Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7426
Gene name
LocationContig_93:35705..37621
Strand+
Gene length (bp)1916
Transcript length (bp)1860
Coding sequence length (bp)1860
Protein length (aa) 620

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05236 TAF4 Transcription initiation factor TFIID component TAF4 family 2.3E-19 327 606

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0006352 DNA-templated transcription, initiation Yes
GO:0005669 transcription factor TFIID complex Yes
GO:0006139 nucleobase-containing compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0044238 primary metabolic process No
GO:0009987 cellular process No
GO:0009058 biosynthetic process No
GO:0008152 metabolic process No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0032991 protein-containing complex No
GO:0140513 nuclear protein-containing complex No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0090575 RNA polymerase II transcription regulator complex No
GO:0006807 nitrogen compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0032774 RNA biosynthetic process No
GO:0090304 nucleic acid metabolic process No
GO:0005667 transcription regulator complex No
GO:0005575 cellular_component No
GO:0018130 heterocycle biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0019438 aromatic compound biosynthetic process No
GO:0046483 heterocycle metabolic process No
GO:0008150 biological_process No
GO:0009059 macromolecule biosynthetic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0016070 RNA metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3984
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3528
Ophiocordyceps australis map64 (Brazil) OphauB2|6528
Ophiocordyceps camponoti-floridani Ophcf2|06616
Ophiocordyceps camponoti-rufipedis Ophun1|7426 (this protein)
Ophiocordyceps kimflemingae Ophio5|7569
Ophiocordyceps subramaniannii Hirsu2|7965

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7426
MAQPQPQATPRAFSPPQHAPSPAPPQAAYTLPPNKRVRTDGPPPSQPASPYPPSPYAASPAAATPPMNVASPSFS
STPPVAPYTNGNTAAGLSLPGARGPSTPPVVVTPQPAPAAAPIYTTATMAPIPATAPPPPMPAANAMGPPQRPAE
RPTKDYEYDVTDSLAGTGIDLRAEEQYMSELFSNALDTSTDARTGFAHYPPGGKGSFYGAGPANQPYGSAASQNQ
EQLAAKAAEQAWVESSMRLAVQKTQEVSDPFLLVALLHRRAEKIAREHNIGLNLEMKNAGQGKMRPPEQFPVPTV
TVRTKPGPDATLVETTGSFIPHDCCLADQLALMSIATKQRVRELVEEANTVAINRQKTAHGEVPEEWASAAAPMN
MENLDPMDWAGEGSPRSSKRSSGDANLGDEAAPPAKKLPRISSIMTVSMRDRARQEREWEEARLRKRQRRKEGGA
DAGATNSRAGSVAPGTPGSMAPESEKTMTKKEMKKSQALKAAEANSHANQNLTSSMFAGLGGKGGLFGKKKTGKT
YDWMNVGRTGGGGTSTSSRATPGPKGPNGTATGSVAAGHSLTTEGRNRLGTWREDRDKGKMIQLRDWVTVLERDG
REAKALSCAYVRLDTAYPK*
Coding >Ophun1|7426
ATGGCTCAGCCTCAGCCGCAGGCCACGCCTCGGGCCTTTTCGCCGCCTCAGCACGCCCCTTCGCCCGCTCCGCCC
CAGGCCGCCTACACGCTCCCTCCCAACAAGCGAGTCCGCACCGACGGACCACCGCCCTCCCAGCCTGCATCGCCA
TACCCTCCGTCGCCTTATGCCGCCAGTCCTGCTGCCGCCACGCCCCCCATGAACGTCGCCTCGCCCAGCTTTTCC
TCGACGCCCCCGGTGGCGCCCTATACCAACGGAAACACCGCGGCCGGTTTGAGCCTCCCGGGCGCGCGCGGCCCC
TCTACGCCTCCCGTCGTCGTGACACCTCAGCCTGCGCCCGCGGCGGCCCCCATCTACACTACCGCCACCATGGCC
CCGATCCCCGCAACGGCACCGCCGCCTCCGATGCCCGCTGCCAACGCCATGGGGCCGCCGCAACGGCCGGCCGAG
AGGCCTACCAAGGACTACGAGTATGACGTGACGGACTCGCTGGCCGGCACCGGCATCGACCTGCGTGCCGAGGAG
CAGTACATGTCGGAGCTCTTCTCCAACGCGCTCGACACCAGCACCGATGCCCGCACCGGCTTCGCCCACTATCCG
CCGGGGGGCAAAGGCTCCTTTTACGGCGCCGGTCCCGCCAATCAACCCTACGGCTCGGCCGCCTCGCAAAACCAG
GAGCAGCTGGCTGCCAAGGCGGCTGAGCAGGCTTGGGTCGAGTCCTCGATGCGTCTGGCCGTGCAGAAGACTCAG
GAGGTCAGCGATCCCTTCCTGCTCGTCGCGCTGCTGCACAGGCGGGCGGAAAAGATTGCGCGAGAGCACAACATC
GGCCTCAACCTGGAAATGAAGAATGCCGGCCAGGGCAAGATGCGGCCGCCTGAACAGTTTCCCGTGCCGACGGTG
ACGGTACGGACGAAGCCTGGGCCCGACGCGACGCTGGTAGAAACGACGGGCTCGTTCATCCCCCATGACTGTTGT
CTCGCGGACCAGCTGGCCCTCATGTCCATCGCCACCAAACAACGAGTGCGCGAGCTCGTCGAAGAGGCCAACACG
GTGGCCATTAACCGCCAGAAGACGGCTCACGGCGAGGTGCCTGAAGAGTGGGCGTCGGCAGCGGCTCCGATGAAC
ATGGAGAATCTGGATCCTATGGACTGGGCTGGAGAGGGCAGCCCAAGGTCATCAAAGCGATCCTCTGGCGATGCA
AACCTGGGAGACGAGGCGGCACCGCCGGCCAAAAAGTTGCCGAGAATCTCATCCATAATGACGGTGTCGATGAGA
GACCGGGCCCGGCAGGAACGCGAGTGGGAAGAGGCCCGGCTACGGAAGCGGCAGCGGCGCAAGGAGGGCGGCGCA
GACGCGGGGGCCACCAACTCGCGGGCGGGAAGCGTGGCTCCCGGAACGCCGGGATCGATGGCGCCGGAGTCGGAG
AAGACGATGACGAAGAAGGAGATGAAGAAGAGTCAGGCGCTCAAGGCGGCCGAGGCGAACAGCCACGCCAATCAG
AACCTGACGAGCAGCATGTTTGCCGGACTGGGGGGCAAGGGCGGGCTATTTGGCAAGAAGAAGACGGGCAAGACG
TACGACTGGATGAACGTGGGCCGGACGGGGGGCGGCGGCACAAGCACGTCATCGCGGGCAACTCCGGGACCCAAA
GGGCCCAACGGAACGGCGACGGGCAGCGTGGCAGCGGGCCACAGCCTGACGACGGAGGGACGCAACCGTCTGGGG
ACGTGGCGGGAAGATCGGGACAAGGGCAAGATGATCCAGCTCCGCGACTGGGTTACGGTGCTGGAGCGGGACGGG
AGGGAGGCCAAGGCGCTGTCTTGTGCGTACGTGCGTCTGGACACGGCGTATCCGAAGTGA
Transcript >Ophun1|7426
ATGGCTCAGCCTCAGCCGCAGGCCACGCCTCGGGCCTTTTCGCCGCCTCAGCACGCCCCTTCGCCCGCTCCGCCC
CAGGCCGCCTACACGCTCCCTCCCAACAAGCGAGTCCGCACCGACGGACCACCGCCCTCCCAGCCTGCATCGCCA
TACCCTCCGTCGCCTTATGCCGCCAGTCCTGCTGCCGCCACGCCCCCCATGAACGTCGCCTCGCCCAGCTTTTCC
TCGACGCCCCCGGTGGCGCCCTATACCAACGGAAACACCGCGGCCGGTTTGAGCCTCCCGGGCGCGCGCGGCCCC
TCTACGCCTCCCGTCGTCGTGACACCTCAGCCTGCGCCCGCGGCGGCCCCCATCTACACTACCGCCACCATGGCC
CCGATCCCCGCAACGGCACCGCCGCCTCCGATGCCCGCTGCCAACGCCATGGGGCCGCCGCAACGGCCGGCCGAG
AGGCCTACCAAGGACTACGAGTATGACGTGACGGACTCGCTGGCCGGCACCGGCATCGACCTGCGTGCCGAGGAG
CAGTACATGTCGGAGCTCTTCTCCAACGCGCTCGACACCAGCACCGATGCCCGCACCGGCTTCGCCCACTATCCG
CCGGGGGGCAAAGGCTCCTTTTACGGCGCCGGTCCCGCCAATCAACCCTACGGCTCGGCCGCCTCGCAAAACCAG
GAGCAGCTGGCTGCCAAGGCGGCTGAGCAGGCTTGGGTCGAGTCCTCGATGCGTCTGGCCGTGCAGAAGACTCAG
GAGGTCAGCGATCCCTTCCTGCTCGTCGCGCTGCTGCACAGGCGGGCGGAAAAGATTGCGCGAGAGCACAACATC
GGCCTCAACCTGGAAATGAAGAATGCCGGCCAGGGCAAGATGCGGCCGCCTGAACAGTTTCCCGTGCCGACGGTG
ACGGTACGGACGAAGCCTGGGCCCGACGCGACGCTGGTAGAAACGACGGGCTCGTTCATCCCCCATGACTGTTGT
CTCGCGGACCAGCTGGCCCTCATGTCCATCGCCACCAAACAACGAGTGCGCGAGCTCGTCGAAGAGGCCAACACG
GTGGCCATTAACCGCCAGAAGACGGCTCACGGCGAGGTGCCTGAAGAGTGGGCGTCGGCAGCGGCTCCGATGAAC
ATGGAGAATCTGGATCCTATGGACTGGGCTGGAGAGGGCAGCCCAAGGTCATCAAAGCGATCCTCTGGCGATGCA
AACCTGGGAGACGAGGCGGCACCGCCGGCCAAAAAGTTGCCGAGAATCTCATCCATAATGACGGTGTCGATGAGA
GACCGGGCCCGGCAGGAACGCGAGTGGGAAGAGGCCCGGCTACGGAAGCGGCAGCGGCGCAAGGAGGGCGGCGCA
GACGCGGGGGCCACCAACTCGCGGGCGGGAAGCGTGGCTCCCGGAACGCCGGGATCGATGGCGCCGGAGTCGGAG
AAGACGATGACGAAGAAGGAGATGAAGAAGAGTCAGGCGCTCAAGGCGGCCGAGGCGAACAGCCACGCCAATCAG
AACCTGACGAGCAGCATGTTTGCCGGACTGGGGGGCAAGGGCGGGCTATTTGGCAAGAAGAAGACGGGCAAGACG
TACGACTGGATGAACGTGGGCCGGACGGGGGGCGGCGGCACAAGCACGTCATCGCGGGCAACTCCGGGACCCAAA
GGGCCCAACGGAACGGCGACGGGCAGCGTGGCAGCGGGCCACAGCCTGACGACGGAGGGACGCAACCGTCTGGGG
ACGTGGCGGGAAGATCGGGACAAGGGCAAGATGATCCAGCTCCGCGACTGGGTTACGGTGCTGGAGCGGGACGGG
AGGGAGGCCAAGGCGCTGTCTTGTGCGTACGTGCGTCTGGACACGGCGTATCCGAAGTGA
Gene >Ophun1|7426
ATGGCTCAGCCTCAGCCGCAGGCCACGCCTCGGGCCTTTTCGCCGCCTCAGCACGCCCCTTCGCCCGCTCCGCCC
CAGGCCGCCTACACGCTCCCTCCCAACAAGCGAGTCCGCACCGACGGACCACCGCCCTCCCAGCCTGCATCGCCA
TACCCTCCGTCGCCTTATGCCGCCAGTCCTGCTGCCGCCACGCCCCCCATGAACGTCGCCTCGCCCAGCTTTTCC
TCGACGCCCCCGGTGGCGCCCTATACCAACGGAAACACCGCGGCCGGTTTGAGCCTCCCGGGCGCGCGCGGCCCC
TCTACGCCTCCCGTCGTCGTGACACCTCAGCCTGCGCCCGCGGCGGCCCCCATCTACACTACCGCCACCATGGCC
CCGATCCCCGCAACGGCACCGCCGCCTCCGATGCCCGCTGCCAACGCCATGGGGCCGCCGCAACGGCCGGCCGAG
AGGCCTACCAAGGACTACGAGTATGACGTGACGGACTCGCTGGCCGGCACCGGCATCGACCTGCGTGCCGAGGAG
CAGTACATGTCGGAGCTCTTCTCCAACGCGCTCGACACCAGCACCGATGCCCGCACCGGCTTCGCCCACTATCCG
CCGGGGGGCAAAGGCTCCTTTTACGGCGCCGGTCCCGCCAATCAACCCTACGGCTCGGCCGCCTCGCAAAACCAG
GAGCAGCTGGCTGCCAAGGCGGCTGAGCAGGCTTGGGTCGAGTCCTCGATGCGTCTGGCCGTGCAGAAGACTCAG
GAGGTCAGCGATCCCTTCCTGCTCGTCGCGCTGCTGCACAGGCGGGCGGAAAAGATTGCGCGAGAGCACAACATC
GGCCTCAACCTGGAAATGAAGAATGCCGGCCAGGGCAAGATGCGGCCGCCTGAACAGTTTCCCGTGCCGACGGTG
ACGGTACGGACGAAGCCTGGGCCCGACGCGACGCTGGTAGAAACGACGGGCTCGTTCATCCCCCATGACTGTTGT
CTCGCGGACCAGCTGGCCCTCATGTCCATCGCCACCAAACAACGAGTGCGCGAGCTCGTCGAAGAGGCCAACACG
GTGGCCATTAACCGCCAGAAGACGGCTCACGGCGAGGTGCCTGAAGAGTGGGCGTCGGCAGCGGCTCCGATGAAC
ATGGAGAATCTGGATCCTATGGACTGGGCTGGAGAGGGCAGCCCAAGGTCATCAAAGCGTAAATGCCCCCCTCAG
ATCTTTGCGGCGATTCACTGACTCGGCTCTCATCAACAGGATCCTCTGGCGATGCAAACCTGGGAGACGAGGCGG
CACCGCCGGCCAAAAAGTTGCCGAGAATCTCATCCATAATGACGGTGTCGATGAGAGACCGGGCCCGGCAGGAAC
GCGAGTGGGAAGAGGCCCGGCTACGGAAGCGGCAGCGGCGCAAGGAGGGCGGCGCAGACGCGGGGGCCACCAACT
CGCGGGCGGGAAGCGTGGCTCCCGGAACGCCGGGATCGATGGCGCCGGAGTCGGAGAAGACGATGACGAAGAAGG
AGATGAAGAAGAGTCAGGCGCTCAAGGCGGCCGAGGCGAACAGCCACGCCAATCAGAACCTGACGAGCAGCATGT
TTGCCGGACTGGGGGGCAAGGGCGGGCTATTTGGCAAGAAGAAGACGGGCAAGACGTACGACTGGATGAACGTGG
GCCGGACGGGGGGCGGCGGCACAAGCACGTCATCGCGGGCAACTCCGGGACCCAAAGGGCCCAACGGAACGGCGA
CGGGCAGCGTGGCAGCGGGCCACAGCCTGACGACGGAGGGACGCAACCGTCTGGGGACGTGGCGGGAAGATCGGG
ACAAGGGCAAGATGATCCAGCTCCGCGACTGGGTTACGGTGCTGGAGCGGGACGGGAGGGAGGCCAAGGCGCTGT
CTTGTGCGTACGTGCGTCTGGACACGGCGTATCCGAAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail