Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7434
Gene name
LocationContig_933:824..2402
Strand+
Gene length (bp)1578
Transcript length (bp)1182
Coding sequence length (bp)1182
Protein length (aa) 394

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05368 NmrA NmrA-like family 3.8E-14 67 291
PF13460 NAD_binding_10 NAD(P)H-binding 2.0E-13 71 215
PF01370 Epimerase NAD dependent epimerase/dehydratase family 5.6E-13 67 186
PF01073 3Beta_HSD 3-beta hydroxysteroid dehydrogenase/isomerase family 3.1E-08 69 182
PF16363 GDP_Man_Dehyd GDP-mannose 4,6 dehydratase 1.5E-07 69 179

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P25284|NDUA9_NEUCR NADH-ubiquinone oxidoreductase 40 kDa subunit, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nuo40 PE=1 SV=2 2 390 0.0E+00
sp|Q559Z0|NDUA9_DICDI NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial OS=Dictyostelium discoideum GN=ndufa9 PE=3 SV=1 63 348 1.0E-46
sp|Q16795|NDUA9_HUMAN NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial OS=Homo sapiens GN=NDUFA9 PE=1 SV=2 15 375 6.0E-45
sp|Q0MQB3|NDUA9_GORGO NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial OS=Gorilla gorilla gorilla GN=NDUFA9 PE=2 SV=2 15 375 9.0E-45
sp|P0CB82|NDUA9_PONPY NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial OS=Pongo pygmaeus GN=NDUFA9 PE=2 SV=1 62 375 2.0E-44
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P25284|NDUA9_NEUCR NADH-ubiquinone oxidoreductase 40 kDa subunit, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nuo40 PE=1 SV=2 2 390 0.0E+00
sp|Q559Z0|NDUA9_DICDI NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial OS=Dictyostelium discoideum GN=ndufa9 PE=3 SV=1 63 348 1.0E-46
sp|Q16795|NDUA9_HUMAN NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial OS=Homo sapiens GN=NDUFA9 PE=1 SV=2 15 375 6.0E-45
sp|Q0MQB3|NDUA9_GORGO NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial OS=Gorilla gorilla gorilla GN=NDUFA9 PE=2 SV=2 15 375 9.0E-45
sp|P0CB82|NDUA9_PONPY NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial OS=Pongo pygmaeus GN=NDUFA9 PE=2 SV=1 62 375 2.0E-44
sp|P0CB81|NDUA9_PONAB NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial OS=Pongo abelii GN=NDUFA9 PE=2 SV=1 62 375 2.0E-44
sp|Q0MQB4|NDUA9_PANTR NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial OS=Pan troglodytes GN=NDUFA9 PE=2 SV=1 15 375 3.0E-44
sp|Q5BK63|NDUA9_RAT NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial OS=Rattus norvegicus GN=Ndufa9 PE=1 SV=2 62 350 4.0E-44
sp|Q9SK66|NDUA9_ARATH NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial OS=Arabidopsis thaliana GN=At2g20360 PE=1 SV=2 21 365 3.0E-42
sp|Q9DC69|NDUA9_MOUSE NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial OS=Mus musculus GN=Ndufa9 PE=1 SV=2 62 350 4.0E-42
sp|P34943|NDUA9_BOVIN NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial OS=Bos taurus GN=NDUFA9 PE=1 SV=1 62 281 2.0E-40
[Show less]

GO

GO Term Description Terminal node
GO:0003854 3-beta-hydroxy-delta5-steroid dehydrogenase activity Yes
GO:0006694 steroid biosynthetic process Yes
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor Yes
GO:0016229 steroid dehydrogenase activity No
GO:0008610 lipid biosynthetic process No
GO:0044238 primary metabolic process No
GO:0006629 lipid metabolic process No
GO:0003824 catalytic activity No
GO:0009058 biosynthetic process No
GO:0008152 metabolic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0003674 molecular_function No
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors No
GO:0008202 steroid metabolic process No
GO:0008150 biological_process No
GO:0033764 steroid dehydrogenase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor No
GO:0016491 oxidoreductase activity No
GO:1901360 organic cyclic compound metabolic process No
GO:0071704 organic substance metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5343
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2535
Ophiocordyceps australis map64 (Brazil) OphauB2|4881
Ophiocordyceps camponoti-floridani Ophcf2|00084
Ophiocordyceps camponoti-rufipedis Ophun1|7434 (this protein)
Ophiocordyceps kimflemingae Ophio5|1191
Ophiocordyceps subramaniannii Hirsu2|5124

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7434
MMRSLAPAAVRQAYAGAFKDRFVSDLSISRTGNPVKRIVGGRSSLGGEGHILYRSYLILKRLTGHNVTVFGATGQ
LGRYVVNRLARRGCTVVVPFREEMAKRHLKVAGDLGKVVFIEFDLRNTASIEACVRHADTVYNLIGRNYPTKNFS
LDDVHVEGTDRITEAVKKYDVDRYIHVSSYNANPASKSEFFSSKSMKGRGEQVARSNLPQSTLVRPAPIFGFEDN
LLLKLASSILFTANHMREKFWPVHSIDVGEALEKMLDDDSTAGQTFELFGPRMYTMAQIKSMVDRETFTKKRHVN
VPKAILRPLAQVLNRVLWWHTLSADEVEREFIDQVIDATAKTFKDLGVHPGDISSFTYHYLQGFRSSNYYDLPPA
TEKEKKEEKKYIHVLNEL*
Coding >Ophun1|7434
ATGATGAGGTCTTTGGCTCCCGCAGCCGTACGTCAGGCGTACGCTGGCGCATTTAAAGACCGCTTTGTGTCCGAT
CTTTCCATTTCTCGCACCGGCAATCCTGTGAAACGCATAGTGGGTGGTCGATCGTCTCTTGGAGGTGAAGGTCAC
ATACTTTATCGAAGCTACTTGATTCTAAAGCGTTTGACAGGCCATAATGTCACTGTCTTCGGCGCTACGGGTCAG
CTGGGGAGATATGTCGTGAATCGTCTTGCTCGTCGAGGCTGCACTGTCGTCGTTCCGTTTCGGGAGGAAATGGCG
AAGCGTCACCTGAAAGTTGCTGGAGACCTGGGCAAGGTCGTATTTATCGAATTCGATCTCCGCAACACAGCATCC
ATTGAGGCATGCGTGCGCCATGCGGATACTGTTTATAACTTGATCGGCCGGAATTATCCAACGAAAAACTTTTCC
CTGGATGACGTACATGTCGAAGGCACAGATCGAATCACCGAAGCTGTCAAGAAATATGACGTCGATAGATATATT
CATGTGTCGTCTTATAACGCCAATCCGGCCTCCAAGTCCGAATTCTTCTCCTCCAAGTCCATGAAGGGCAGAGGC
GAGCAAGTTGCGCGATCCAATTTACCGCAGTCGACCTTGGTTCGACCGGCCCCAATATTCGGGTTTGAGGATAAT
CTTCTTCTTAAGCTGGCATCTTCAATATTGTTCACAGCCAACCACATGCGAGAGAAATTTTGGCCTGTCCACTCC
ATTGATGTGGGCGAGGCACTAGAGAAGATGCTCGACGACGACTCTACCGCAGGCCAAACGTTTGAGCTTTTCGGT
CCAAGGATGTACACAATGGCTCAGATCAAGTCTATGGTGGACAGGGAAACATTCACAAAGAAGCGTCACGTGAAC
GTGCCGAAAGCGATACTTCGACCGTTGGCCCAGGTCCTGAATCGTGTTCTATGGTGGCACACGCTATCCGCAGAC
GAGGTAGAACGAGAGTTCATTGACCAGGTCATCGACGCGACGGCAAAGACGTTCAAGGACCTAGGGGTTCATCCT
GGGGATATTTCTAGCTTCACGTATCATTACCTTCAAGGTTTCCGTAGCTCGAACTACTACGACCTACCGCCTGCT
ACGGAAAAAGAAAAGAAAGAAGAGAAGAAATACATTCATGTACTAAACGAGCTATAG
Transcript >Ophun1|7434
ATGATGAGGTCTTTGGCTCCCGCAGCCGTACGTCAGGCGTACGCTGGCGCATTTAAAGACCGCTTTGTGTCCGAT
CTTTCCATTTCTCGCACCGGCAATCCTGTGAAACGCATAGTGGGTGGTCGATCGTCTCTTGGAGGTGAAGGTCAC
ATACTTTATCGAAGCTACTTGATTCTAAAGCGTTTGACAGGCCATAATGTCACTGTCTTCGGCGCTACGGGTCAG
CTGGGGAGATATGTCGTGAATCGTCTTGCTCGTCGAGGCTGCACTGTCGTCGTTCCGTTTCGGGAGGAAATGGCG
AAGCGTCACCTGAAAGTTGCTGGAGACCTGGGCAAGGTCGTATTTATCGAATTCGATCTCCGCAACACAGCATCC
ATTGAGGCATGCGTGCGCCATGCGGATACTGTTTATAACTTGATCGGCCGGAATTATCCAACGAAAAACTTTTCC
CTGGATGACGTACATGTCGAAGGCACAGATCGAATCACCGAAGCTGTCAAGAAATATGACGTCGATAGATATATT
CATGTGTCGTCTTATAACGCCAATCCGGCCTCCAAGTCCGAATTCTTCTCCTCCAAGTCCATGAAGGGCAGAGGC
GAGCAAGTTGCGCGATCCAATTTACCGCAGTCGACCTTGGTTCGACCGGCCCCAATATTCGGGTTTGAGGATAAT
CTTCTTCTTAAGCTGGCATCTTCAATATTGTTCACAGCCAACCACATGCGAGAGAAATTTTGGCCTGTCCACTCC
ATTGATGTGGGCGAGGCACTAGAGAAGATGCTCGACGACGACTCTACCGCAGGCCAAACGTTTGAGCTTTTCGGT
CCAAGGATGTACACAATGGCTCAGATCAAGTCTATGGTGGACAGGGAAACATTCACAAAGAAGCGTCACGTGAAC
GTGCCGAAAGCGATACTTCGACCGTTGGCCCAGGTCCTGAATCGTGTTCTATGGTGGCACACGCTATCCGCAGAC
GAGGTAGAACGAGAGTTCATTGACCAGGTCATCGACGCGACGGCAAAGACGTTCAAGGACCTAGGGGTTCATCCT
GGGGATATTTCTAGCTTCACGTATCATTACCTTCAAGGTTTCCGTAGCTCGAACTACTACGACCTACCGCCTGCT
ACGGAAAAAGAAAAGAAAGAAGAGAAGAAATACATTCATGTACTAAACGAGCTATAG
Gene >Ophun1|7434
ATGATGAGGTCTTTGGCTCCCGCAGCCGTACGTCAGGCGTACGCTGGCGCATTTAAAGACCGCTTTGTGTCCGAT
CTTTCCATTTCTCGCACCGGCAATCCTGTGAAACGCATAGTGGGTGGTCGGTATGTCACTGTTCTCGATCTGGCC
TGCAAGATCTGTACTGATGGATAAACATCTCTAGATCGTCTCTTGGAGGTGAAGGTCACATACTTTATCGAAGCT
ACTTGATTCTAAAGCGTTTGACAGGCCATAATGTCACTGTCTTCGGCGCTACGGGTCAGCTGGGGAGATATGTCG
TGAATCGTCTTGGTCTGTTATCAAGAGGTCATATATTATCTGAACAACAGTTCATCTAACCTGAAATAAGCTCGT
CGAGGCTGCACTGTCGTCGTTCCGTTTCGGGAGGAAATGGCGAAGCGTCACCTGAAAGTTGCTGGAGACCTGGGC
AAGGTCGTATTTATCGTAAGCGTGTATTTGCTATGACTACCTGTATTTCCTGACGATGAACGATTCAGGAATTCG
ATCTCCGCAACACAGCATCCATTGAGGCATGCGTGCGCCATGCGGATACTGTTTATAACTTGATCGGCCGGAATT
ATCCAACGAAGTAGGCTCACACTCCCATACTCGACTACATCCTACTTTAACTTCAGATTTTCTAGAAACTTTTCC
CTGGATGACGTACATGTCGAAGGCACAGATCGAATCACCGAAGCTGTCAAGAAATATGACGTCGATAGATATATT
CATGTGTCGTCTTATAACGCCAATCCGGCCTCCAAGTCCGAATTCTTCTCCTCCAAGGTATGGCATGTCAAAGCT
CTCATCCAAAGACTTCCACGCATCTAAAGTCCATGAAGGGCAGAGGCGAGCAAGTTGCGCGATCCAATTTACCGC
AGTCGACCTTGGTTCGACCGGCCCCAATATTCGGGTTTGAGGATAATCTTCTTCTTAAGCTGGCATCTTCAATAT
TGTTCACAGCCAACCACATGCGAGAGAAATTTTGGCCTGTCCACGTATGTCGCATCCTTAACTCTTATCGCGCAA
GAATGCTGACCGCTCGGTGATTGGACAGTCCATTGATGTGGGCGAGGCACTAGAGAAGATGCTCGACGACGACTC
TACCGCAGGCCAAACGTTTGAGCTTTTCGGTCCAAGGATGTACACAATGGCTCAGATCAAGTCTATGGTGGACAG
GGAAACATTCACAAAGAAGCGTCACGTGAACGTGCCGAAAGCGATACTTCGACCGTTGGCCCAGGTCCTGAATCG
TGTTCTATGGTGGCACACGCTATCCGCAGACGAGGTAGAACGAGAGTTCATTGACCAGGTCATCGACGCGACGGC
AAAGACGTTCAAGGACCTAGGGGTTCATCCTGGGGATATTTCTAGCTTCACGTATCATTACCTTGTGAGTTGCGA
TGATAAGCTTTCGGCGAAAAAGCTAGTAGCCAAGACACTGACATCTGGAAACAGCAAGGTTTCCGTAGCTCGAAC
TACTACGACCTACCGCCTGCTACGGAAAAAGAAAAGAAAGAAGAGAAGAAATACATTCATGTACTAAACGAGCTA
TAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail