Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7424
Gene name
LocationContig_93:29086..31936
Strand+
Gene length (bp)2850
Transcript length (bp)2586
Coding sequence length (bp)2586
Protein length (aa) 862

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01496 V_ATPase_I V-type ATPase 116kDa subunit family 0.0E+00 32 846

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P32563|VPH1_YEAST V-type proton ATPase subunit a, vacuolar isoform OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPH1 PE=1 SV=3 1 846 0.0E+00
sp|Q8W4S4|VHAA3_ARATH V-type proton ATPase subunit a3 OS=Arabidopsis thaliana GN=VHA-a3 PE=1 SV=1 10 854 0.0E+00
sp|Q9SJT7|VHAA2_ARATH V-type proton ATPase subunit a2 OS=Arabidopsis thaliana GN=VHA-a2 PE=1 SV=1 10 854 0.0E+00
sp|Q54E04|VATM_DICDI Vacuolar proton translocating ATPase 100 kDa subunit OS=Dictyostelium discoideum GN=vatM PE=1 SV=2 10 855 0.0E+00
sp|P15920|VPP2_MOUSE V-type proton ATPase 116 kDa subunit a isoform 2 OS=Mus musculus GN=Atp6v0a2 PE=1 SV=2 9 843 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P32563|VPH1_YEAST V-type proton ATPase subunit a, vacuolar isoform OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPH1 PE=1 SV=3 1 846 0.0E+00
sp|Q8W4S4|VHAA3_ARATH V-type proton ATPase subunit a3 OS=Arabidopsis thaliana GN=VHA-a3 PE=1 SV=1 10 854 0.0E+00
sp|Q9SJT7|VHAA2_ARATH V-type proton ATPase subunit a2 OS=Arabidopsis thaliana GN=VHA-a2 PE=1 SV=1 10 854 0.0E+00
sp|Q54E04|VATM_DICDI Vacuolar proton translocating ATPase 100 kDa subunit OS=Dictyostelium discoideum GN=vatM PE=1 SV=2 10 855 0.0E+00
sp|P15920|VPP2_MOUSE V-type proton ATPase 116 kDa subunit a isoform 2 OS=Mus musculus GN=Atp6v0a2 PE=1 SV=2 9 843 0.0E+00
sp|Q9Y487|VPP2_HUMAN V-type proton ATPase 116 kDa subunit a isoform 2 OS=Homo sapiens GN=ATP6V0A2 PE=1 SV=2 9 849 0.0E+00
sp|O97681|VPP2_BOVIN V-type proton ATPase 116 kDa subunit a isoform 2 OS=Bos taurus GN=ATP6V0A2 PE=2 SV=1 9 849 0.0E+00
sp|Q9HBG4|VPP4_HUMAN V-type proton ATPase 116 kDa subunit a isoform 4 OS=Homo sapiens GN=ATP6V0A4 PE=1 SV=2 9 855 0.0E+00
sp|Q9I8D0|VPP1_CHICK V-type proton ATPase 116 kDa subunit a isoform 1 OS=Gallus gallus GN=ATP6V0A1 PE=1 SV=1 9 851 0.0E+00
sp|Q920R6|VPP4_MOUSE V-type proton ATPase 116 kDa subunit a isoform 4 OS=Mus musculus GN=Atp6v0a4 PE=1 SV=1 9 855 0.0E+00
sp|P30628|VPP1_CAEEL Probable V-type proton ATPase 116 kDa subunit a OS=Caenorhabditis elegans GN=unc-32 PE=2 SV=3 3 860 0.0E+00
sp|Q93050|VPP1_HUMAN V-type proton ATPase 116 kDa subunit a isoform 1 OS=Homo sapiens GN=ATP6V0A1 PE=1 SV=3 9 851 0.0E+00
sp|Q01290|VPH1_NEUCR V-type proton ATPase subunit a OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=vph-1 PE=3 SV=1 1 861 0.0E+00
sp|O13742|VPH1_SCHPO V-type proton ATPase subunit a OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vph1 PE=3 SV=2 9 851 0.0E+00
sp|P37296|STV1_YEAST V-type proton ATPase subunit a, Golgi isoform OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STV1 PE=1 SV=2 4 851 0.0E+00
sp|Q8AVM5|VPP1_XENLA V-type proton ATPase 116 kDa subunit a isoform 1 OS=Xenopus laevis GN=atp6v0a1 PE=2 SV=1 9 851 0.0E+00
sp|Q9Z1G4|VPP1_MOUSE V-type proton ATPase 116 kDa subunit a isoform 1 OS=Mus musculus GN=Atp6v0a1 PE=1 SV=3 9 851 0.0E+00
sp|P25286|VPP1_RAT V-type proton ATPase 116 kDa subunit a isoform 1 OS=Rattus norvegicus GN=Atp6v0a1 PE=2 SV=1 9 851 0.0E+00
sp|A1A5G6|VPP1_XENTR V-type proton ATPase 116 kDa subunit a isoform 1 OS=Xenopus tropicalis GN=atp6v0a1 PE=2 SV=1 9 851 0.0E+00
sp|Q5R422|VPP1_PONAB V-type proton ATPase 116 kDa subunit a isoform 1 OS=Pongo abelii GN=ATP6V0A1 PE=2 SV=1 9 851 0.0E+00
sp|Q29466|VPP1_BOVIN V-type proton ATPase 116 kDa subunit a isoform 1 OS=Bos taurus GN=ATP6V0A1 PE=2 SV=1 9 851 0.0E+00
sp|Q8RWZ7|VHAA1_ARATH V-type proton ATPase subunit a1 OS=Arabidopsis thaliana GN=VHA-a1 PE=2 SV=1 3 849 2.0E-176
sp|Q13488|VPP3_HUMAN V-type proton ATPase 116 kDa subunit a isoform 3 OS=Homo sapiens GN=TCIRG1 PE=1 SV=3 9 848 3.0E-155
sp|Q9HM61|VATI_THEAC V-type ATP synthase subunit I OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=atpI PE=3 SV=1 81 501 1.0E-09
sp|Q9UWW3|VATI_SULSO V-type ATP synthase subunit I OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=atpI PE=3 SV=1 280 487 1.0E-07
sp|Q9UXU2|VATI_PYRAB V-type ATP synthase subunit I OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=atpI PE=3 SV=1 123 496 3.0E-07
sp|O59659|VATI_METMA V-type ATP synthase subunit I OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=atpI PE=3 SV=2 341 450 1.0E-06
sp|Q9YEA0|VATI_AERPE V-type ATP synthase subunit I OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=atpI PE=3 SV=2 736 843 2.0E-06
sp|Q57675|VATI_METJA V-type ATP synthase subunit I OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=atpI PE=3 SV=1 60 455 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0046961 proton-transporting ATPase activity, rotational mechanism Yes
GO:0033179 proton-transporting V-type ATPase, V0 domain Yes
GO:1902600 proton transmembrane transport Yes
GO:0051234 establishment of localization No
GO:0009678 pyrophosphate hydrolysis-driven proton transmembrane transporter activity No
GO:0098660 inorganic ion transmembrane transport No
GO:0006812 cation transport No
GO:0006811 ion transport No
GO:0032991 protein-containing complex No
GO:0042625 ATPase-coupled ion transmembrane transporter activity No
GO:0098796 membrane protein complex No
GO:0140657 ATP-dependent activity No
GO:0034220 ion transmembrane transport No
GO:0098655 cation transmembrane transport No
GO:0008324 cation transmembrane transporter activity No
GO:0009987 cellular process No
GO:0006810 transport No
GO:0098662 inorganic cation transmembrane transport No
GO:0019829 ATPase-coupled cation transmembrane transporter activity No
GO:0003674 molecular_function No
GO:0022857 transmembrane transporter activity No
GO:0015075 ion transmembrane transporter activity No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0015399 primary active transmembrane transporter activity No
GO:0005215 transporter activity No
GO:0015078 proton transmembrane transporter activity No
GO:0008150 biological_process No
GO:0022853 active ion transmembrane transporter activity No
GO:0051179 localization No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0044769 ATPase activity, coupled to transmembrane movement of ions, rotational mechanism No
GO:0005575 cellular_component No
GO:0055085 transmembrane transport No
GO:0033177 proton-transporting two-sector ATPase complex, proton-transporting domain No
GO:0042626 ATPase-coupled transmembrane transporter activity No
GO:0022804 active transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 416 447 31
2 462 484 22
3 550 568 18
4 578 600 22
5 613 632 19
6 647 669 22
7 787 809 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7424
MAPKQDTPFRSADMSMVQLYVSNEIGREVVTALGELGLCQFRDLNEKVSAFQRTYTQEIRRLDNVERQLRYFYAQ
MEKTGIRLKKLDLDRDRLASPSTSEIDELAERSQTLEQRISALNDSYETLKKREGDLTEWRWVLREAGSFFDRAH
GSVEEIRASTDNDDAPLLSDVEQHNTAPEVERSFSGMNIGFVAGVIARERVAAFERILWRTLRGNLYMNQSEIPE
QLIDPSNNEAVQKNVFVIFAHGKEILAKIRKISESMGADVYSVDENSDLRRDQIHEVNNRLDDVQSVLRNTQATL
EAELAQISQSLSAWMVLVAKEKAVYSTLNLFSYDRARRTLIAEAWCPTNDLPLIRSTLQDVTNRAGLSIPSIINE
IRTNQTPPTYIKTNKFTEGFQTIVNAYGTATYQEVNPAMPVIVTFPFLFAVMFGDFGHAVIMLAAALAMIYWEKS
LKKVSFELFAMIFYGRYIALVMAVFSIFTGLVYNDAFSKSMTLFDSAWTYTKPDGYKEGQSVDGQLNDRGYRYPF
GIDSAWHGTDNELLFSNSFKMKMSIILGWAHMTYSLCFAYTNARHFRRPIDIWGNFVPGMIFFQSIFGYLVVCII
YKWCVQWIDIRQGVVIAQPPGLLNMLIYMFLQPGTLDVRLYRGQEVVQVLLLLLAFVQVPVLLFLKPFFLRWEHN
RARARGYRGIGETSRVSALDGDDEHSLANGHGNSLDAEDGVVMLSQDLGGEHDEFDFGEVMIHQVIHTIEFCLNC
VSHTASYLRLWALSLAHQQLSVVLWNMTLGIALKRQGALGVIMIVALFYLWFFLTIAILVCMEGTSAMLHSLRLA
WVESFSKFAEFAGWPFAPFSFATLMEESEELKEYLG*
Coding >Ophun1|7424
ATGGCTCCAAAGCAAGATACGCCGTTCCGCTCGGCGGATATGAGCATGGTGCAGCTGTACGTTTCCAACGAAATC
GGCCGCGAGGTTGTCACGGCCCTCGGCGAGCTTGGACTGTGTCAGTTTCGAGACTTGAACGAGAAAGTGTCTGCT
TTTCAGAGGACGTACACTCAGGAGATCCGCCGTCTGGATAACGTCGAGAGACAGCTCCGCTACTTTTACGCGCAG
ATGGAAAAGACTGGCATCCGTCTCAAGAAGCTCGACTTGGATCGCGACAGGCTGGCGTCCCCCTCGACTTCGGAG
ATTGACGAGCTGGCCGAACGCAGCCAGACGCTCGAGCAGCGCATCTCGGCACTCAACGATAGCTACGAAACGCTC
AAGAAACGAGAGGGCGACTTGACCGAATGGCGCTGGGTTCTGCGCGAGGCTGGTAGTTTCTTTGACCGCGCCCAC
GGCAGCGTCGAGGAGATCCGGGCTTCGACTGATAACGACGACGCGCCCTTGCTCTCCGACGTCGAGCAACATAAC
ACGGCGCCCGAGGTGGAGAGGTCCTTTTCCGGCATGAACATTGGCTTCGTCGCCGGCGTCATCGCTAGGGAGCGT
GTTGCCGCCTTTGAGCGCATCCTCTGGCGCACGCTGCGTGGCAACCTGTACATGAACCAGTCCGAGATACCGGAG
CAGCTCATCGACCCGTCCAACAACGAGGCCGTCCAGAAGAATGTCTTTGTCATCTTTGCCCACGGCAAGGAGATA
TTGGCCAAGATCCGCAAGATATCGGAATCCATGGGGGCCGACGTCTACAGCGTCGACGAGAATAGCGACCTGCGG
CGAGACCAGATCCACGAGGTCAACAACCGGCTCGACGATGTTCAGAGCGTGCTCCGCAACACGCAGGCGACTCTC
GAAGCCGAGCTGGCTCAGATCTCGCAGTCGTTGTCGGCCTGGATGGTTCTCGTGGCCAAGGAAAAGGCCGTCTAC
AGCACGCTCAACCTCTTCTCGTACGACCGTGCGCGCCGCACGCTCATCGCCGAGGCGTGGTGCCCTACCAACGAC
CTGCCGCTGATCCGGTCGACGCTGCAGGACGTCACCAACCGAGCTGGTCTGTCGATCCCGTCCATTATCAATGAG
ATTCGGACCAACCAGACGCCGCCGACGTACATCAAGACCAACAAGTTCACCGAGGGCTTCCAGACCATTGTTAAC
GCCTACGGTACAGCCACCTACCAAGAGGTCAACCCGGCCATGCCCGTCATTGTCACGTTCCCCTTTCTCTTCGCC
GTCATGTTCGGCGACTTTGGCCACGCCGTCATCATGTTGGCGGCGGCGTTGGCCATGATCTACTGGGAAAAGTCG
CTCAAGAAGGTGTCGTTTGAGCTGTTCGCCATGATCTTTTACGGCCGGTACATTGCCCTCGTCATGGCCGTCTTC
TCCATCTTCACGGGACTCGTGTACAACGACGCCTTCTCCAAGTCGATGACGCTTTTCGACAGCGCCTGGACCTAC
ACCAAGCCCGACGGCTACAAGGAAGGCCAGTCGGTCGACGGCCAGCTCAACGACCGCGGCTACCGCTATCCCTTT
GGCATTGATTCGGCCTGGCACGGCACCGACAACGAGCTGCTGTTCAGCAACAGCTTCAAGATGAAGATGAGCATC
ATCCTCGGATGGGCGCACATGACGTACTCGCTGTGCTTCGCCTACACCAACGCCCGGCACTTTCGAAGGCCCATC
GACATCTGGGGCAACTTTGTGCCCGGCATGATCTTCTTCCAGAGCATATTCGGCTACCTGGTCGTCTGCATCATC
TACAAGTGGTGCGTGCAGTGGATCGACATACGCCAAGGCGTCGTCATCGCCCAGCCACCGGGCCTCCTCAACATG
CTCATCTACATGTTCCTCCAGCCCGGCACGCTCGACGTACGGCTGTACCGAGGCCAGGAGGTGGTTCAGGTGCTG
CTACTGCTACTGGCCTTTGTGCAGGTGCCCGTCCTGCTCTTCCTCAAGCCCTTTTTCCTGCGGTGGGAGCACAAC
CGGGCGCGGGCCAGGGGTTATCGTGGCATAGGGGAAACATCCCGCGTTAGCGCCCTGGATGGAGACGACGAGCAT
TCCCTGGCCAACGGGCACGGAAACAGCCTCGACGCCGAAGATGGCGTCGTCATGCTATCGCAGGATCTTGGCGGC
GAGCACGACGAGTTTGACTTTGGCGAGGTCATGATTCATCAAGTCATTCACACCATTGAATTCTGCCTCAACTGC
GTCTCCCACACGGCATCCTACCTCCGCCTCTGGGCCCTCTCCCTCGCCCACCAGCAACTCAGCGTCGTCCTCTGG
AACATGACGCTAGGCATAGCCCTCAAGAGACAGGGCGCACTGGGCGTCATCATGATCGTCGCCCTCTTCTACCTC
TGGTTCTTCCTCACCATCGCCATCCTGGTCTGCATGGAGGGCACCAGCGCCATGCTCCATTCCCTTCGGCTGGCG
TGGGTAGAGTCGTTTTCCAAGTTTGCAGAGTTTGCGGGCTGGCCGTTTGCGCCCTTTTCGTTTGCTACGCTTATG
GAGGAGTCGGAGGAGTTGAAGGAGTATTTGGGATGA
Transcript >Ophun1|7424
ATGGCTCCAAAGCAAGATACGCCGTTCCGCTCGGCGGATATGAGCATGGTGCAGCTGTACGTTTCCAACGAAATC
GGCCGCGAGGTTGTCACGGCCCTCGGCGAGCTTGGACTGTGTCAGTTTCGAGACTTGAACGAGAAAGTGTCTGCT
TTTCAGAGGACGTACACTCAGGAGATCCGCCGTCTGGATAACGTCGAGAGACAGCTCCGCTACTTTTACGCGCAG
ATGGAAAAGACTGGCATCCGTCTCAAGAAGCTCGACTTGGATCGCGACAGGCTGGCGTCCCCCTCGACTTCGGAG
ATTGACGAGCTGGCCGAACGCAGCCAGACGCTCGAGCAGCGCATCTCGGCACTCAACGATAGCTACGAAACGCTC
AAGAAACGAGAGGGCGACTTGACCGAATGGCGCTGGGTTCTGCGCGAGGCTGGTAGTTTCTTTGACCGCGCCCAC
GGCAGCGTCGAGGAGATCCGGGCTTCGACTGATAACGACGACGCGCCCTTGCTCTCCGACGTCGAGCAACATAAC
ACGGCGCCCGAGGTGGAGAGGTCCTTTTCCGGCATGAACATTGGCTTCGTCGCCGGCGTCATCGCTAGGGAGCGT
GTTGCCGCCTTTGAGCGCATCCTCTGGCGCACGCTGCGTGGCAACCTGTACATGAACCAGTCCGAGATACCGGAG
CAGCTCATCGACCCGTCCAACAACGAGGCCGTCCAGAAGAATGTCTTTGTCATCTTTGCCCACGGCAAGGAGATA
TTGGCCAAGATCCGCAAGATATCGGAATCCATGGGGGCCGACGTCTACAGCGTCGACGAGAATAGCGACCTGCGG
CGAGACCAGATCCACGAGGTCAACAACCGGCTCGACGATGTTCAGAGCGTGCTCCGCAACACGCAGGCGACTCTC
GAAGCCGAGCTGGCTCAGATCTCGCAGTCGTTGTCGGCCTGGATGGTTCTCGTGGCCAAGGAAAAGGCCGTCTAC
AGCACGCTCAACCTCTTCTCGTACGACCGTGCGCGCCGCACGCTCATCGCCGAGGCGTGGTGCCCTACCAACGAC
CTGCCGCTGATCCGGTCGACGCTGCAGGACGTCACCAACCGAGCTGGTCTGTCGATCCCGTCCATTATCAATGAG
ATTCGGACCAACCAGACGCCGCCGACGTACATCAAGACCAACAAGTTCACCGAGGGCTTCCAGACCATTGTTAAC
GCCTACGGTACAGCCACCTACCAAGAGGTCAACCCGGCCATGCCCGTCATTGTCACGTTCCCCTTTCTCTTCGCC
GTCATGTTCGGCGACTTTGGCCACGCCGTCATCATGTTGGCGGCGGCGTTGGCCATGATCTACTGGGAAAAGTCG
CTCAAGAAGGTGTCGTTTGAGCTGTTCGCCATGATCTTTTACGGCCGGTACATTGCCCTCGTCATGGCCGTCTTC
TCCATCTTCACGGGACTCGTGTACAACGACGCCTTCTCCAAGTCGATGACGCTTTTCGACAGCGCCTGGACCTAC
ACCAAGCCCGACGGCTACAAGGAAGGCCAGTCGGTCGACGGCCAGCTCAACGACCGCGGCTACCGCTATCCCTTT
GGCATTGATTCGGCCTGGCACGGCACCGACAACGAGCTGCTGTTCAGCAACAGCTTCAAGATGAAGATGAGCATC
ATCCTCGGATGGGCGCACATGACGTACTCGCTGTGCTTCGCCTACACCAACGCCCGGCACTTTCGAAGGCCCATC
GACATCTGGGGCAACTTTGTGCCCGGCATGATCTTCTTCCAGAGCATATTCGGCTACCTGGTCGTCTGCATCATC
TACAAGTGGTGCGTGCAGTGGATCGACATACGCCAAGGCGTCGTCATCGCCCAGCCACCGGGCCTCCTCAACATG
CTCATCTACATGTTCCTCCAGCCCGGCACGCTCGACGTACGGCTGTACCGAGGCCAGGAGGTGGTTCAGGTGCTG
CTACTGCTACTGGCCTTTGTGCAGGTGCCCGTCCTGCTCTTCCTCAAGCCCTTTTTCCTGCGGTGGGAGCACAAC
CGGGCGCGGGCCAGGGGTTATCGTGGCATAGGGGAAACATCCCGCGTTAGCGCCCTGGATGGAGACGACGAGCAT
TCCCTGGCCAACGGGCACGGAAACAGCCTCGACGCCGAAGATGGCGTCGTCATGCTATCGCAGGATCTTGGCGGC
GAGCACGACGAGTTTGACTTTGGCGAGGTCATGATTCATCAAGTCATTCACACCATTGAATTCTGCCTCAACTGC
GTCTCCCACACGGCATCCTACCTCCGCCTCTGGGCCCTCTCCCTCGCCCACCAGCAACTCAGCGTCGTCCTCTGG
AACATGACGCTAGGCATAGCCCTCAAGAGACAGGGCGCACTGGGCGTCATCATGATCGTCGCCCTCTTCTACCTC
TGGTTCTTCCTCACCATCGCCATCCTGGTCTGCATGGAGGGCACCAGCGCCATGCTCCATTCCCTTCGGCTGGCG
TGGGTAGAGTCGTTTTCCAAGTTTGCAGAGTTTGCGGGCTGGCCGTTTGCGCCCTTTTCGTTTGCTACGCTTATG
GAGGAGTCGGAGGAGTTGAAGGAGTATTTGGGATGA
Gene >Ophun1|7424
ATGGCTCCAAAGCAAGATACGCCGTTCCGCTCGGCGGATATGAGCATGGTGCAGCTGTACGTTTCCAACGAAATC
GGCCGCGAGGTTGTCACGGCCCTCGGCGAGCTTGGACTGTGTCAGTTTCGAGACGTACGTCGTCTATCCGTCCTG
TCCTCATCTTCCGGTCCGGGTTTGGCTCACGTGTGGATCTTGTGCAGTTGAACGAGAAAGTGTCTGCTTTTCAGA
GGACGTACACTCAGGAGATCCGCCGTCTGGATAACGTCGAGAGACAGCTCCGTGCGTTGGCCCCCAAGCCCAAAC
CCCTAAGGAGGGTATACTGACCAAGACGCAGGCTACTTTTACGCGCAGATGGAAAAGACTGGCATCCGTCTCAAG
AAGCTCGACTTGGATCGCGACAGGCTGGCGTCCCCCTCGACTTCGGAGATTGACGAGCTGGCCGAACGCAGCCAG
ACGCTCGAGCAGCGCATCTCGGCACTCAACGATAGCTACGAAACGCTCAAGAAACGAGAGGGCGACTTGACCGAA
TGGCGCTGGGTTCTGCGCGAGGCTGGTAGTTTCTTTGACCGCGCCCACGGCAGCGTCGAGGAGATCCGGGCTTCG
ACTGATAACGACGACGCGCCCTTGCTCTCCGACGTCGAGCAACATAACACGGCGCCCGAGGTGGAGAGGTCCTTT
TCCGGCATGAACATTGGCTTCGTCGCCGGCGTCATCGCTAGGGAGCGTGTTGCCGCCTTTGAGCGCATCCTCTGG
CGCACGCTGCGTGGCAACCTGTACATGAACCAGTCCGAGATACCGGAGCAGCTCATCGACCCGTCCAACAACGAG
GCCGTCCAGAAGAATGTCTTTGTCATCTTTGCCCACGGCAAGGAGATATTGGCCAAGATCCGCAAGATATCGGAA
TCCATGGGGGCCGACGTCTACAGCGTCGACGAGAATAGCGACCTGCGGCGAGACCAGATCCACGAGGTCAACAAC
CGGCTCGACGATGTTCAGAGCGTGCTCCGCAACACGCAGGCGACTCTCGAAGCCGAGCTGGCTCAGATCTCGCAG
TCGTTGTCGGCCTGGATGGTTCTCGTGGCCAAGGAAAAGGCCGTCTACAGCACGCTCAACCTCTTCTCGTACGAC
CGTGCGCGCCGCACGCTCATCGCCGAGGCGTGGTGCCCTACCAACGACCTGCCGCTGATCCGGTCGACGCTGCAG
GACGTCACCAACCGAGCTGGTCTGTCGATCCCGTCCATTATCAATGAGATTCGGACCAACCAGACGCCGCCGACG
TACATCAAGACCAACAAGTTCACCGAGGGCTTCCAGACCATTGTTAACGCCTACGGTACAGCCACCTACCAAGAG
GTCAACCCGGCCATGCCCGTCATTGTCACGTTCCCCTTTCTCTTCGCCGTCATGTTCGGCGACTTTGGCCACGCC
GTCATCATGTTGGCGGCGGCGTTGGCCATGATCTACTGGGAAAAGTCGCTCAAGAAGGTGTCGTTTGAGCTGTTC
GCCATGATCTTTTACGGCCGGTACATTGCCCTCGTCATGGCCGTCTTCTCCATCTTCACGGGACTCGTGTACAAC
GACGCCTTCTCCAAGTCGATGACGCTTTTCGACAGCGCCTGGACCTACACCAAGCCCGACGGCTACAAGGAAGGC
CAGTCGGTCGACGGCCAGCTCAACGACCGCGGCTACCGCTATCCCTTTGGCATTGATTCGGCCTGGCACGGCACC
GACAACGAGCTGCTGTTCAGCAACAGCTTCAAGATGAAGATGAGCATCATCCTCGGATGGGCGCACATGACGTAC
TCGCTGTGCTTCGCCTACACCAACGCCCGGCACTTTCGAAGGCCCATCGACATCTGGGGCAACTTTGTGCCCGGC
ATGATCTTCTTCCAGAGCATATTCGGCTACCTGGTCGTCTGCATCATCTACAAGTGGTGCGTGCAGTGGATCGAC
ATACGCCAAGGCGTCGTCATCGCCCAGCCACCGGGCCTCCTCAACATGCTCATCTACATGTTCCTCCAGCCCGGC
ACGCTCGACGTACGGCTGTACCGAGGCCAGGAGGTGGTTCAGGTGCTGCTACTGCTACTGGCCTTTGTGCAGGTG
CCCGTCCTGCTCTTCCTCAAGCCCTTTTTCCTGCGGTGGGAGCACAACCGGGCGCGGGCCAGGGGTTATCGTGGC
ATAGGGGAAACATCCCGCGTTAGCGCCCTGGATGGAGACGACGAGCATTCCCTGGCCAACGGGCACGGAAACAGC
CTCGACGCCGAAGATGGCGTCGTCATGCTATCGCAGGATCTTGGCGGCGAGCACGACGAGTTTGACTTTGGCGAG
GTCATGATTCATCAAGTCATTCACACCATTGGTATGTTTGTTTTTCTCTCTTCTCGGGGGGGGTTATTCTTCCTT
GTTGCTGATGGTGATAGAATTCTGCCTCAACTGCGTCTCCCACACGGCATCCTACCTCCGCCTCTGGGCCCTCTC
CCTCGCCCACCAGCAACTCAGCGTCGTCCTCTGGAACATGACGCTAGGCATAGCCCTCAAGAGACAGGGCGCACT
GGGCGTCATCATGATCGTCGCCCTCTTCTACCTCTGGTTCTTCCTCAGTGAGTTTCTCCTCTCCCTTCCCCCATT
CCTTTTCCCCCTCAGTTAGTATTCCCGATGCTGACCGGGGGGGGGGCAACAGCCATCGCCATCCTGGTCTGCATG
GAGGGCACCAGCGCCATGCTCCATTCCCTTCGGCTGGCGTGGGTAGAGTCGTTTTCCAAGTTTGCAGAGTTTGCG
GGCTGGCCGTTTGCGCCCTTTTCGTTTGCTACGCTTATGGAGGAGTCGGAGGAGTTGAAGGAGTATTTGGGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail