGCCTCTGCCGATAGACGCGACGATGCAGCAAGTCTATCCGCCCTTTCTCTCGGCTACGACCTCGAC
GACAACAGGGAAGATGGCCTCGCCACAGACGCCCAGTCCGTCACAACATCCCAGCACGACGCCATGATCAACGAC
GAGCTCGAGTCGACGTGGATCCTCAACCTCAGCATGCACTTCCGCGACCGATCCAGAAGGGAAAAGTTCTTCGTC
ACCTATCGAGAAAAGGCAAACGTCTGGCGTCGCGTCACCATCTCTCTCGATTATCGGCTCGCTACGCCCAACTCG
TTGGAGGATGACCTCGTCAACACGCAGTACCAGCGCGAGAAGAGCGCAAAGATTTACGAGGCTATTCGCGAGAGC
CTCCTCGATATCAAGTTTTACGATACCGTCACTAACCTCAAGCTCGAAACTACCAACGGTCGTCTTCACGTGCAT
GTTGTCGAGGATGGCAATGAAATCATCAACTATCCCCTCGTGAAACAGGTTCGACACTTGAGCTGCAAGCGAGTT
CGCGAGCGGGACATTACCTTTGACTCTCACATGTCGGGCTTCGTCTACAAGGTGCGCGTCGACGGCGAGATGCTC
ATCAAGAAGGAGATTCCCAGCCAAGACACCGTCGACGAGTTTCTGTACGAGGTCAACGCCCTCAGCAGCCTGCGC
TTCTCCCGCCACATCGTCACCTTTTACGGCGTCGTCGTCGATGACACGGAGCAGCGCGTCAAGGGCCTGCTGATA
AGCTACGCTTCGCGAGGCGCCCTCATCGACATCATCTACGATCACGGCAAGGCTGGCGGCGGTGGTAGAAGATTG
CCGTGGTCCAGCAAGGAGAAGTGGGCGCGGCAGATGGTTCAGGGTCTGGCCGATATACACGAGTCGGGATTCGTT
CAGGGAGACTTTACCCTGTCCAACATTGTCATCGACGACGCAGACGACGCCAAGATCATCGACATCAACAGGAGG
GGATGTCCTCTCGGATGGGAGCCCCCCGAGGCGACGGCGCTGCTGGAGCTGGGTCACCGGATATCCATGTACATA
GGCGTCAAGTCGGACCTCTACCAGCTGGGAATGGTTCTCTGGGGCCTGGCCATGGACGAGGATGAGCCCGAGGCG
CTCGGCCGGCCTCTACTGTTCGATGGCGGCGCAGACGAGGTGCCCGACTGGTACCGACACATGACGGAGATTTGC
CTCGACGCCGATCCCAGGATGCGCTTACAGGCGTCGACGCTGCTGCAGTTCTTCCCCAAGCACTACGAGGCCATC
TCGGTCGACGACGGCACCTCGCTGAGCGCCTATCTCGTCGACGGCTTCCAGGCCGATGGCCGGCCACTGATGCGG
TCGTGGCCCTGTTCGGGAAGAACGTACGTCGACACGCCCTACGACGTCTCCTTTCCGACGCGAGGCCGATCGCCG
CCGAGTCTGCTGCCGAGTGACCTCGACCTGCGCGAGACGTCACGAGACGCGCTGAGCAAGACGTCGTGGCTCGCC
AACCGGACGGTGAGGCCTTCGTACACGGACATTGACGACGCCATGTCGGAAGCCGCTTCGCTGCGGCACGACGAG
ACGCTCAGGCATGAAGAGACGCCGACGCCGACGGCCTGCAGGCACGGTCACGAGGCAGCGGCTGCCAAGCACGAC
GACGACGATGGCGGCTTCAGGGCAGAGCGGGCGTCTGTTACGGAGACGAATACAGCTGACGAGACGGCACCCGAC
GTGTCACGGGCCGGGGGTTCGCAGGCGGATGGTGACACGGCAGACGTCGTACGCAGTGCCATCTTCCGAGAGACG
AGGGCGGGCTCCGATGACGGGGCTGAGATGAAGGGGGGTCCGGATCCGGAGCCGAAGCAGGAGGGCACTGCTACC
ACGACGATGGACGGGCCACGTCCATCTTGTCACCAGCAGGAAAGCGACGACGCAGAGGAGCCCGAGTACGTGGCG
GCGCAGCAGATGGCCAGCGGGTTGCACGACTGGACGACGACGACGACGACGTCACTGCCCTTGTCGCTGACGGGG
GTGGGAGCTGCGCACATAGACATTGACGAGGAGAGGATGCGAGAGAAGAGTATTCTGGATGACGATGATGATGAT
GATGTTGATGATGACTTTGGCGCCCTGATGCGGCCGGCGACGGTCCCGGTGTTGATGACGATGACGGTGACGGAC
AGAAGCGGGCGGTCATGA
Gene >Ophun1|7437
ATGACGGACGAGACGGATCATGTGAAGCCGGCTCTCTGGCGTCGCATCTTGGGCAAGCCCGGTGTCACGCCGCTT
CCGCCTCCGGTTCTTTCCGTTCCGGCTCTCTCCACTCCGGCCCTCTCCACTCCGGCCACCTCCACTCCGGCCCTC
TCCCCTCCGGCCCTCTCCCCTCCTCCAAACGCAGAGTCCAAGCTCCCGGCTAGAAAAGTGGTCACCGGCCTGCCC
CGGGCCCAGACGTTCAAGAGGCAGCAGTCGGAGCAGCGCGTCCATCTATCGCCCATCACCACCTCTCTCGATGAA
CGGAGAGCAGCCTCTGCCGATAGACGCGACGATGCAGCAAGTCTATCCGCCCTTTCTCTCGGCTACGACCTCGAC
GACAACAGGGAAGATGGCCTCGCCACAGACGCCCAGTCCGTCACAACATCCCAGCACGACGCCATGATCAACGAC
GAGCTCGAGTCGACGTGGATCCTCAACCTCAGCATGCACTTCCGCGACCGATCCAGAAGGGAAAAGTTCTTCGTC
ACCTATCGAGAAAAGGCAAACGTCTGGCGTCGCGTCACCATCTCTCTCGATTATCGGCTCGCTACGCCCAACTCG
TTGGAGGATGACCTCGTCAACACGCAGTACCAGCGCGAGAAGAGCGCAAAGATTTACGAGGCTATTCGCGAGAGC
CTCCTCGATATCAAGTTTTACGATACCGTCACTAACCTCAAGCTCGAAACTACCAACGGTCGTCTTCACGTGCAT
GTTGTCGAGGATGGCAATGTGAGTTGACGGCTTTCACCCCCCTTTTCTATATCTTGTGCTCACTAAGGGGGCGCA
GGAAATCATCAACTATCCCCTCGTGAAACAGGTTCGACACTTGAGCTGCAAGCGAGTTCGCGAGCGGGACATTAC
CTTTGACTCTCACATGTCGGGCTTCGTCTACAAGGTGCGCGTCGACGGCGAGATGCTCATCAAGAAGGAGATTCC
CAGCCAAGACACCGTCGACGAGTTTCTGTACGAGGTCAACGCCCTCAGCAGCCTGCGCTTCTCCCGCCACATCGT
CACCTTTTACGGCGTCGTCGTCGATGACACGGAGCAGCGCGTCAAGGGCCTGCTGATAAGCTACGCTTCGCGAGG
CGCCCTCATCGACATCATCTACGATCACGGCAAGGCTGGCGGCGGTGGTAGAAGATTGCCGTGGTCCAGCAAGGA
GAAGTGGGCGCGGCAGATGGTTCAGGGTCTGGCCGATATACACGAGTCGGGATTCGTTCAGGGAGACTTTACCCT
GTCCAACATTGTCATCGACGACGCAGACGACGCCAAGATCATCGACATCAACAGGAGGGGATGTCCTCTCGGATG
GGAGCCCCCCGAGGCGACGGCGCTGCTGGAGCTGGGTCACCGGATATCCATGTACATAGGCGTCAAGTCGGACCT
CTACCAGCTGGGAATGGTTCTCTGGGGCCTGGCCATGGACGAGGATGAGCCCGAGGCGCTCGGCCGGCCTCTACT
GTTCGATGGCGGCGCAGACGAGGTGCCCGACTGGTACCGACACATGACGGAGATTTGCCTCGACGCCGATCCCAG
GATGCGCTTACAGGCGTCGACGCTGCTGCAGTTCTTCCCCAAGCACTACGAGGCCATCTCGGTCGACGACGGCAC
CTCGCTGAGCGCCTATCTCGTCGACGGCTTCCAGGCCGATGGCCGGCCACTGATGCGGTCGTGGCCCTGTTCGGG
AAGAACGTACGTCGACACGCCCTACGACGTCTCCTTTCCGACGCGAGGCCGATCGCCGCCGAGTCTGCTGCCGAG
TGACCTCGACCTGCGCGAGACGTCACGAGACGCGCTGAGCAAGACGTCGTGGCTCGCCAACCGGACGGTGAGGCC
TTCGTACACGGACATTGACGACGCCATGTCGGAAGCCGCTTCGCTGCGGCACGACGAGACGCTCAGGCATGAAGA
GACGCCGACGCCGACGGCCTGCAGGCACGGTCACGAGGCAGCGGCTGCCAAGCACGACGACGACGATGGCGGCTT
CAGGGCAGAGCGGGCGTCTGTTACGGAGACGAATACAGCTGACGAGACGGCACCCGACGTGTCACGGGCCGGGGG
TTCGCAGGCGGATGGTGACACGGCAGACGTCGTACGCAGTGCCATCTTCCGAGAGACGAGGGCGGGCTCCGATGA
CGGGGCTGAGATGAAGGGGGGTCCGGATCCGGAGCCGAAGCAGGAGGGCACTGCTACCACGACGATGGACGGGCC
ACGTCCATCTTGTCACCAGCAGGAAAGCGACGACGCAGAGGAGCCCGAGTACGTGGCGGCGCAGCAGATGGCCAG
CGGGTTGCACGACTGGACGACGACGACGACGACGTCACTGCCCTTGTCGCTGACGGGGGTGGGAGCTGCGCACAT
AGACATTGACGAGGAGAGGATGCGAGAGAAGAGTATTCTGGATGACGATGATGATGATGATGTTGATGATGACTT
TGGCGCCCTGATGCGGCCGGCGACGGTCCCGGTGTTGATGACGATGACGGTGACGGACAGAAGCGGGCGGTCATG
A

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail